WorldWideScience

Sample records for sapas tepev sif

  1. SIF 3.0

    Science.gov (United States)

    Waters, John K.

    2009-01-01

    This article introduces Schools Interoperability Framework (SIF), a specification for data sharing among educational software applications that has grown to 10 disparate software applications. This new version (code name Columbus) is likely to give districts more vendors to choose from--maybe a lot more--because it will be arriving with a profound…

  2. False Color Image of Volcano Sapas Mons

    Science.gov (United States)

    1991-01-01

    This false-color image shows the volcano Sapas Mons, which is located in the broad equatorial rise called Atla Regio (8 degrees north latitude and 188 degrees east longitude). The area shown is approximately 650 kilometers (404 miles) on a side. Sapas Mons measures about 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high. Its flanks show numerous overlapping lava flows. The dark flows on the lower right are thought to be smoother than the brighter ones near the central part of the volcano. Many of the flows appear to have been erupted along the flanks of the volcano rather than from the summit. This type of flank eruption is common on large volcanoes on Earth, such as the Hawaiian volcanoes. The summit area has two flat-topped mesas, whose smooth tops give a relatively dark appearance in the radar image. Also seen near the summit are groups of pits, some as large as one kilometer (0.6 mile) across. These are thought to have formed when underground chambers of magma were drained through other subsurface tubes and lead to a collapse at the surface. A 20 kilometer-diameter (12-mile diameter) impact crater northeast of the volcano is partially buried by the lava flows. Little was known about Atla Regio prior to Magellan. The new data, acquired in February 1991, show the region to be composed of at least five large volcanoes such as Sapas Mons, which are commonly linked by complex systems of fractures or rift zones. If comparable to similar features on Earth, Atla Regio probably formed when large volumes of molten rock upwelled from areas within the interior of Venus known as'hot spots.' Magellan is a NASA spacecraft mission to map the surface of Venus with imaging radar. The basic scientific instrument is a synthetic aperture radar, or SAR, which can look through the thick clouds perpetually shielding the surface of Venus. Magellan is in orbit around Venus which completes one turn around its axis in 243 Earth days. That period of time, one Venus day

  3. Venus - 3D Perspective View of Sapas Mons

    Science.gov (United States)

    1992-01-01

    Sapas Mons is displayed in the center of this computer-generated three-dimensional perspective view of the surface of Venus. The viewpoint is located 527 kilometers (327 miles) northwest of Sapas Mons at an elevation of 4 kilometers (2.5 miles) above the terrain. Lava flows extend for hundreds of kilometers across the fractured plains shown in the foreground to the base of Sapas Mons. The view is to the southeast with Sapas Mons appearing at the center with Maat Mons located in the background on the horizon. Sapas Mons, a volcano 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high is located at approximately 8 degrees north latitude, 188 degrees east longitude, on the western edge of Atla Regio. Its peak sits at an elevation of 4.5 kilometers (2.8 miles) above the planet's mean elevation. Sapas Mons is named for a Phoenician goddess. The vertical scale in this perspective has been exaggerated 10 times. Rays cast in a computer intersect the surface to create a three-dimensional perspective view. Simulated color and a digital elevation map developed by the U.S. Geological Survey are used to enhance small-scale structure. The simulated hues are based on color images recorded by the Soviet Venera 13 and 14 spacecraft. The image was produced by the Solar System Visualization project and the Magellan Science team at the JPL Multimission Image Processing Laboratory and is a single frame from a video released at the April 22, 1992 news conference.

  4. SAPA Paradigma Baru Sistem Akuntansi Sektor Publik dalam Pelaksanaan Otonomi Daerah

    Directory of Open Access Journals (Sweden)

    Lilis Setiatiti

    2016-01-01

    Full Text Available With the enactment of the law on regional autonomy and its implementing regulations, has led to changes in many aspects of local government birokrase environment. SAPA is a new paradigm scores within the public accounting system in anticipation of the implementation of regional autonomy. SAPA give a new alternative in local government accounting system previously used single entry. SAPA implementation is expected to improve the performance and direction of pemangunan area. By SAPA performance reports will be more comprehensive local, regional wealth will always be detected, accounting more secure, can be used as a reference for more accurate budgeting. Besides, the SAPA accounting information will be more accurate for local governments to make decisions because of the financial statements which are presented not only with cash flow considerations.

  5. SLIGHTLY IRRADIATED FUEL (SIF) INTERIM DISPOSITION PROJECT

    International Nuclear Information System (INIS)

    Norton, S.H.

    2010-01-01

    CH2M HILL Plateau Remediation Company (CH2M HILL PRC) is proud to submit the Slightly Irradiated Fuel (SIF) Interim Disposition Project for consideration by the Project Management Institute as Project of the Year for 2010. The SIF Project was a set of six interrelated sub-projects that delivered unique stand-alone outcomes, which, when integrated, provided a comprehensive and compliant system for storing high risk special nuclear materials. The scope of the six sub-projects included the design, construction, testing, and turnover of the facilities and equipment, which would provide safe, secure, and compliant Special Nuclear Material (SNM) storage capabilities for the SIF material. The project encompassed a broad range of activities, including the following: Five buildings/structures removed, relocated, or built; Two buildings renovated; Structural barriers, fencing, and heavy gates installed; New roadways and parking lots built; Multiple detection and assessment systems installed; New and expanded communication systems developed; Multimedia recording devices added; and A new control room to monitor all materials and systems built. Project challenges were numerous and included the following: An aggressive 17-month schedule to support the high-profile Plutonium Finishing Plant (PFP) decommissioning; Company/contractor changeovers that affected each and every project team member; Project requirements that continually evolved during design and construction due to the performance- and outcome-based nature ofthe security objectives; and Restrictions imposed on all communications due to the sensitive nature of the projects In spite of the significant challenges, the project was delivered on schedule and $2 million under budget, which became a special source of pride that bonded the team. For years, the SIF had been stored at the central Hanford PFP. Because of the weapons-grade piutonium produced and stored there, the PFP had some of the tightest security on the Hanford

  6. SLIGHTLY IRRADIATED FUEL (SIF) INTERIM DISPOSITION PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    NORTON SH

    2010-02-23

    CH2M HILL Plateau Remediation Company (CH2M HILL PRC) is proud to submit the Slightly Irradiated Fuel (SIF) Interim Disposition Project for consideration by the Project Management Institute as Project of the Year for 2010. The SIF Project was a set of six interrelated sub-projects that delivered unique stand-alone outcomes, which, when integrated, provided a comprehensive and compliant system for storing high risk special nuclear materials. The scope of the six sub-projects included the design, construction, testing, and turnover of the facilities and equipment, which would provide safe, secure, and compliant Special Nuclear Material (SNM) storage capabilities for the SIF material. The project encompassed a broad range of activities, including the following: Five buildings/structures removed, relocated, or built; Two buildings renovated; Structural barriers, fencing, and heavy gates installed; New roadways and parking lots built; Multiple detection and assessment systems installed; New and expanded communication systems developed; Multimedia recording devices added; and A new control room to monitor all materials and systems built. Project challenges were numerous and included the following: An aggressive 17-month schedule to support the high-profile Plutonium Finishing Plant (PFP) decommissioning; Company/contractor changeovers that affected each and every project team member; Project requirements that continually evolved during design and construction due to the performance- and outcome-based nature ofthe security objectives; and Restrictions imposed on all communications due to the sensitive nature of the projects In spite of the significant challenges, the project was delivered on schedule and $2 million under budget, which became a special source of pride that bonded the team. For years, the SIF had been stored at the central Hanford PFP. Because of the weapons-grade piutonium produced and stored there, the PFP had some of the tightest security on the Hanford

  7. Dissipative current in SIFS Josephson junctions

    NARCIS (Netherlands)

    Vasenko, A.; Kawabata, S.; Golubov, Alexandre Avraamovitch; Kupriyanov, M. Yu; Hekking, F.W.J.

    2010-01-01

    We investigate superconductor/insulator/ferromagnet/superconductor (SIFS) tunnel Josephson junctions in the dirty limit, using the quasiclassical theory. We consider the case of a strong tunnel barrier such that the left S layer and the right FS bilayer are decoupled. We calculate quantitatively the

  8. East Part of Sapas Mons with Flooded Crater

    Science.gov (United States)

    1991-01-01

    This Magellan image centered near 9.6 degrees north latitude, 189.5 degrees east longitude of an area 140 kilometers (87 miles) by 110 kilometers (68 miles) covers part of the eastern flank of the volcano Sapas Mons on the western edge of Atla Regio. The bright lobate features along the southern and the western part of the image, oriented in northeast to southwest directions, are lava flows that are rough at the 12.6 centimeter wavelength of the radar. These flows range in width from 5 kilometers to 25 kilometers (3 to 16 miles) with lengths of 50 kilometers to 100 kilometers (31 to 62 miles), extending off the area shown here. Additional radar-dark (smooth) flows are also present. The radar-bright linear structures in the northwest part of the image are interpreted to be faults and fractures possibly associated with the emplacement of magma in the subsurface. Located near the center of the image is a 20 kilometer (12 mile) diameter impact crater. This crater is superimposed on a northeast/southwest trending fracture while the southern part of the crater's ejecta blanket is covered by a 6 kilometer (4 mile) wide radar-bright lava flow. These relations indicate that the crater post dates an episode of fracturing and is older than the lava flows covering its southern edge. This is one of only a few places on Venus in which an impact crater is seen to be covered by volcanic deposits.

  9. Sun and Shade leaves, SIF, and Photosynthetic Capacity

    Science.gov (United States)

    Berry, J. A.; Badgley, G.

    2016-12-01

    Recent advances in retrieval of solar induced chlorophyll fluorescence (SIF) have opened up new possibilities for remote sensing of canopy physiology and structure. To date most of the emphasis has been placed on SIF as an indicator of stress and photosynthetic capacity. However, it is clear that canopy structure can also have an influence. To this point, simulations of SIF in land surface models tend to under predict observed variation in SIF. Also, large, systematic differences in SIF from different canopy types seem to correlate well with the photosynthetic capacity of these canopies. SIF emissions from pampered crops can be several-fold that from evergreen, needle-leaf forests. Yet, these may have similar vegetation indices and absorb a similar fraction of incident PAR. SIF photons produced in a conifer canopy do have a lower probability of escaping its dense, clumped foliage. However, this does not explain the correlated differences in photosynthetic rate and SIF. It is useful, in this regard, to consider the separate contributions of sun and shade leaves to the SIF emitted by a canopy. Sun leaves tend to be displayed to intercept the direct solar beam, and these highly illuminated leaves are often visible from above the canopy. Sun leaves produce more SIF and a large fraction of it escapes. Therefore, the intensity of SIF may be a sensitive indicator of the partitioning of absorbed PAR to sun and shade leaves. Many models account tor the different photosynthetic capacity of sun and shade leaves in calculating canopy responses. However, the fraction of leaves in each category is usually parameterized by an assumed leaf angle distribution (e.g. spherical). In reality, the sun/shade fraction can vary over a wide range, and it has been difficult to measure. SIF and possibly near-IR reflectance of canopies can be used to specify this key parameter with obvious importance to understanding photosynthetic rate.

  10. Strain gage based determination of mixed mode SIFs

    Science.gov (United States)

    Murthy, K. S. R. K.; Sarangi, H.; Chakraborty, D.

    2018-05-01

    Accurate determination of mixed mode stress intensity factors (SIFs) is essential in understanding and analysis of mixed mode fracture of engineering components. Only a few strain gage determination of mixed mode SIFs are reported in literatures and those also do not provide any prescription for radial locations of strain gages to ensure accuracy of measurement. The present investigation experimentally demonstrates the efficacy of a proposed methodology for the accurate determination of mixed mode I/II SIFs using strain gages. The proposed approach is based on the modified Dally and Berger's mixed mode technique. Using the proposed methodology appropriate gage locations (optimal locations) for a given configuration have also been suggested ensuring accurate determination of mixed mode SIFs. Experiments have been conducted by locating the gages at optimal and non-optimal locations to study the efficacy of the proposed approach. The experimental results from the present investigation show that highly accurate SIFs (0.064%) can be determined using the proposed approach if the gages are located at the suggested optimal locations. On the other hand, results also show the very high errors (212.22%) in measured SIFs possible if the gages are located at non-optimal locations. The present work thus clearly substantiates the importance of knowing the optimal locations of the strain gages apriori in accurate determination of SIFs.

  11. Constraining the SIF - GPP relationship via estimation of NPQ

    Science.gov (United States)

    Silva, C. E.; Yang, X.; Tang, J.; Lee, J. E.; Cushman, K.; Toh Yuan Kun, L.; Kellner, J. R.

    2016-12-01

    Airborne and satellite measurements of solar-induced fluorescence (SIF) have the potential to improve estimates of gross primary production (GPP). Plants dissipate absorbed photosynthetically active radiation (APAR) among three de-excitation pathways: SIF, photochemical quenching (PQ), which results in electron transport and the production of ATP and NADPH consumed during carbon fixation (i.e., GPP), and heat dissipation via conversion of xanthophyll pigments (non-photochemical quenching: NPQ). As a result, the relationship between SIF and GPP is a function of NPQ and may vary temporally and spatially with environmental conditions (e.g., light and water availability) and plant traits (e.g., leaf N content). Accurate estimates of any one of the de-excitation pathways require measurement of the other two. Here we combine half-hourly measurements of canopy APAR and SIF with eddy covariance estimates of GPP at Harvard Forest to close the canopy radiation budget and infer canopy NPQ throughout the 2013 growing season. We use molecular-level photosynthesis equations to compute PQ (umol photons m-2s-1) from GPP (umol CO2 m-2s-1) and invert an integrated canopy radiative transfer and leaf-level photosynthesis/fluorescence model (SCOPE) to quantify hemispherically and spectrally-integrated SIF emission (umol photons m-2s-1) from single band (760 nm) top-of-canopy SIF measurements. We estimate half-hourly NPQ as the residual required to close the radiation budget (NPQ = APAR - SIF - PQ). Our future work will test estimated NPQ against simultaneously acquired measurements of the photochemical reflectance index (PRI), a spectral index sensitive to xanthopyll pigments. By constraining two of the three de-excitation pathways, simultaneous SIF and PRI measurements are likely to improve GPP estimates, which are crucial to the study of climate - carbon cycle interactions.

  12. Screening for personality disorder in a sample of incarcerated male youth: preliminary validation of the Standardised Assessment of Personality-Abbreviated Scale (SAPAS)

    DEFF Research Database (Denmark)

    Kongerslev, Mickey; Bo, Sune; Simonsen, Erik

    2011-01-01

    Aims: To test the validity of an age-appropriate adaptation of the Standardised Assessment of Personality - Abbreviated Scale (SAPAS) in a sample of incarcerated male youth Method: A sample of incarcerated boys, age 15 to 18, were administered the SAPAS by social workers from the participating pr...

  13. Background of SIFs and Stress Indices for Moment Loadings of Piping Components

    International Nuclear Information System (INIS)

    Wais, E. A.; Rodabaugh, E. C.

    2005-01-01

    This report provides background information, references, and equations for twenty-four piping components (thirteen component SIFs and eleven component stress indices) that justify the values or expressions for the SIFs and indices

  14. Using the SAPAS to identify risk for personality disorders among psychiatric outpatients in India: A feasibility study.

    Science.gov (United States)

    Innocent, Simeon; Podder, Priyanka; Ram, Jai Ranjan; Barnicot, Kirsten; Sen, Piyal

    2018-02-01

    Personality disorders (PDs) are common among psychiatric outpatients and are associated with increased morbidity and worse treatment outcomes. Epidemiological research conducted among this population in Asian countries is limited, reflecting a significant gap in the current literature. One barrier to this research is the lack of appropriate screening tools. The current research assessed the feasibility of using the SAPAS (Standardized Assessment of Personality-Abbreviated Scale) screening tool to identify individuals at high risk of PD in an Indian psychiatric outpatient population and provides an initial estimate of PD prevalence by using a validated diagnostic interview, the ICD-10 International Personality Disorder Examination. The findings suggest that whilst use of the SAPAS was feasible, acceptable to patients and led to clinically useful findings, when using the recommended cut-off score of 4, the SAPAS largely overdiagnoses the risk for PD in psychiatric outpatients in India (positive predictive value = 26.3%). The estimated prevalence of personality disorder in the sample was 11.1%, based on administering the International Personality Disorder Examination diagnostic interview to high-risk patients scoring 4 and above on the SAPAS, which is higher than previous estimates for this population and still likely to be an underestimation. Future studies should translate the measure into Bengali and evaluate its sensitivity and specificity at different cut-off points in order to optimize its use in Indian populations. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  15. Managing Interoperability for GEOSS - A Report from the SIF

    Science.gov (United States)

    Khalsa, S. J.; Actur, D.; Nativi, S.; Browdy, S.; Eglitis, P.

    2009-04-01

    The Global Earth Observation System of Systems (GEOSS) is a coordinating and integrating framework for Earth observing and information systems, which are contributed on a voluntary basis by Members and Participating Organizations of the intergovernmental Group on Earth Observations (GEO). GEOSS exists to support informed decision making for the benefit of society, including the implementation of international environmental treaty obligations. GEO Members and Participating organizations use the GEOSS Common Infrastructure (GCI) to register their Earth observation resources, thereby making them discoverable and consumable by both humans and client applications. Essential to meeting GEO user needs is a process for supporting interoperability of observing, processing, modeling and dissemination capabilities. The GEO Standards and Interoperability Forum (SIF) was created to develop, implement and oversee this process. The SIF supports GEO organizations contributing resources to the GEOSS by helping them understand and work with the GEOSS interoperability guidelines and encouraging them to register their "interoperability arrangements" (standards or other ad hoc arrangements for interoperability) in the GEOSS standards registry, which is part of the GCI. These registered interoperability arrangements support the actual services used to achieve interoperability of systems. By making information about these interoperability arrangements available to users of the GEOSS the SIF enhances the understanding and utility of contributed resources. We describe the procedures that the SIF has enacted to carry out its work. To operate effectively the SIF uses a workflow system and is establishing a set of regional teams and domain experts. In the near term our work has focused on population and review of the GEOSS Standards Registry, but we are also developing approaches to achieving progressive convergence on, and uptake of, an optimal set of interoperability arrangements for all of

  16. Measuring solar induced chlorophyll fluorescence (SIF) in the Amazon rainforest

    Science.gov (United States)

    Kornfeld, A.; Stutz, J.; Berry, J. A.

    2016-12-01

    Measurement of solar induced chlorophyll fluorescence (SIF) has, in our hands, been fraught with missteps and puzzling problems. Here we describe lessons we have learned and the resulting novel system recently installed in the Amazon rainforest near Manaus, Brazil. The system is designed to measure light from 740 - 780 nm, enabling us to compare SIF computed from Fraunhofer lines in an optically transparent band of the atmosphere (745 - 759 nm) with SIF computed using the telluric O2A band (760 - 770 nm). Fraunhofer line analysis requires high optical resolution (better than 0.2 nm) to detect the relatively narrow lines, but we discovered that fiber-optic diffraction-grating spectrometers are sensitive to very small inhomogeneities in the lighting. Errors resulting from this autocorrelated but random noise were similar in magnitude to the SIF signal itself. Optical diffusers reduce this problem, leading to our final design: a sealed cylinder, dubbed Rotaprism, in which a rotatable prism selects whether light from upward- or downward-looking windows enters an axially-placed optical fiber. Cosine-correcting opal glass covering the windows not only solves the noise issue but also makes the measurements correspond to photon flux. Rotaprism also maximizes the amount of light reaching the spectrometer - maximizing the signal:noise ratio - by avoiding the need for lossy optical switches and fiber splitters. Rotaprism is driven by a pneumatic actuator that is controlled by electronic valves attached to a pressurized N2 source. The gas exhausts into the temperature-controlled spectrometer enclosure to help purge the optics. Finally, custom software provides fault-tolerant control and data acquisition, ensuring that measurements continue with little or no intervention at the remote field site despite unreliable power. Analysis of initial data demonstrates the advantage of Fraunhofer line SIF analysis: due to the atmosphere transparency in this band, the results are more

  17. Clinical utility of Standardised Assessment of Personality - Abbreviated Scale (SAPAS) among patients with first episode depression

    DEFF Research Database (Denmark)

    Bukh, Jens Drachmann; Bock, Camilla; Vinberg, Maj

    2010-01-01

    for comorbid personality disorder among patients suffering from depression would be of clinical use. METHOD: The present study aimed to assess the utility of the Standardised Assessment of Personality - Abbreviated Scale (SAPAS) as a screen for personality disorder in a population of patients recently......BACKGROUND: Personality disorder frequently co-occurs with depression and seems to be associated with a poorer outcome of treatment and increased risk for recurrences. However, the diagnosing of personality disorder can be lengthy and requires some training. Therefore, a brief screening interview...... diagnosed with first episode depression. A total number of 394 patients with an ICD-10 diagnosis of a single depressive episode were sampled consecutively via the Danish Psychiatric Central Research Register during a 2years inclusion period and assessed by the screening interview and, subsequently...

  18. He Sapa Bloketu Woecun: Remote Sensing at the Heart of Everything That Is

    Science.gov (United States)

    Bolman, J. R.

    2007-12-01

    We are living in a definite time of change. Distinct changes are being experienced in our most sacred and natural environments. This is especially true on Native Tribal lands. Native people have lived for millennia in distinct and unique ways. The knowledge of balancing the needs of people with the needs of our natural environments is paramount in all tribal societies. This inherent knowledge has become the foundation on which to build a "woven" contemporary understanding of western science and geospatial technologies. The Upper Midwest Aerospace Consortium (UMAC) and the Native Tribes of South Dakota and Northern California have recognized the critical need in developing an understanding of and proficiency in the application of geospatial technologies (remote sensing). The presentation will highlight: 1) the current use of remote sensing in Native Tribal communities of the Great Plains and Northern California; 2) successful partnerships between Native communities, Tribal Colleges, public Universities and private organizations; 3) how to address balancing the needs of the people with the needs of the environment (Climate Change); and 4) the critical need for developing strong Native Leaders, experienced in remote sensing, to lead Tribal, local, state and national communities through the challenges presented by Climate Change. Humboldt State University (HSU) and the Upper Midwest Aerospace Consortium (UMAC) have been recognized nationally for their STEM partnerships with Native Tribal communities. Unique collaborations are emerging "bridging" Native Tribal people across geographic areas in developing remote sensing programs/projects which integrate the distinctive Traditional Ecological Knowledge (TEK) of Native Tribal people. Focus will be placed on the currently funded UMAC & NSF OEDG Project "He Sapa Bloketu Woecun" and the application of geospatial technologies (remote sensing) in the sacred sites of the Black Hills as well as Northern California.

  19. Patterns of deformation and volcanic flows associated with lithospheric loading by large volcanoes on Venus

    Science.gov (United States)

    Mcgovern, Patrick J.; Solomon, Sean C.

    1993-01-01

    Magellan radar imaging and topography data are now available for a number of volcanoes on Venus greater than 100 km in radius. These data can be examined to reveal evidence of the flexural response of the lithosphere to the volcanic load. On Venus, erosion and sediment deposition are negligible, so tectonic evidence of deformation around large volcanoes should be evident except where buried by very young flows. Radar images reveal that most tectonic features and flow units on the flanks of these volcanoes have predominantly radial orientations. However, both Tepev Mons in Bell Regio and Sapas Mons in Atla Regio exhibit circumferential graben on their flanks. In addition, images reveal several flow units with an annular character around the north and west flanks of Tepev Mons. This pattern most likely results from ponding of flows in an annular flexural moat. Maat Mons in Atla Regio and Sif Mons in Eistla Regio are examples of volcanoes that lack circumferential graben and annular flows; discernible flow units and fractures on these constructs appear to be predominantly radial. Altimetry data can also provide evidence of flexural response. Tepev Mons is partially encircled by depressions that may be sections of a flexural moat that has not been completely filled. The locations of these depressions generally coincide with the annular flows described above. There is weaker evidence for such depressions around Maat Mons as well. The lack of circumferential tectonic features around most volcanoes on Venus might be explained by gradual moat filling and coverage by radial flows. The depressions around Tepev (and possible Maat) may indicate that this process is currently continuing. We use analytic models of plate flexure in an axisymmetric geometry to constrain the elastic plate thickness supporting Tepev Mons. If we consider the outer radius of the ponded flows to be the edge of a moat, we find that models with elastic plate thickness of 10-20 km fit best. Finite element

  20. Josephson effect in SIFS junctions at arbitrary scattering

    International Nuclear Information System (INIS)

    Pugach, N. G.; Kupriyanov, M. Yu.; Goldobin, E.; Koelle, D.; Kleiner, R.

    2011-01-01

    Full text: The interplay between dirty and clean limits in Superconductor-Ferromagnet-Superconductor (SFS) Josephson junctions is a subject of intensive theoretical studies. SIFS junctions, containing an additional insulator (I) barrier are interesting as potential logic elements in superconducting circuits, since their critical current I c can be tuned over a wide range, still keeping a high I c R N product, where R N is the normal resistance of the junction. They are also a convenient model system for a comparative study of the 0-π transitions for arbitrary relations between characteristic lengths of the F-layer: the layer thickness d, the mean free path l, the magnetic length ξ H =v F /2H, and the nonmagnetic coherence length ξ 0 =v F /2πT, where v F is the Fermi velocity, H is the exchange magnetic energy, and T is the temperature. The spatial variations of the order parameter are described by the complex coherent length in the ferromagnet ξ F -1 = ξ 1 -1 + iξ 2 -1 . It is well known, that in the dirty limit (l 1,2 ) described by the Usadel equations both ξ 1 2 = ξ 2 2 = v F l/3H. In this work the spatial distribution of the anomalous Green's functions and the Josephson current in the SIFS junction are calculated. The linearized Eilenberger equations are solved together with the Zaitsev boundary conditions. This allows comparing the dirty and the clean limits, investigating a moderate disorder, and establishing the applicability limits of the Usadel equations for such structures. We demonstrate that for an arbitrary relation between l, ξ H , and d the spatial distribution of the anomalous Green's function can be approximated by a single exponent with reasonable accuracy, and we find its effective decay length and oscillation period for several values of ξ H , l and d. The role of different types of the FS interface is analyzed. The applicability range of the Usadel equation is established. The results of calculations have been applied to the

  1. Reactividad del antígeno GST-SAPA de Trypanosoma cruzi frente a sueros de pacientes con enfermedad de Chagas y leishmaniasis Reactivity of GST-SAPA antigen of Trypanosoma cruzi against sera from patients with Chagas disease and leishmaniasis

    Directory of Open Access Journals (Sweden)

    José Gil

    2011-04-01

    Full Text Available El diagnóstico serológico de la infección producida por Trypanosoma cruzi es de especial relevancia dado que los métodos parasitológicos tienen, en las fases indeterminada y crónica, una sensibilidad limitada. El antígeno SAPA fue usado en diversos estudios y demostró ser un buen candidato para el diagnóstico de la infección por T. cruzi. La enfermedad de Chagas y la leishmaniasis son endémicas en el norte de Salta, con posibles zonas de solapamiento. Este hecho suele dar lugar a infecciones mixtas T. cruzi-Leishmania spp., con la consecuente probabilidad de diagnóstico cruzado cuando se usan antígenos no específicos. Se evaluó la reactividad del antígeno GST-SAPA en la prueba de ELISA (ELISA-SAPA frente a sueros de personas infectadas por T. cruzi (n = 154, con leishmaniasis (n = 66, infecciones mixtas (n = 29 y controles negativos (n = 28, usando como pruebas de referencia para el diagnóstico de la infección por T. cruzi kits comerciales de ELISA y HAI. Se calculó la sensibilidad, especificidad e índice de concordancia kappa de la prueba de ELISA-SAPA, para la detección de infección por T. cruzi. Entre los sueros de pacientes con leishmaniasis estudiados se detectó un 30.5% de infecciones mixtas. Para la detección de infección por T. cruzi, ELISA-SAPA mostró una sensibilidad del 97.1% (intervalo de confianza del 95%: 94.5-99.9, una especificidad del 100% (intervalo de confianza del 95%: 99.5-100 y un índice de concordancia kappa de 96 (intervalo de confianza del 95%:93-99%, comparado con las pruebas serológicas comerciales. Los valores de sensibilidad, especificidad y concordancia calculados muestran una alta eficiencia de ELISA-SAPA.Serologic diagnosis of Trypanosoma cruzi infection is important due to the limited sensitivity of direct parasitologic methods for diagnosis in the indeterminate and chronic phases of disease. SAPA antigen has been used in several studies and has been shown to be a good marker for use

  2. Orientational ordering and site structure of SiF4 trapped in rare gas solids

    Science.gov (United States)

    Jones, Llewellyn H.; Swanson, Basil I.; Ekberg, Scott A.

    1984-12-01

    The infrared spectrum of the ν3 mode of SiF4 shows only one site with marked site-symmetry splitting accompanied by pronounced (>95%) orientational ordering. The results indicate a site symmetry of C3v with the SiF4 molecule occupying a four-atom substitutional site with a cubic-close-packed environment. In krypton and xenon matrices, however, SiF4 occupies a three-atom substitutional site. The fact that SiF4 shows only one dominant site when present in argon matrices of UF6 indicates that one of the two UF6 sites has a local hexagonal close packed environment induced by short range stacking faults.

  3. Comparing the engineering program feeders from SiF and convention models

    Science.gov (United States)

    Roongruangsri, Warawaran; Moonpa, Niwat; Vuthijumnonk, Janyawat; Sangsuwan, Kampanart

    2018-01-01

    This research aims to compare the relationship between two types of engineering program feeder models within the technical education systems of Rajamangala University of Technology Lanna (RMUTL), Chiangmai, Thailand. To illustrate, the paper refers to two typologies of feeder models, which are the convention and the school in factory (SiF) models. The new SiF model is developed through a collaborative educational process between the sectors of industry, government and academia, using work-integrated learning. The research methodology were use to compared features of the the SiF model with conventional models in terms of learning outcome, funding budget for the study, the advantages and disadvantages from the point of view of students, professors, the university, government and industrial partners. The results of this research indicate that the developed SiF feeder model is the most pertinent ones as it meet the requirements of the university, the government and the industry. The SiF feeder model showed the ability to yield positive learning outcomes with low expenditures per student for both the family and the university. In parallel, the sharing of knowledge between university and industry became increasingly important in the process, which resulted in the improvement of industrial skills for professors and an increase in industrial based research for the university. The SiF feeder model meets its demand of public policy in supporting a skilled workforce for the industry, which could be an effective tool for the triple helix educational model of Thailand.

  4. Sequence of phase transitions in (NH4)3SiF7.

    Science.gov (United States)

    Mel'nikova, S V; Molokeev, M S; Laptash, N M; Pogoreltsev, E I; Misyul, S V; Flerov, I N

    2017-02-21

    Single crystals of silicon double salt (NH 4 ) 3 SiF 7 = (NH 4 ) 2 SiF 6 ·NH 4 F = (NH 4 ) 3 [SiF 6 ]F were grown and studied by the methods of polarization optics, X-ray diffraction and calorimetry. A sequence of symmetry transformations with the temperature change was established: P4/mbm (Z = 2) (G 1 ) ↔ Pbam (Z = 4) (G 2 ) ↔ P2 1 /c (Z = 4) (G 3 ) ↔ P1[combining macron] (Z = 4) (G 4 ) ↔ P2 1 /c (Z = 8) (G 5 ). Crystal structures of different phases were determined. The experimental data were also interpreted by a group-theoretical analysis of the complete condensate of order parameters taking into account critical and noncritical atomic displacements. Strengthening of the N-HF hydrogen bonds can be a driving force of the observed phase transitions.

  5. Silicon electrodeposition from chloride-fluoride melts containing K2SiF6 and SiO2

    Directory of Open Access Journals (Sweden)

    Zhuk Sergey I.

    2017-01-01

    Full Text Available Silicon electrodeposition on glassy carbon from the KF-KCl-K2SiF6, KF-KCl-K2SiF6-KOH and KF-KCl-K2SiF6-SiO2 melts was studied by the cyclic voltammetry. Тhe electroreduction of Si(IV to metallic Si was observed as a single 4-electron wave under all considered conditions. The reactions of cathode reduction of silicon from fluoride and oxyfluoride complexes were suggested. It was shown that the process can be controlled by the preliminary transformation of SiO44- to SiF62- and SiOxFyz-. The influence of the current density on structure and morphology of silicon deposits obtained during galvanostatic electrolysis of the KF-KCl-K2SiF6-SiO2 melt was studied.

  6. Optical anomaly in artificial cubic hieratite, K2[SiF6

    NARCIS (Netherlands)

    Göbel, Ole; ten Elshof, Johan E.; Kaminsky, W.; Hannss, M.

    2015-01-01

    Crystals of K2[SiF6] were grown in agar gel, silica gel and jelly. Crystals grown in agar gel or jelly exhibit birefringence and consist of six double refracting growth sectors, each having the shape of a tetragonal pyramid. Nevertheless, the structure of the crystals from agar gel could be refined

  7. High-resolution fluorescence imaging for red and far-red SIF retrieval at leaf and canopy scales

    Science.gov (United States)

    Albert, L.; Alonso, L.; Cushman, K.; Kellner, J. R.

    2017-12-01

    New commercial-off-the-shelf imaging spectrometers promise the combination of high spatial and spectral resolution needed to retrieve solar induced fluorescence (SIF) at multiple wavelengths for individual plants and even individual leaves from low-altitude airborne or ground-based platforms. Data from these instruments could provide insight into the status of the photosynthetic apparatus at scales of space and time not observable from high-altitude and space-based platforms, and could support calibration and validation activities of current and forthcoming space missions to quantify SIF (OCO-2, OCO-3, FLEX, and GEOCARB). High-spectral resolution enables SIF retrieval from regions of strong telluric absorption by molecular oxygen, and also within numerous solar Fraunhofer lines in atmospheric windows not obscured by oxygen or water absorptions. Here we evaluate algorithms for SIF retrieval using a commercial-off-the-shelf diffraction-grating imaging spectrometer with a spectral sampling interval of 0.05 nm and a FWHM 650 or 700 nm. These filters enable a direct measurement of SIF emission > 650 or 700 nm that serves as a benchmark against which retrievals from reflectance spectra can be evaluated. We repeated this comparison between leaf-level SIF emission spectra and retrieved SIF emission spectra for leaves treated with drought stress and an herbicide (DCMU) that inhibits electron transfer from QA to QB of PSII.

  8. Satellite-derived SIF and CO2 Observations Show Coherent Responses to Interannual Climate Variations

    Science.gov (United States)

    Butterfield, Z.; Hogikyan, A.; Kulawik, S. S.; Keppel-Aleks, G.

    2017-12-01

    Gross primary production (GPP) is the single largest carbon flux in the Earth system, but its sensitivity to changes in climate is subject to significant uncertainty. Satellite measurements of solar-induced chlorophyll fluorescence (SIF) offer insight into spatial and temporal patterns in GPP at a global scale and, combined with other satellite-derived datasets, provide unprecedented opportunity to explore interactions between atmospheric CO2, GPP, and climate variability. To explore potential drivers of GPP in the Northern Hemisphere (NH), we compare monthly-averaged SIF data from the Global Ozone Monitoring Experiment 2 (GOME-2) with observed anomalies in temperature (T; CRU-TS), liquid water equivalent (LWE) from the Gravity Recovery and Climate Experiment (GRACE), and photosynthetically active radiation (PAR; CERES SYN1deg). Using observations from 2007 through 2015 for several NH regions, we calculate month-specific sensitivities of SIF to variability in T, LWE, and PAR. These sensitivities provide insight into the seasonal progression of how productivity is affected by climate variability and can be used to effectively model the observed SIF signal. In general, we find that high temperatures are beneficial to productivity in the spring, but detrimental in the summer. The influences of PAR and LWE are more heterogeneous between regions; for example, higher LWE in North American temperate forest leads to decreased springtime productivity, while exhibiting a contrasting effect in water-limited regions. Lastly, we assess the influence of variations in terrestrial productivity on atmospheric carbon using a new lower tropospheric CO2 product derived from the Greenhouse Gases Observing Satellite (GOSAT). Together, these data shed light on the drivers of interannual variability in the annual cycle of NH atmospheric CO2, and may provide improved constraints on projections of long-term carbon cycle responses to climate change.

  9. Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.

  10. Scientist impact factor (SIF): a new metric for improving scientists' evaluation?

    Science.gov (United States)

    Lippi, Giuseppe; Mattiuzzi, Camilla

    2017-08-01

    The publication of scientific research is the mainstay for knowledge dissemination, but is also an essential criterion of scientists' evaluation for recruiting funds and career progression. Although the most widespread approach for evaluating scientists is currently based on the H-index, the total impact factor (IF) and the overall number of citations, these metrics are plagued by some well-known drawbacks. Therefore, with the aim to improve the process of scientists' evaluation, we developed a new and potentially useful indicator of recent scientific output. The new metric scientist impact factor (SIF) was calculated as all citations of articles published in the two years following the publication year of the articles, divided by the overall number of articles published in that year. The metrics was then tested by analyzing data of the 40 top scientists of the local University. No correlation was found between SIF and H-index (r=0.15; P=0.367) or 2 years H-index (r=-0.01; P=0.933), whereas the H-index and 2 years H-index values were found to be highly correlated (r=0.57; Particles published in one year and the total number of citations to these articles in the two following years (r=0.62; Pscientists, wherein the SIF reflects the scientific output over the past two years thus increasing their chances to apply to and obtain competitive funding.

  11. On the knowledge of the (NH4)3SiF7 type of structure

    International Nuclear Information System (INIS)

    Hofmann, B.; Hoppe, R.

    1979-01-01

    New obtained are Rb 3 SiF 7 (a = 7.95 9 ; c = 5.82 3 A), Cs 3 SiF 7 (a = 8.30 6 ; c = 6.17 0 A), Rb 3 TiF 7 (a = 8.20 2 ; c = 5.97 9 A), Cs 3 TiF 7 (a = 8.47 3 ; c = 6.31 3 A). and Cs 2 RbSiF 7 (a = 8.19 8 ; c = 6.01 9 A); Cs 2 KSiF 7 (a = 8.11 5 , c = 5.97 2 A), Rb 2 CsSiF 7 (a = 8.09 9 ; c = 5.89 9 A), Rb 2 KSiF 7 (a = 7.88 3 ; c = 5.72 4 A), all colourless, Rb 3 CrF 7 (a = 8.08 4 ; c = 5.90 2 A), Cs 3 CrF 7 (a 8.39 0 ; c = 6.24 7 A), both pink, K 3 MnF 7 (a = 11.14 6 ; b = 11.00 5 ; c = 5.63 1 A), Rb 3 MnF 7 (a = 8.05 0 ; c = 5.89 0 A), Cs 3 MnF 7 (a 8.36 9 ; c = 6.23 3 A), each lemon yellow, and Rb 3 NiF 7 (a = 7.97 8 ; c = 5.85 7 A) and Cs 3 NiF 7 (a = 8.30 7 ; c = 6.19 2 A), both bright carmine red. Proposals for structure, due to Guinier-Simon powder datas (Cu-Kα), are based on the assumption that these fluorides (K 3 MnF 7 exception) are isotypic with K 3 SiF 7 , P4/mbm. Calculations of the Madelung Part of Lattice Energy, MAPLE, confirm the adopted parameters of position. Effective Coordination Numbers, ECoN, calculated by use of Mean Fictive Ionic Radii, MEFIR, are calculated and discussed. Raman spectra indicate the presence of octahedral groups [MF 6 ] in case of Rb 3 SiF 7 , and Cs 3 TiF 7 . The magnetic behaviour of A 3 MnF 7 is measured (70-293 K). (author)

  12. Comparison of methods for measurement and retrieval of SIF with tower based sensors

    Science.gov (United States)

    Kornfeld, A.; Berry, J. A.

    2017-12-01

    As the popularity of solar induced fluorescence (SIF) measurement increases, the number of ways to measure and process the data has also increased, leaving a bewildering array of choices for the practitioner. To help clarify the advantages and disadvantages of several methods, we modified our foreoptic, Rotaprism, to measure spectra using either bi-hemispheric (cosine correcting diffusers on both upward and downward views) or hemispherical-conical views (only the upward view is cosine corrected). To test spatial sensitivity of each optic, we recorded data after moving the device relatively short distances - 1-2x the sensor's height above the canopy. When using conical measurements, measured SIF varied by as much as 100% across locations, whereas bi-hemispherical measurements were nearly unaffected by the moves. Reflectance indexes such as NDVI, PRI, NIRv were also spatially sensitive for the conical measurements. We also compared retrievals using either the O2A band or the adjacent Fraunhofer band to examine the relative advantages of each retrieval band for full-day retrievals. Finally, we investigated how choice of retrieval algorithm (SVD, FLD, SFM) affects the computed results. The primary site for this experiment was a California bunchgrass/tallgrass field. Additional data from the Brazilian Amazon will also be used, where appropriate, to support our conclusions.

  13. A Novel Technique that Enables Efficient Conduct of Simultaneous Isomerization and Fermentation (SIF) of Xylose

    Science.gov (United States)

    Rao, Kripa; Chelikani, Silpa; Relue, Patricia; Varanasi, Sasidhar

    Of the sugars recovered from lignocellulose, D-glucose can be readily converted into ethanol by baker's or brewer's yeast (Saccharomyces cerevisiae). However, xylose that is obtained by the hydrolysis of the hemicellulosic portion is not fermentable by the same species of yeasts. Xylose fermentation by native yeasts can be achieved via isomerization of xylose to its ketose isomer, xylulose. Isomerization with exogenous xylose isomerase (XI) occurs optimally at a pH of 7-8, whereas subsequent fermentation of xylulose to ethanol occurs at a pH of 4-5. We present a novel scheme for efficient isomerization of xylose to xylulose at conditions suitable for the fermentation by using an immobilized enzyme system capable of sustaining two different pH microenvironments in a single vessel. The proof-of-concept of the two-enzyme pellet is presented, showing conversion of xylose to xylulose even when the immobilized enzyme pellets are suspended in a bulk solution whose pH is sub-optimal for XI activity. The co-immobilized enzyme pellets may prove extremely valuable in effectively conducting "simultaneous isomerization and fermentation" (SIF) of xylose. To help further shift the equilibrium in favor of xylulose formation, sodium tetraborate (borax) was added to the isomerization solution. Binding of tetrahydroxyborate ions to xylulose effectively reduces the concentration of xylulose and leads to increased xylose isomerization. The formation of tetrahydroxyborate ions and the enhancement in xylulose production resulting from the complexation was studied at two different bulk pH values. The addition of 0.05 M borax to the isomerization solution containing our co-immobilized enzyme pellets resulted in xylose to xylulose conversion as high as 86% under pH conditions that are suboptimal for XI activity. These initial findings, which can be optimized for industrial conditions, have significant potential for increasing the yield of ethanol from xylose in an SIF approach.

  14. Simulating Canopy-Level Solar Induced Fluorescence with CLM-SIF 4.5 at a Sub-Alpine Conifer Forest in the Colorado Rockies

    Science.gov (United States)

    Raczka, B. M.; Bowling, D. R.; Lin, J. C.; Lee, J. E.; Yang, X.; Duarte, H.; Zuromski, L.

    2017-12-01

    Forests of the Western United States are prone to drought, temperature extremes, forest fires and insect infestation. These disturbance render carbon stocks and land-atmosphere carbon exchanges highly variable and vulnerable to change. Regional estimates of carbon exchange from terrestrial ecosystem models are challenged, in part, by a lack of net ecosystem exchange observations (e.g. flux towers) due to the complex mountainous terrain. Alternatively, carbon estimates based on light use efficiency models that depend upon remotely-sensed greenness indices are challenged due to a weak relationship with GPP during the winter season. Recent advances in the retrieval of remotely sensed solar induced fluorescence (SIF) have demonstrated a strong seasonal relationship between GPP and SIF for deciduous, grass and, to a lesser extent, conifer species. This provides an important opportunity to use remotely-sensed SIF to calibrate terrestrial ecosystem models providing a more accurate regional representation of biomass and carbon exchange across mountainous terrain. Here we incorporate both leaf-level fluorescence and leaf-to-canopy radiative transfer represented by the SCOPE model into CLM 4.5 (CLM-SIF). We simulate canopy level fluorescence at a sub-alpine forest site (Niwot Ridge, Colorado) and test whether these simulations reproduce remotely-sensed SIF from a satellite (GOME2). We found that the average peak SIF during the growing season (yrs 2007-2013) was similar between the model and satellite observations (within 15%); however, simulated SIF during the winter season was significantly greater than the satellite observations (5x higher). This implies that the fluorescence yield is overestimated by the model during the winter season. It is important that the modeled representation of seasonal fluorescence yield is improved to provide an accurate seasonal representation of SIF across the Western United States.

  15. Protein Stable Isotope Fingerprinting (P-SIF): Multidimensional Protein Chromatography Coupled to Stable Isotope-Ratio Mass Spectrometry

    Science.gov (United States)

    Pearson, A.; Bovee, R. J.; Mohr, W.; Tang, T.

    2012-12-01

    As metagenomics increases our insight into microbial community diversity and metabolic potential, new approaches are required to determine the biogeochemical expression of this potential within ecosystems. Because stable isotopic analysis of the major bioactive elements (C, N) has been used historically to map flows of substrates and energy among macroscopic food webs, similar principles may apply to microbes. To address this challenge, we have developed a new analytical approach called Protein Stable Isotope Fingerprinting (P-SIF). P-SIF generates natural stable isotopic fingerprints of microbial individual or community proteomes. The main advantage of P-SIF is the potential to bridge the gap between diversity and function, thereby providing a window into the "black box" of environmental microbiology and helping to decipher the roles of uncultivated species. Our method implements a three-way, orthogonal scheme to separate mixtures of whole proteins into subfractions dominated by single or closely-related proteins. Protein extracts first are isoelectrically focused in a gel-free technique that yields 12 fractions separated over a gradient of pH 3-10. Each fraction then is separated by size-exclusion chromatography into 20 pools, ranging from >100kD to ~10kD. Finally, each of these pools is subjected to HPLC and collected in 40 time-slices based on protein hydrophobicity. Theoretical calculation reveals that the true chromatographic resolution of the total scheme is 5000, somewhat less than the 9600 resulting fractions. High-yielding fractions are subjected to δ13C analysis by spooling-wire microcombustion irMS (SWiM-irMS) optimized for samples containing 1-5 nmol carbon. Here we will present the method, results for a variety of pure cultures, and preliminary data for a sample of mixed environmental proteins. The data show the promise of this method for unraveling the metabolic complexity hidden within microbial communities.

  16. Tracking Seasonal and Diurnal Photosynthesis and Plant Water Status in Maize Using SIF, Eddy Covariance Fluxes, PAM Fluorescence and Gas Exchange

    Science.gov (United States)

    Chang, C.; Melkonian, J.; Riha, S. J.; Gu, L.; Sun, Y.

    2017-12-01

    Improving the sensitivity of methods for crop monitoring and yield forecasting is crucial as the frequency of extreme weather events increases. Conventional remote monitoring methods rely on greenness-based indices such as NDVI and EVI, which do not directly measure photosynthesis and are not sufficiently sensitive to rapid plant stress response. Solar-induced chlorophyll fluorescence (SIF) is a promising new technology that serves as a direct functional proxy of photosynthesis. We developed the first system utilizing dual QE Pro spectrometers to continuously measure the diurnal and seasonal cycle of SIF, and deployed the system in a corn field in upstate New York in 2017. To complement SIF, canopy-level measurements of carbon and water fluxes were also measured, along with concurrent leaf-level measurements of gas exchange and PAM fluorescence, midday water potential, leaf pigments, phenology, LAI, and soil moisture. We show that SIF is well correlated to GPP during the growing season and show that both are controlled by similar environmental conditions including PAR and water availability. We also describe diurnal changes in photosynthesis and plant water status and demonstrate the sensitivity of SIF to diurnal plant response.

  17. Comparison of Measurements and FluorMOD Simulations for Solar Induced Chlorophyll Fluorescence and Reflectance of a Corn Crop under Nitrogen Treatments [SIF and Reflectance for Corn

    Science.gov (United States)

    Middleton, Elizabeth M.; Corp, Lawrence A.; Campbell, Petya K. E.

    2007-01-01

    The FLuorescence Explorer (FLEX) satellite concept is one of six semifinalist mission proposals selected in 2006 for pre-Phase studies by the European Space Agency (ESA). The FLEX concept proposes to measure passive solar induced chlorophyll fluorescence (SIF) of terrestrial ecosystems. A new spectral vegetation Fluorescence Model (FluorMOD) was developed to include the effects of steady state SIF on canopy reflectance. We used our laboratory and field measurements previously acquired from foliage and canopies of corn (Zea mays L.) under controlled nitrogen (N) fertilization to parameterize and evaluate FluorMOD. Our data included biophysical properties, fluorescence (F) and reflectance spectra for leaves; reflectance spectra of canopies and soil; solar irradiance; plot-level leaf area index; and canopy SIF emissions determined using the Fraunhofer Line Depth principal for the atmospheric telluric oxygen absorption features at 688 nm (O2-beta) and 760 nm (O2-alpha). FluorMOD simulations implemented in the default "look-up-table" mode did not reproduce the observed magnitudes of leaf F, canopy SIF, or canopy reflectance. However, simulations for all of these parameters agreed with observations when the default FluorMOD information was replaced with measurements, although N treatment responses were underestimated. Recommendations were provided to enhance FluorMOD's potential utility in support of SIF field experiments and studies of agriculture and ecosystems.

  18. Volcano morphometry and volume scaling on Venus

    Science.gov (United States)

    Garvin, J. B.; Williams, R. S., Jr.

    1994-01-01

    A broad variety of volcanic edifices have been observed on Venus. They ranged in size from the limits of resolution of the Magellan SAR (i.e., hundreds of meters) to landforms over 500 km in basal diameter. One of the key questions pertaining to volcanism on Venus concerns the volume eruption rate or VER, which is linked to crustal productivity over time. While less than 3 percent of the surface area of Venus is manifested as discrete edifices larger than 50 km in diameter, a substantial component of the total crustal volume of the planet over the past 0.5 Ga is related to isolated volcanoes, which are certainly more easily studied than the relatively diffusely defined plains volcanic flow units. Thus, we have focused our efforts on constraining the volume productivity of major volcanic edifices larger than 100 km in basal diameter. Our approach takes advantage of the topographic data returned by Magellan, as well as our database of morphometric statistics for the 20 best known lava shields of Iceland, plus Mauna Loa of Hawaii. As part of this investigation, we have quantified the detailed morphometry of nearly 50 intermediate to large scale edifices, with particular attention to their shape systematics. We found that a set of venusian edifices which include Maat, Sapas, Tepev, Sif, Gula, a feature at 46 deg S, 215 deg E, as well as the shield-like structure at 10 deg N, 275 deg E are broadly representative of the approx. 400 volcanic landforms larger than 50 km. The cross-sectional shapes of these 7 representative edifices range from flattened cones (i.e., Sif) similar to classic terrestrial lava shields such as Mauna Loa and Skjaldbreidur, to rather dome-like structures which include Maat and Sapas. The majority of these larger volcanoes surveyed as part of our study displayed cross-sectional topographies with paraboloidal shaped, in sharp contrast with the cone-like appearance of most simple terrestrial lava shields. In order to more fully explore the

  19. As variações da forma do sifão carotídeo na arteriografia cerebral: estudo sobre 120 casos não tumorais

    Directory of Open Access Journals (Sweden)

    A. Mattos Pimenta

    1954-06-01

    Full Text Available O estudo de 120 arteriogramas de pacientes em que foi comprovada a inexistência de lesão que ocupa espaço intracraniano, permitiu o reconhecimento de várias formas de sifão carotídeo normal. Foi assim possível fazer uma classificação anatômica dos vários tipos e concluir que a forma do sifão não permite, sozinha, fazer o diagnóstico topográfico de tumores intracranianos. É importante reconhecer exatamente os limites do sifão, a fim de localizar, precisamente, os aneurismas da carótida interna. Do exposto podemos tirar duas ordens de conclusões: 1 Conclusões anatômicas - O sifão carotídeo normal não apresenta grande número de variações de forma, podendo ser reconhecidos dois tipos básicos: angulados e arredondados. Os primeiros subdividem-se em angulados com ramos oblíquos (ângulo agudo ou ângulo obtuso e angulados com um ramo horizontal (superior ou inferior. Os segundos (arredondados dividem-se em três subtipos: semi-elíptico, em alça (horizontal ou oblíquo e em S (superior, inferior ou duplo. Nos grupos e subgrupos cada segmento do sifão pode apresentar variação no comprimento e espessura, como é evidente à observação dos esquemas. 2 Conclusões neurocirúrgicas - A existência de grande número de formas consideradas como normais de sifão carotídeo leva à conclusão de que não é possível basear o diagnóstico de tumor, ou melhor, de lesão que ocupa espaço intracraniano, exclusivamente pela imagem arteriográfica do sifão. As variações fisiológicas do sifão, somadas às das artérias do grupo silviano e da cerebral anterior, trazem dificuldades diagnosticas que obrigam o neurocirurgião a procurar o maior número de indícios para fazer a interpretação correta do exame. Assim sendo, na rotina neurocirúrgica é aconselhável que os arteriogramas sejam feitos pelo menos em duas posições: perfil e ântero-posterior. E' importante reconhecer bem os limites do sifão para se estabelecer

  20. Les adhésifs à photopolymérisation radicalaire employés pour le cpllage structural du verre en conservation-restauration: Etude de la résistance au cisaillement de 4 adhésifs optiques polymérisables aux UV

    OpenAIRE

    Gillioz, Sandra,

    2016-01-01

    Les adhésifs photopolymérisables, dont la prise s’effectue en quelques secondes sous rayonnement ultraviolet (UV), représentent une option séduisante pour le collage du verre en conservationrestauration, particulièrement lorsque les fragments ne peuvent être maintenus de manière temporaire. Dans le présent travail, nous avons étudié la compatibilité des adhésifs photopolymérisables avec le collage du verre en conservation-restauration en nous focalisant sur leur résistance mécanique. Quatre a...

  1. Potentials of satellite derived SIF products to constrain GPP simulated by the new ORCHIDEE-FluOR terrestrial model at the global scale

    Science.gov (United States)

    Bacour, C.; Maignan, F.; Porcar-Castell, A.; MacBean, N.; Goulas, Y.; Flexas, J.; Guanter, L.; Joiner, J.; Peylin, P.

    2016-12-01

    A new era for improving our knowledge of the terrestrial carbon cycle at the global scale has begun with recent studies on the relationships between remotely sensed Sun Induce Fluorescence (SIF) and plant photosynthetic activity (GPP), and the availability of such satellite-derived products now "routinely" produced from GOSAT, GOME-2, or OCO-2 observations. Assimilating SIF data into terrestrial ecosystem models (TEMs) represents a novel opportunity to reduce the uncertainty of their prediction with respect to carbon-climate feedbacks, in particular the uncertainties resulting from inaccurate parameter values. A prerequisite is a correct representation in TEMs of the several drivers of plant fluorescence from the leaf to the canopy scale, and in particular the competing processes of photochemistry and non photochemical quenching (NPQ).In this study, we present the first results of a global scale assimilation of GOME-2 SIF products within a new version of the ORCHIDEE land surface model including a physical module of plant fluorescence. At the leaf level, the regulation of fluorescence yield is simulated both by the photosynthesis module of ORCHIDEE to calculate the photochemical yield and by a parametric model to estimate NPQ. The latter has been calibrated on leaf fluorescence measurements performed for boreal coniferous and Mediterranean vegetation species. A parametric representation of the SCOPE radiative transfer model is used to model the plant fluorescence fluxes for PSI and PSII and the scaling up to the canopy level. The ORCHIDEE-FluOR model is firstly evaluated with respect to in situ measurements of plant fluorescence flux and photochemical yield for scots pine and wheat. The potentials of SIF data to constrain the modelled GPP are evaluated by assimilating one year of GOME-2-SIF products within ORCHIDEE-FluOR. We investigate in particular the changes in the spatial patterns of GPP following the optimization of the photosynthesis and phenology parameters

  2. Les adhésifs à photopolymérisation radicalaire employés pour le collage structural du verre en conservation-restauration.

    OpenAIRE

    Gillioz, Sandra

    2016-01-01

    Nous avons étudié la compatibilité des adhésifs photopolymérisables avec le collage du verre en conservation-restauration en nous focalisant sur leur résistance mécanique. Quatre adhésifs photopolymérisables à voie radicalaire ont été sélectionnés – Conloc® 665 (EGO®), Loctite® 350 (Henkel®), NOA® 61 (Norland Optical Adhesives®) et Verifix® LV740 (Bohle®) – en employant à titre de comparaison la résine époxyde de référence pour le collage structural du verre – Hxtal® Nyl-1 (Hxtal Adhesive®). ...

  3. The Applicability of Tax Treaties in Respect of Income Distributed by Luxembourgian SIF and SICAR Private Equity Funds and the Tax Consequences for Finnish Investors

    OpenAIRE

    Järvinen, Oscar

    2015-01-01

    In a globalized market for private equity investments, the risk for international double taxation has made the applicability of tax treaties all the more important. The study is concerned with private equity fund structures, where a Luxembourgian SIF or SICAR is used as fund vehicle, where the investor is resident in Finland and where the target company is resident in a third state. In such triangular investment structures the determination of the applicable tax treaty may not always be clear...

  4. Determination of total fluoride in HF/HNO3/H2SiF6 etch solutions by new potentiometric titration methods.

    Science.gov (United States)

    Weinreich, Wenke; Acker, Jörg; Gräber, Iris

    2007-03-30

    In the photovoltaic industry the etching of silicon in HF/HNO(3) solutions is a decisive process for cleaning wafer surfaces or to produce certain surface morphologies like polishing or texturization. With regard to cost efficiency, a maximal utilisation of etch baths in combination with highest quality and accuracy is strived. To provide an etch bath control realised by a replenishment with concentrated acids the main constituents of these HF/HNO(3) etch solutions including the reaction product H(2)SiF(6) have to be analysed. Two new methods for the determination of the total fluoride content in an acidic etch solution based on the precipitation titration with La(NO(3))(3) are presented within this paper. The first method bases on the proper choice of the reaction conditions, since free fluoride ions have to be liberated from HF and H(2)SiF(6) at the same time to be detected by a fluoride ion-selective electrode (F-ISE). Therefore, the sample is adjusted to a pH of 8 for total cleavage of the SiF(6)(2-) anion and titrated in absence of buffers. In a second method, the titration with La(NO(3))(3) is followed by a change of the pH-value using a HF resistant glass-electrode. Both methods provide consistent values, whereas the analysis is fast and accurate, and thus, applicable for industrial process control.

  5. Separative recovery with lime of phosphate and fluoride from an acidic effluent containing H3PO4, HF and/or H2SiF6.

    Science.gov (United States)

    Gouider, Mbarka; Feki, Mongi; Sayadi, Sami

    2009-10-30

    Fluoride content and flow-rate of fertilizer plant wastewater from phosphoric acid and/or triple superphosphate (TSP) production lead to the discharge of several thousand tons of fluoride (F(-)) per year and even more for phosphate (PO4(3-)). Since sustainability is an important environmental concern, the removal methods should allow phosphorus and fluoride to be recycled as a sustainable products for use as raw materials either in agricultural or industrial applications. In the present work, separative recovery with lime of these two target species was investigated. A preliminary speciation study, carried out on the crude effluent, showed that two forms of fluoride: HF and H2SiF6 are present in a highly acidic medium (pH approximately 2). Evidence that fluoride is present under both free (HF) and combined (H2SiF6) forms, in the phosphate-containing effluent, was provided by comparing potentiometric titration curves of a crude wastewater sample and synthetic acid mixtures containing H3PO4, HF and H2SiF6. In a second step synthetic effluent containing mixtures of the following acids: HF, H2SiF6 and H3PO4, were treated with lime. The behaviour of these compounds under lime treatment was analysed. The data showed that fluoride has a beneficial effect on phosphate removal. Moreover, by acting on the precipitation pH, a "selective" recovery of fluoride and phosphate ions was possible either from phosphoric acid/hydrofluoric acid or phosphoric acid/hexafluorosilicic acid mixtures. Indeed, the first stage of the separative recovery, led to a fluoride removal efficiency of 97-98% from phosphoric acid/hydrofluoric acid mixture. It was of 93-95% from phosphoric acid/hexafluorosilicic acid mixture. During the second stage, the phosphate precipitation reached 99.8% from both acidic mixtures whereas it did not exceed 82% from a solution containing H3PO4 alone. The XRD and IR analyses showed that during lime treatment, a H2SiF6 hydrolysis occurred, instead of CaSiF6 solid

  6. Volcanic SO2 and SiF4 visualization using 2-D thermal emission spectroscopy – Part 1: Slant-columns and their ratios

    Directory of Open Access Journals (Sweden)

    M. Grutter

    2012-02-01

    Full Text Available The composition and emission rates of volcanic gas plumes provide insight of the geologic internal activity, atmospheric chemistry, aerosol formation and radiative processes around it. Observations are necessary for public security and the aviation industry. Ground-based thermal emission infrared spectroscopy, which uses the radiation of the volcanic gas itself, allows for continuously monitoring during day and night from a safe distance. We present measurements on Popocatépetl volcano based on thermal emission spectroscopy during different campaigns between 2006–2009 using a Scanning Infrared Gas Imaging System (SIGIS. The experimental set-up, measurement geometries and analytical algorithms are described. The equipment was operated from a safe distance of 12 km from the volcano at two different spectral resolutions: 0.5 and 4 cm−1. The 2-dimensional scanning capability of the instrument allows for an on-line visualization of the volcanic SO2 plume and its animation. SiF4 was also identified in the infrared spectra recorded at both resolutions. The SiF4/SO2 molecular ratio can be calculated from each image and used as a highly useful parameter to follow changes in volcanic activity. A small Vulcanian eruption was monitored during the night of 16 to 17 November 2008 and strong ash emission together with a pronounced SO2 cloud was registered around 01:00 a.m. LST (Local Standard Time. Enhanced SiF4/SO2 ratios were observed before and after the eruption. A validation of the results from thermal emission measurements with those from absorption spectra of the moon taken at the same time, as well as an error analysis, are presented. The inferred propagation speed from sequential images is used in a subsequent paper (Part 2 to calculate the emission rates at different distances from the crater.

  7. Effects of Heterogeneity within Tree Crowns on Airborne-Quantified SIF and the CWSI as Indicators of Water Stress in the Context of Precision Agriculture

    Directory of Open Access Journals (Sweden)

    Carlos Camino

    2018-04-01

    Full Text Available This research focused on understanding the effects of structural heterogeneity within tree crowns on the airborne retrieval of solar-induced chlorophyll fluorescence (SIF and the Crop Water Stress Index (CWSI. We explored the SIF and CWSI variability observed within crowns of trees subjected to different water stress regimes and its effect on the relationships with leaf physiological measurements. High-resolution (20 cm hyperspectral imagery was acquired to assess fluorescence retrieval from sunlit portions of the tree crowns using the Fraunhofer line depth method, and from entire crowns using automatic object-based tree crown detection methods. We also measured the canopy temperature distribution within tree crowns using segmentation algorithms based on temperature percentiles applied to high-resolution (25 cm thermal imagery. The study was conducted in an almond orchard cultivated under three watering regimes in Cordoba, in southern Spain. Three airborne campaigns took place during the summer of 2015 using high-resolution hyperspectral and thermal cameras on board a manned aircraft. Relationships between SIF and the assimilation rate improved significantly when the sunlit tree crown pixels extracted through segmentation were used for all flight dates. By contrast, the SIF signal extracted from the entire tree crowns was highly degraded due to the canopy heterogeneity observed within tree crowns. The quartile crown segmentations applied to the thermal images showed that the CWSI values obtained were within the theoretically expected CWSI range only when the pixels were extracted from the 50th percentile class. However, the CWSI values were biased in the upper quartile (Q75 for all watering regimes due to the soil background effects on the calculated mean crown temperature. The relationship between the CWSI and Gs was heavily affected by the crown segmentation levels applied and improved remarkably when the CWSI values were calculated from the

  8. Mass Spectrometric Investigation of Silicon Extremely Enriched in (28)Si: From (28)SiF4 (Gas Phase IRMS) to (28)Si Crystals (MC-ICP-MS).

    Science.gov (United States)

    Pramann, Axel; Rienitz, Olaf

    2016-06-07

    A new generation of silicon crystals even further enriched in (28)Si (x((28)Si) > 0.999 98 mol/mol), recently produced by companies and institutes in Russia within the framework of a project initiated by PTB, were investigated with respect to their isotopic composition and molar mass M(Si). A modified isotope dilution mass spectrometric (IDMS) method treating the silicon as the matrix containing a so-called virtual element (VE) existing of the isotopes (29)Si and (30)Si solely and high resolution multicollector inductively coupled plasma mass spectrometry (MC-ICP-MS) were applied in combination. This method succeeds also when examining the new materials holding merely trace amounts of (29)Si (x((29)Si) ≈ 5 × 10(-6) mol/mol) and (30)Si (x((30)Si) ≈ 7 × 10(-7) mol/mol) extremely difficult to detect with lowest uncertainty. However, there is a need for validating the enrichment in (28)Si already in the precursor material of the final crystals, silicon tetrafluoride (SiF4) gas prior to crystal production. For that purpose, the isotopic composition of selected SiF4 samples was determined using a multicollector magnetic sector field gas-phase isotope ratio mass spectrometer. Contaminations of SiF4 by natural silicon due to storing and during the isotope ratio mass spectrometry (IRMS) measurements were observed and quantified. The respective MC-ICP-MS measurements of the corresponding crystal samples show-in contrast-several advantages compared to gas phase IRMS. M(Si) of the new crystals were determined to some extent with uncertainties urel(M) < 1 × 10(-9). This study presents a clear dependence of the uncertainty urel(M(Si)) on the degree of enrichment in (28)Si. This leads to a reduction of urel(M(Si)) during the past decade by almost 3 orders of magnitude and thus further reduces the uncertainty of the Avogadro constant NA which is one of the preconditions for the redefinition of the SI unit kilogram.

  9. Examining the Effects of Different Ring Configurations and Equatorial Fluorine Atom Positions on CO 2 Sorption in [Cu(bpy) 2 SiF 6

    KAUST Repository

    Forrest, Katherine A.

    2013-10-02

    Simulations of CO2 sorption were performed in a metal-organic material (MOM) that is part of a "SIFSIX" family of compounds that has remarkable carbon dioxide capture and separation properties. The MOM considered here has the formula [Cu(bpy)2SiF6] (bpy = 4,4′-bipyridine). This hydrophobic MOM is both water-stable and CO 2-specific with significant sorption capacity under ambient conditions. The crystal structure reveals bpy rings and equatorial fluorine atoms in multiple possible orientations; the static disorder has been modeled based on single-crystal X-ray diffraction data revealing several possible relatives of atoms in the crystal structure. With regards to the bpy rings, the structure can be interpreted as two pyridyl rings with coplanar configurations within a unit cell (configuration 1), a twisted bpy ring conformation in which orthogonal pyridyl rings have C4 symmetry about the Cu2+ ion (configuration 2), and a twisted bpy ring conformation in which the two orthogonal pyridyl rings are facing one another within a unit cell (configuration 3). Further, the equatorial fluorine atoms can be positioned such that all atoms are eclipsed with the square grid (position A), oriented at a 21.3 angle with respect to the square grid (position B), and oriented at a 45 angle with respect to the square grid (position C). It was observed that experimental data for CO2 sorption were only consistent with sorption into configurations 1 and 3 with any of the possible equatorial fluorine atom positions at ambient temperatures, although simulations using position A produced slightly higher uptakes in these bpy ring configurations. It is demonstrated that the orientation of the bpy rings in configurations 1 and 3 allows more space for the sorbate molecules and thus promotes favorable MOM-sorbate interactions, resulting in isotherms in line with the experimental results. The results from this study suggests that [Cu(bpy)2SiF 6] in either configuration 1 or 3 with CO2 present in

  10. Morphology and electronic transport of polycrystalline silicon films deposited by SiF sub 4 /H sub 2 at a substrate temperature of 200 deg. C

    CERN Document Server

    Hazra, S; Ray, S

    2002-01-01

    Undoped and phosphorous doped polycrystalline silicon (poly-Si) films were deposited using a SiF sub 4 /H sub 2 gas mixture at a substrate temperature of 200 deg. C by radio frequency plasma enhanced chemical vapor deposition (rf-PECVD). Fourier transform infrared (FTIR) spectroscopy and x-ray diffraction (XRD) experiments reveal that the present poly-Si films are equivalent to the poly-Si films deposited at high temperature (>600 deg. C). XRD and scanning electron microscope observations show that the crystalline quality of slightly P-doped film is better compared to that of undoped poly-Si films. Phosphorus atom concentration in the slightly P-doped poly-Si film is 5.0x10 sup 1 sup 6 atoms/cm sup 3. Association of a few phosphorous atoms in the silicon matrix enhances crystallization as eutectic-forming metals do. Dark conductivity of slightly P-doped film is 4 orders of magnitude higher, although mobility-lifetime product (eta mu tau) is 2 orders of magnitude lower than that of undoped film. The presence o...

  11. Reaction of (carbonylimido)sulfur(IV) derivatives with TAS-fluoride, (Me2N)3S+Me3SiF2-.

    Science.gov (United States)

    Lork, E; Viets, D; Mews, R; Oberhammer, H

    2000-10-16

    In the reaction of TAS-fluoride, (Me2N)3S+Me3SiF2-, with carbonyl sulfur difluoride imides RC(O)NSF2 (R = F, CF3), C-N bond, cleavage is observed, and TAS+RC(O)F2- and NSF are the final products. From TASF and RC(O)NS(CF3)F, the salts TAS+RC(O)NS(CF3)F2- (R = F (14), CF3 (15)), with psi-pentacoordinate sulfur centers in the anions, are formed. An X-ray structure investigation of 14 shows that the fluorine atoms occupy axial positions and CF3, NC(O)F, and the sulfur lone pair occupy equatorial positions of the trigonal bipyramid. The -C(O)F group lies in the equatorial plane with the CO bond synperiplanar to the SN bond. According to B3LYP calculations, this structure corresponds to a global minimum and the expected axial orientation of the -C(O)F group represents a transition state. Calculations for the unstable FC(O)NSF3- anion show a different geometry. The -C(O)F group deviates 40 degrees from axial orientation, and the equatorially bonded fluorine is, in contrast to the -CF3 group in 14, syn positioned.

  12. Thermodynamic optimization of the (Na2O + SiO2 + NaF + SiF4) reciprocal system using the Modified Quasichemical Model in the Quadruplet Approximation

    International Nuclear Information System (INIS)

    Lambotte, Guillaume; Chartrand, Patrice

    2011-01-01

    Highlights: → We model the Na 2 O-SiO 2 -NaF-SiF 4 reciprocal system based on a comprehensive review of all available experimental data. → The assessment includes Na 2 O-SiO 2 and NaF-SiF 4 binary systems. → Improvements to the Modified Quasichemical Model in the Quadruplet Approximation are presented. → The very strong short-range ordering among first-nearest and second-nearest neighbors in this system is reproduced. → This work constitutes the first assessment for all compositions and temperatures of a reciprocal oxyfluoride system. - Abstract: All available thermodynamic and phase diagram data for the condensed phases of the ternary reciprocal system (NaF + SiF 4 + Na 2 O + SiO 2 ) have been critically assessed. Model parameters for the unary (SiF 4 ), the binary systems and the ternary reciprocal system have been found, which permit to reproduce the most reliable experimental data. The Modified Quasichemical Model in the Quadruplet Approximation was used for the oxyfluoride liquid solution, which exhibits strong first-nearest-neighbor and second-nearest-neighbor short-range ordering. This thermodynamic model takes into account both types of short-range ordering as well as the coupling between them. Model parameters have been estimated for the hypothetical high-temperature liquid SiF 4 .

  13. HOW RISKY ARE SIF'S SECURITIES?

    Directory of Open Access Journals (Sweden)

    Claudiu Botoc

    2014-07-01

    Full Text Available The capital asset pricing model (CAPM lies at the heart of models in financial economics and it has a long history of theoretical and empirical investigations. The beta (β of the stock is a measure of how much specific risk remains in the stock after all possible risks are diversified. The specific risk of an individual stock is the slope coefficient of the regression between the return for the individual security and the return for the market index. The main aim of the paper is to measure the systematic risk for a given number of stocks from the Romanian capital market in order to determine if these stocks are riskier than the market itself. The focus is on market risk and not on the company-specific risk and the hypotheses tested states that “stock market prices are mainly set based on the trading activity of the investors”. Using data for the period 2001-2014, the results suggest that all SIF’s were bearing a higher risk than the market itself, with an increasing level for the sub-period 2008-2014 (post crisis. Since SIF’s are earning a high return too, these results are consistent with risk-return trade-off. The results remain robust even when was used monthly return instead of daily return.

  14. L’utilisation d’adhésifs optiques réticulables aux UV pour le collage d’objets d’art en verre transparent coloré, à surface d’encollage réduite

    Directory of Open Access Journals (Sweden)

    Viviane Bechoux

    2011-11-01

    Full Text Available La recherche porte sur une double problématique :1° La possibilité d’utiliser les adhésifs réticulables aux UV  pour coller le verre transparent coloré. 2° Le collage du verre  s’avère très complexe quand les éléments à assembler sont fins, fragiles et quand la surface d’encollage est réduite à quelques millimètres.Dans ce cas précis, la solidité mécanique du collage et la rapidité de polymérisation de l’adhésif sont les premiers critères à prendre en compte pour assurer un assemblage final fiable.This research focuses on two issues : 1° The possibility to use UV-crosslinkable adhesives to bond transparent coloured glass.2° The glass bonding is very complex when the parts to be joined are thin, fragile, and when the bonding surface is reduced to a few millimetres in size. In this case, the mechanical strength of the bonding and the speed of the curing process of the adhesive are the first criteria to be taken into account to ensure a reliable final bonding.

  15. Molecular beam electric deflection of the tetrahalides CF4, CCl4, SiF4, SiCl4, GeCl4, TiF4, TiCl4, VF4, and VCl4

    International Nuclear Information System (INIS)

    Muenter, A.A.; Dyke, T.R.; Falconer, W.E.; Klemperer, W.

    1975-01-01

    Using molecular beam electric deflection, the temperature dependence of polar behavior has been studied for the molecules CF 4 , CCl 4 , SiF 4 , SiCl 4 , GeCl 4 , TiF 4 TiCl 4 , VF 4 , VF 4 , and VCl 4 . A number of these molecules show polar behavior consistent with a vibrationally induced dipole moment for states with one or both of the triply degenerate vibrations excited. In four of the tetrachloride species, the presence of a vibrationally induced dipole moment was confirmed by the change in polar behavior with isotopic substituion of the Cl atoms. The deflection behavior of the transition metal tetrahalides varied from nonpolar in VCl 4 to very polar in TiF 4

  16. A WLED based on LuAG:Ce3+ PiG coated red-emitting K2SiF6:Mn4+ phosphor by screen-printing

    Science.gov (United States)

    Cao, Rui; Wu, Lingchao; Di, Xiaoxuan; Li, Pengzhi; Hu, Guangcai; Liang, Xiaojuan; Xiang, Weidong

    2017-08-01

    It is high-profile that the use of phosphor-in-glass (PiG) is extensive because of its excellent advantages in thermal resistance and lifetime aspects, and so on. Here, white light-emitting diodes (WLED) based on LuAG:Ce3+ PiG coated red-emitting K2SiF6:Mn4+ (KSF) phosphors by screen-printing are fabricated. Among all of these, the commercial LuAG phosphors and glass raw materials of TeO2-based glass, were weighted and milled in an agate thoroughly. Then, the mixture was melted and sintered at 850 K or so for 20 min in the ambient atmosphere through low temperature co-fired method, cold-forming LuAG PiG clump and cut into different LuAG PiG thicknesses. After that, the commercial red phosphor KSF was coated on LuAG PiG by screen-printing technique. Finally, high-performance WLEDs based on the TeO2-based glass were obtained, tested and characterized, which exhibit a highest color rendering index of 94.1, a lowest color temperature of 3744 K and a largest luminous efficiency of 101.02 lm·W-1. Most noticeably of all, the promising method has excellent developing potential for industrialization in high-power WLED.

  17. He Sapa Bloketu Waecun: 2008 Summer Science and Cultural Camps

    Science.gov (United States)

    Kliche, D. V.; Sanovia, J.; Decker, R.; Bolman, J.

    2008-12-01

    The South Dakota School of Mines, Humboldt State University and Sinte Gleska University with support from the National Science Foundation, sponsored four camps for South Dakota Lakota youth to nurture a geosciences learning community linked to culturally significant sites in the Black Hills. These camps utilized outdoor, experiential learning to integrate indigenous knowledge with contemporary western science. The project resulted in increased awareness among Native and non-Native Americans, young and adult, about the importance of geosciences in their connection and interpretation of nature. The project also motivated participants in learning and becoming active in land and resources protection and the importance of becoming knowledgeable and active in regulatory policies (both Tribal and State). The four camps were scheduled during the month of June, 2008, which is the month of the summer solstice, a sacred time for the Lakota people which signal the Lakota Sundance Ceremony. The timing of the camps was chosen to give the Native American participants the framework to express their connection to Native lands through the understanding of their oral history. For the first time in such camps, middle and high school students were encouraged to have a parent or relative attending with them. The camps proved to be a great success among students and their families. The curriculum and activities helped participants immerse themselves mentally, physically and spiritually into an experience of a life time. We plan to show our results from these camps and emphasize the usefulness of this new approach in teaching science and encouraging the new generation to pursue careers in geosciences.

  18. Estratigrafía del Cretácico en el sondeo del Sifón de los Yesos (Torrelaguna y su correlación con afloramientos de superficie

    Directory of Open Access Journals (Sweden)

    Iglesias, J. A.

    2000-04-01

    Full Text Available Several hydrogeological boreholes for survey purposes have been drilled by the Canal de Isabel 11 near Torrelaguna (Madrid. One of those boreholes, at the Sifón de los Yesos, was drilled out with complete core recovering and cut across detrital and evaporitic rocks of Paleogene age and, partly, the Upper Cretaceous series mainly composed of dolostones, marls and sandstones. Six units have been distinguished in the Cretaceous of the borehole, from base to top: 1 Marls and dolostones with minor sandy intercalations (23.6 m; 2 Thick-bedded yellow dolostones (23.4 m; 3 marly dolostones and marls with minor dolostones (8 m; 4 thick-bedded yellow dolostones (17.4 m; 5 medium to thick-bedded white dolostones (21.3 m; and 6 Calcareous breccias alternating with white dolostones and red mudstones (28.5 m. These units have been correlated with the nearby Barranco de las Cuevas section, which is a key section in order to understand the stratigraphical relationships for the Cretaceous south of the Central System, because of several lithostratigraphical units are poorly dolomitized here and thus their facies and sedimentary environments of deposition can be studied and understood. From base to top borehole unit l is correlated with the Tranquera Fm.; borehole units 2, 3 and 4 (lower part are correlated with Hortezuelos Fm.; borehole units 4 (upper part and 5 are correlated with Hontoria del Pinar Fm.; and finally, borehole unit 6 is correlated with Burgo de Osma Fm. There are clear differences between these units in surface outcrop and in the borehole relating to colour, which is related to the organic matter content and its oxidation state, and appearance, marly intercalations are weak intervals in surface meanwhile correspond to harder and more compacted intervals in the borehole. The recognition of the borehole facies for the Cretaceous is a very useful stratigraphical tool for future drilling campaigns allowing a more detailed interpretation of the cores

  19. pVT-Second Virial Coefficients B(T ), Viscosity η(T ), and Self-Diffusion ρD(T) of the Gases: BF3, CF4, SiF4, CCl4, SiCl4, SF6, MoF6, WF6, UF6, C(CH3)4, and Si(CH3)4 Determined by Means of an Isotropic Temperature-Dependent Potential

    Science.gov (United States)

    Zarkova, L.; Hohm, U.

    2002-03-01

    We present results on self-consistent calculations of second pVT-virial coefficients B(T), viscosity data η(T), and diffusion coefficients ρD(T) for eleven heavy globular gases: boron trifluoride (BF3), carbon tetrafluoride (CF4), silicon tetrafluoride (SiF4), carbon tetrachloride (CCl4), silicon tetrachloride (SiCl4), sulfur hexafluoride (SF6), molybdenum hexafluoride (MoF6), tungsten hexafluoride (WF6), uranium hexafluoride (UF6), tetramethyl methane (C(CH3)4, TMM), and tetramethyl silane (Si(CH3)4, TMS). The calculations are performed mainly in the temperature range between 200 and 900 K by means of isotropic n-6 potentials with temperature-dependent separation rm(T) and potential well depth ɛ(T). The potential parameters at T=0 K (ɛ, rm, n) and the enlargement of the first level radii δ are obtained solving an ill-posed problem of minimizing the squared deviations between experimental and calculated values normalized to their relative experimental error. The temperature dependence of the potential is obtained as a result of the influence of vibrational excitation on binary interactions. This concept of the isotropic temperature-dependent potential (ITDP) is presented in detail where gaseous SF6 will serve as an example. The ITDP is subsequently applied to all other gases. This approach and the main part of the results presented here have already been published during 1996-2000. However, in some cases the data are upgraded due to the recently improved software (CF4, SF6) and newly found experimental data (CF4, SiF4, CCl4, SF6).

  20. Aspects of the reproductive biology of Sarpa sa/pa (Pisces: Sparidae ...

    African Journals Online (AJOL)

    fork length, while the adult sex ratio in the shore-based catch was 1 :1.6 in favour of males. Frequency distribu- ... 1978; Lasiak 1983; Whitfield 1989; Whitfield & Kok 1992). In order to obtain a full .... cated at Sea World, Durban. The fish were ...

  1. Searching for Organisational Identity : - a case study at Sapa Heat Transfer

    OpenAIRE

    Eklind, Martin; Hallgren, Linda

    2009-01-01

    Organisational Identity (i.e. OI) could be described as an employee theory of who the organisation is. The concept is seen as one of the most problematic concepts to define. One of the main reasons for that is its close relation to the concepts of culture and image, as they are seen as defining each other. As expressed in previous research there is a need for theoretical clarification and investigations in practice in this area. We aim to contribute to an OI concept clarification and theoreti...

  2. PERANCANGAN MODEL DISTRIBUSI KOMODITAS PADI PASKA-PANEN BERBASIS SUPPLY CHAIN MANAGEMENT (Studi Kasus Sistem SAPA Sukabumi

    Directory of Open Access Journals (Sweden)

    Didiek Sri Wiyono

    2012-02-01

    Full Text Available Ditinjau dari kajian Supply Chain Management (SCM, salah satu akar masalah pada bisnis komoditas padi paska-panen adalah masalah distribusi. Rendahnya tingkat aksesibilitas informasi ketersediaan komoditas bagi para stakeholder mengakibatkan proses distribusi tidak berjalan dengan baik, sehingga sering terjadi penumpukan komoditas maupun kekosongan komoditas di sisi yang lain. Permasalahan komunikasi dan koordinasi ini mengakibatkan distribusi komoditas padi tidak berjalan dengan baik sehingga sangat merugikan  konsumen, petani dan semua pihak yang terlibat di dalam sistem SCM. Fokus penelitian ini adalah merancang model distribusi komoditas padi paska-panen. Rancangan model berbasis Supply Chain Management (SCM dipilih karena karakteristiknya dalam hal kemudahan interaksi antar   stakeholder  dinilai mampu menjawab permasalahan rendahnya tingkat aksesibilitas informasi ketersediaan komoditas. Proses perancangan dimulai dengan melakukan inventarisasi kebutuhan stakeholder hingga mendapatkan format yang sesuai dengan distribusi komoditas padi paska-panen. Selanjutnya dibuat System Requirement Specification (SRS dan diidentifikasi value chain dari komoditas padi paska-panen. SRS dan value chain yang telah didapat dijadikan dasar dalam merancang model distribusi dengan bantuan Use Case Model. Hasil penelitian ini berupa model bisnis yang komperhensif dari sebuah sistem distribusi komoditas padi paska-panen berbasis SCM yang telah disesuaikan  dengan kebutuhan pengguna. Kata kunci: Supply Chain Management, komunikasi dan koordinasi, penyebaran informasi,   model distribusi komoditas padi pascapanen.   Abstract With the Supply Chain Management’s (SCM appoach, uncertaintly of rice, main commodity in agri-industry after-harvest paddy, supply and distribution which is giving a bad impact for consumers, farmers, and all who are involved in this business, found that root of the problems is minimum availability of comodities and accessibility of informations. These problems happened because uncertaintly and unavailability of accurate informations about inventory, demands and also products capacity  form industries. By the advanced development of internet, web and mobile technologies, problems in creating, providing and deseminating of informations can be minimized by using appropriate application in SCM based information system that uses the advanced facilities of internet and mobile communication network which have been widely spead in Indonesia. Creating software requirement specifications (SRS, use case diagrams, class diagrams and comparing SRS with these diagrams, will be much helpfull for the designed processes to meet and fit with user needs. User interface and prototype of these applications, as a result, also introduced to the client and users to guarantee the fitness of the designed applications. Keywords: Supply Chain Management, comunication and coordinaton, sharing information, distribution model of after-harvest paddy

  3. Selected ICAR Data from the SAPA-Project: Development and Initial Validation of a Public-Domain Measure

    Directory of Open Access Journals (Sweden)

    David M. Condon

    2016-01-01

    Full Text Available These data were collected during the initial evaluation of the International Cognitive Ability Resource (ICAR project. ICAR is an international collaborative effort to develop open-source public-domain tools for cognitive ability assessment, including tools that can be administered in non-proctored environments (e.g., online administration and those which are based on automatic item generation algorithms. These data provide initial validation of the first four ICAR item types as reported in Condon & Revelle [1]. The 4 item types contain a total of 60 items: 9 Letter and Number Series items, 11 Matrix Reasoning items, 16 Verbal Reasoning items and 24 Three-dimensional Rotation items. Approximately 97,000 individuals were administered random subsets of these 60 items using the Synthetic Aperture Personality Assessment method between August 18, 2010 and May 20, 2013. The data are available in rdata and csv formats and are accompanied by documentation stored as a text file. Re-use potential includes a wide range of structural and item-level analyses.

  4. Selected personality data from the SAPA-Project: On the structure of phrased self-report items

    Directory of Open Access Journals (Sweden)

    David M Condon

    2015-08-01

    Full Text Available These data were collected to evaluate the structure of personality constructs in the temperament domain. In the context of modern personality theory, these constructs are typically construed in terms of the Big Five (Conscientiousness, Agreeableness, Neuroticism, Openness, and Extraversion though several additional constructs were included here. Approximately 24,000 individuals were administered random subsets of 696 items from 92 public-domain personality scales using the Synthetic Aperture Personality Assessment method between December 8, 2013 and July 26, 2014. The data are available in rdata format and are accompanied by documentation stored as a text file. Re-use potential include many types of structural and correlational analyses of personality. 

  5. Analisis Sif Kerja, Masa Kerja, dan Budaya K3 dengan Fungsi Paru Pekerja Tambang Batu Bara

    Directory of Open Access Journals (Sweden)

    Qomariyatus Sholihah

    2015-08-01

    study aimed to determine relations of work shift, work period and occupational health and safety (OHS culture with lung function of coal mining worker. This study was control case design with each amount of sample for case and control was 178 respondents. The study was conducted on October – November 2014 at PT X in South Borneo. Results based on chisquare test showed p value = 0.044 for work shift, 0.028 for work period and 0.013 for OHS culture. Based on logistic regression test results, p value for work shift was 0.01 with OR = 3.934. As conclusion, there is a relation between work shift with lung function, then there is no relation found between work period and OHS culture with lung function. Work shift is an independent variable most dominantly influencing the lung function.

  6. Assessing Children's Appraisals of Security in the Family System: The Development of the Security in the Family System (SIFS) Scales

    Science.gov (United States)

    Forman, Evan M.; Davies, Patrick T.

    2005-01-01

    Background: Although delineating the processes by which children appraise the family as a source of security from their collective experiences in the family subsystem has assumed center stage in many conceptualizations of child development, the dearth of measures of child adaptation in the family system has hindered empirical advances. Therefore,…

  7. Pancreatitis-Associated Splenic Artery Pseudoaneurysm: Endovascular Treatment with Self-Expandable Stent-Grafts

    International Nuclear Information System (INIS)

    Brountzos, Elias N.; Vagenas, Kostantinos; Apostolopoulou, Sotiria C.; Panagiotou, Irene; Lymberopoulou, Dimitra; Kelekis, Dimitrios A.

    2003-01-01

    We present a patient with a splenic arterypseudoaneurysm (SAPA) treated with placement of self-expandable stent-grafts. The procedure was complicated by stent-graft migration,but successful management resulted in lasting exclusion of the SAPA,while the patency of the splenic artery was preserved. This is the first report of self-expandable stent-graft treatment of SAPA

  8. Examining the Effects of Different Ring Configurations and Equatorial Fluorine Atom Positions on CO 2 Sorption in [Cu(bpy) 2 SiF 6

    KAUST Repository

    Forrest, Katherine A.; Pham, Tony; Nugent, Patrick; Burd, Stephen D.; Mullen, Ashley; Wojtas, Lukasz; Zaworotko, Michael J.; Space, Brian

    2013-01-01

    ] (bpy = 4,4′-bipyridine). This hydrophobic MOM is both water-stable and CO 2-specific with significant sorption capacity under ambient conditions. The crystal structure reveals bpy rings and equatorial fluorine atoms in multiple possible orientations

  9. Electronic excitation to low-lying states of GeF4 molecule by electron impact: A comparative study with CF4 and SiF4 molecules

    International Nuclear Information System (INIS)

    Ohtomi, S; Matsui, M; Mochizuki, Y; Suga, A; Kato, H; Hoshino, M; Tanaka, H; Duflot, D; Limão-Vieira, P

    2015-01-01

    We report on the measurements of the electron impact electronic excitation cross sections for XF 4 (X = C, Si and Ge) molecules at 100 eV, 5° scattering angle and 30 eV, 30° in the electron energy loss range 8.0 - 18 eV. For a target of GeF 4 molecule, the optically-forbidden behavior has been observed in the lower electron energy loss range. (paper)

  10. Ambivalence about supervised injection facilities among community stakeholders.

    Science.gov (United States)

    Strike, Carol; Watson, Tara Marie; Kolla, Gillian; Penn, Rebecca; Bayoumi, Ahmed M

    2015-08-21

    Community stakeholders express a range of opinions about supervised injection facilities (SIFs). We sought to identify reasons for ambivalence about SIFs amongst community stakeholders in two Canadian cities. We used purposive sampling methods to recruit various stakeholder representatives (n = 141) for key informant interviews or focus group discussions. Data were analyzed using a thematic process. We identified seven reasons for ambivalence about SIFs: lack of personal knowledge of evidence about SIFs; concern that SIF goals are too narrow and the need for a comprehensive response to drug use; uncertainty that the community drug problem is large enough to warrant a SIF(s); the need to know more about the "right" places to locate a SIF(s) to avoid damaging communities or businesses; worry that a SIF(s) will renew problems that existed prior to gentrification; concern that resources for drug use prevention and treatment efforts will be diverted to pay for a SIF(s); and concern that SIF implementation must include evaluation, community consultation, and an explicit commitment to discontinue a SIF(s) in the event of adverse outcomes. Stakeholders desire evidence about potential SIF impacts relevant to local contexts and that addresses perceived potential harms. Stakeholders would also like to see SIFs situated within a comprehensive response to drug use. Future research should determine the relative importance of these concerns and optimal approaches to address them to help guide decision-making about SIFs.

  11. Sub-Saharan Africa Report Tables of Contents JPRS-SSA-86-068, 1 July 1986- JPRS-SSA-86-095, 15 September 1986

    Science.gov (United States)

    1987-02-21

    Grows, Cooperatives Under Greater Pressure (Sue Leeman; THE STAR, 5 Jun 86) 72 Nation’s Export Drive Into EC Markets Expected Xo Founder (Mick...Development (DAILY DISPATCH, 24 Jun 86) 61 Zulu King Criticizes Church Role in Black Crisis (THE STAR, 30 Jun 86) 62 Briefs New Intelligence Unit...8217 (SAPA, 21 Aug 86) 58 Buthelezi Discusses Afrikaner- Zulu Coexistence (SAPA, 22 Aug 86) 59 People’s Army Leader, ANC’s Modise Discusses

  12. Sun-induced chlorophyll fluorescence, photosynthesis, and light use efficiency of a soybean field from seasonally continuous measurements

    Science.gov (United States)

    Recent development of sun-induced chlorophyll fluorescence (SIF) technology is stimulating studies to remotely approximate canopy photosynthesis (measured as gross primary production, GPP). While multiple applications have advanced the empirical relationship between GPP and SIF, mechanistic understa...

  13. Stress intensity factors of three parallel edge cracks under bending moments

    International Nuclear Information System (INIS)

    Ismail, A E

    2013-01-01

    This paper reports the study of stress intensity factors (SIF) of three edge cracks in a finite plate under bending moments. The goal of this paper was to analyze the three edge crack interactions under such loading. Several studies can be found in literature discussing on mode I SIF. However, most of these studies obtained the SIFs using tensile force. Lack of SIF reported discussing on the SIFs obtained under bending moments. ANSYS finite element program was used to develop the finite element model where singular elements were used to model the cracks. Different crack geometries and parameters were utilized in order to characterize the SIFs. According to the present results, crack geometries played a significant role in determining the SIFs and consequently induced the crack interaction mechanisms

  14. Reconstructed Solar-Induced Fluorescence: A Machine Learning Vegetation Product Based on MODIS Surface Reflectance to Reproduce GOME-2 Solar-Induced Fluorescence

    Science.gov (United States)

    Gentine, P.; Alemohammad, S. H.

    2018-04-01

    Solar-induced fluorescence (SIF) observations from space have resulted in major advancements in estimating gross primary productivity (GPP). However, current SIF observations remain spatially coarse, infrequent, and noisy. Here we develop a machine learning approach using surface reflectances from Moderate Resolution Imaging Spectroradiometer (MODIS) channels to reproduce SIF normalized by clear sky surface irradiance from the Global Ozone Monitoring Experiment-2 (GOME-2). The resulting product is a proxy for ecosystem photosynthetically active radiation absorbed by chlorophyll (fAPARCh). Multiplying this new product with a MODIS estimate of photosynthetically active radiation provides a new MODIS-only reconstruction of SIF called Reconstructed SIF (RSIF). RSIF exhibits much higher seasonal and interannual correlation than the original SIF when compared with eddy covariance estimates of GPP and two reference global GPP products, especially in dry and cold regions. RSIF also reproduces intense productivity regions such as the U.S. Corn Belt contrary to typical vegetation indices and similarly to SIF.

  15. The rhetoric of racism: revisiting the creation of the Psychological Institute of the Republic of South Africa (1956-1962).

    Science.gov (United States)

    Long, Wahbie

    2014-01-01

    This paper revisits the 1962 splitting of the South African Psychological Association (SAPA), when disaffected Afrikaner psychologists broke away to form the whites-only Psychological Institute of the Republic of South Africa (PIRSA). It presents an analysis of the rhetorical justification for forming a new professional association on principles at odds with prevailing international norms, demonstrating how the episode involved more than the question of admitting black psychologists to the association. In particular, the paper argues that the SAPA-PIRSA separation resulted from an Afrikaner nationalist reading of the goals of psychological science. PIRSA, that is, insisted on promoting a discipline committed to the ethnic-national vision of the apartheid state. For its part, SAPA's racial integration was of a nominal order only, ostensibly to protect itself from international sanction. The paper concludes that, in a racist society, it is difficult to produce anything other than a racist psychology. © 2014 Wiley Periodicals, Inc.

  16. Role and Effectiveness of Percutaneous Arterial Embolization in Hemodynamically Unstable Patients with Ruptured Splanchnic Artery Pseudoaneurysms

    International Nuclear Information System (INIS)

    Dohan, Anthony; Eveno, Clarisse; Dautry, Raphael; Guerrache, Youcef; Camus, Marine; Boudiaf, Mourad; Gayat, Etienne; Dref, Olivier Le; Sirol, Marc; Soyer, Philippe

    2015-01-01

    PurposeTo assess the role and effectiveness of percutaneous arterial embolization (TAE) in patients with hemodynamic instability due to hypovolemic shock secondary to ruptured splanchnic artery pseudoaneurysms (SAPA).Materials and MethodsSeventeen patients (11 men, 6 women; mean age, 53 years) with hemodynamic instability (systolic blood pressure <90 mmHg) due to hypovolemic shock secondary to ruptured SAPA were treated by TAE. Clinical files, multidetector row computed tomography angiography, and angiographic examinations along with procedure details were reviewed.ResultsSeventeen SAPAs were present, predominantly located on gastroduodenal or pancreatic arteries (9/17; 53 %). Angiography showed extravasation of contrast medium from SAPA in 15/17 patients (88 %). Technical success rate of TAE was 100 %. TAE was performed using metallic coils in all patients (100 %), in association with gelatin sponge in 5/17 patients (29 %). TAE allowed controlling the bleeding and returning to normal hemodynamic status in 16/17 patients (94 %). In 1/17 patient (6 %), surgery was needed to definitively control the bleeding. The mortality and morbidity rate of TAE at 30 days were 0 and 12 %, respectively. Morbidity consisted in coil migration in 1/17 patient (6 %) and transient serum liver enzyme elevation in 1/17 patient (6 %).ConclusionTAE is an effective and safe treatment option for ruptured SAPA in hemodynamically unstable patients, with a success rate of 94 %. Our results suggest that TAE should be the favored option in patients with hemodynamic instability due to ruptured SAPA

  17. Role and Effectiveness of Percutaneous Arterial Embolization in Hemodynamically Unstable Patients with Ruptured Splanchnic Artery Pseudoaneurysms

    Energy Technology Data Exchange (ETDEWEB)

    Dohan, Anthony, E-mail: anthony.dohan@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Eveno, Clarisse, E-mail: clarisse.eveno@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Dautry, Raphael, E-mail: raphael.dautry@lrb.aphp.fr; Guerrache, Youcef, E-mail: docyoucef05@yahoo.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Camus, Marine, E-mail: marine.camus@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Boudiaf, Mourad, E-mail: mourad.boudiaf@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Gayat, Etienne, E-mail: etienne.gayat@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Dref, Olivier Le, E-mail: olivier.ledref@lrb.aphp.fr; Sirol, Marc, E-mail: marc.sirol@lrb.aphp.fr; Soyer, Philippe, E-mail: philippe.soyer@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France)

    2015-08-15

    PurposeTo assess the role and effectiveness of percutaneous arterial embolization (TAE) in patients with hemodynamic instability due to hypovolemic shock secondary to ruptured splanchnic artery pseudoaneurysms (SAPA).Materials and MethodsSeventeen patients (11 men, 6 women; mean age, 53 years) with hemodynamic instability (systolic blood pressure <90 mmHg) due to hypovolemic shock secondary to ruptured SAPA were treated by TAE. Clinical files, multidetector row computed tomography angiography, and angiographic examinations along with procedure details were reviewed.ResultsSeventeen SAPAs were present, predominantly located on gastroduodenal or pancreatic arteries (9/17; 53 %). Angiography showed extravasation of contrast medium from SAPA in 15/17 patients (88 %). Technical success rate of TAE was 100 %. TAE was performed using metallic coils in all patients (100 %), in association with gelatin sponge in 5/17 patients (29 %). TAE allowed controlling the bleeding and returning to normal hemodynamic status in 16/17 patients (94 %). In 1/17 patient (6 %), surgery was needed to definitively control the bleeding. The mortality and morbidity rate of TAE at 30 days were 0 and 12 %, respectively. Morbidity consisted in coil migration in 1/17 patient (6 %) and transient serum liver enzyme elevation in 1/17 patient (6 %).ConclusionTAE is an effective and safe treatment option for ruptured SAPA in hemodynamically unstable patients, with a success rate of 94 %. Our results suggest that TAE should be the favored option in patients with hemodynamic instability due to ruptured SAPA.

  18. Monitoring and Assessing the 2012 Drought in the Great Plains: Analyzing Satellite-Retrieved Solar-Induced Chlorophyll Fluorescence, Drought Indices, and Gross Primary Production

    Directory of Open Access Journals (Sweden)

    Siheng Wang

    2016-01-01

    Full Text Available We examined the relationship between satellite measurements of solar-induced chlorophyll fluorescence (SIF and several meteorological drought indices, including the multi-time-scale standard precipitation index (SPI and the Palmer drought severity index (PDSI, to evaluate the potential of using SIF to monitor and assess drought. We found significant positive relationships between SIF and drought indices during the growing season (from June to September. SIF was found to be more sensitive to short-term SPIs (one or two months and less sensitive to long-term SPI (three months than were the normalized difference vegetation index (NDVI or the normalized difference water index (NDWI. Significant correlations were found between SIF and PDSI during the growing season for the Great Plains. We found good consistency between SIF and flux-estimated gross primary production (GPP for the years studied, and synchronous declines of SIF and GPP in an extreme drought year (2012. We used SIF to monitor and assess the drought that occurred in the Great Plains during the summer of 2012, and found that although a meteorological drought was experienced throughout the Great Plains from June to September, the western area experienced more agricultural drought than the eastern area. Meanwhile, SIF declined more significantly than NDVI during the peak growing season. Yet for senescence, during which time the reduction of NDVI still went on, the reduction of SIF was eased. Our work provides an alternative to traditional reflectance-based vegetation or drought indices for monitoring and assessing agricultural drought.

  19. Effect of elastic anisotropy of crystal grain on stress intensity factor

    International Nuclear Information System (INIS)

    Kamaya, Masayuki

    2002-01-01

    The stress intensity factor (SIF) is used widely for evaluating integrity of cracked components. Usually, the SIF obtained under isotropic elastic conditions is used for the evaluations. Although, macroscopic elastic behaviors of polycrystal materials can be considered isotropic, each crystal has anisotropic elastic properties. This implies that if the crack size is small and the influence of anisotropic elastic properties on the stress around cracks is significant, the SIF evaluated under anisotropic elastic conditions may differ from the SIF obtained under isotropic elastic conditions. In the present study, the effect of anisotropic elasticity on the SIF was evaluated by using the finite element analysis (FEA). First, the SIF of semi-circular cracks located in a single crystal was evaluated. It was found that the SIF is affected crystal orientation. Secondly, FEA using a polycrystal model was performed. It was found that the change in the SIF was caused by crack tip crystal orientation as well as the deformation constraint from neighboring crystals. Finally, the statistical tendency of change in the SIF caused by the anisotropic elastic properties and the relationship with crack size were examined. The influence of the local SIF on crack growth behavior is also discussed. (author)

  20. Effect of elastic anisotropy of crystal grain on stress intensity factor

    Energy Technology Data Exchange (ETDEWEB)

    Kamaya, Masayuki [Inst. of Nuclear Safety System Inc., Mihama, Fukui (Japan)

    2002-09-01

    The stress intensity factor (SIF) is used widely for evaluating integrity of cracked components. Usually, the SIF obtained under isotropic elastic conditions is used for the evaluations. Although, macroscopic elastic behaviors of polycrystal materials can be considered isotropic, each crystal has anisotropic elastic properties. This implies that if the crack size is small and the influence of anisotropic elastic properties on the stress around cracks is significant, the SIF evaluated under anisotropic elastic conditions may differ from the SIF obtained under isotropic elastic conditions. In the present study, the effect of anisotropic elasticity on the SIF was evaluated by using the finite element analysis (FEA). First, the SIF of semi-circular cracks located in a single crystal was evaluated. It was found that the SIF is affected crystal orientation. Secondly, FEA using a polycrystal model was performed. It was found that the change in the SIF was caused by crack tip crystal orientation as well as the deformation constraint from neighboring crystals. Finally, the statistical tendency of change in the SIF caused by the anisotropic elastic properties and the relationship with crack size were examined. The influence of the local SIF on crack growth behavior is also discussed. (author)

  1. Continuous Measurements of Canopy-level Solar-Induced Chlorophyll Fluorescence for Inferring Diurnal and Seasonal Dynamics of Photosynthesis in Crop Fields in the Midwestern USA

    Science.gov (United States)

    Miao, G.; Guan, K.; Yang, X.; Bernacchi, C.; DeLucia, E. H.; Cai, Y.; Masters, M. D.; Peng, B.

    2016-12-01

    Plants emitted photons of red and far-red light, called chlorophyll fluorescence, after sunlight absorption for photosynthesis. This solar-induced fluorescence (SIF) is generated simultaneously while plants actively photosynthesize. The link between photosynthesis and SIF resulting from the competition for the same excitation energy has long been investigated and applied for inferring the rate of photosynthesis. Recent development of continuous SIF observational technology is furthering the inferring potential as well as our understandings of fluctuations of SIF and photosynthesis with changes in environmental conditions. To better understand this photosynthesis-SIF link at multiple time scales and their relationships with environmental drivers, we deployed two newly developed tower-based SIF systems (FluoSpec) in a corn (Zea mays L., C4 plant) field and a soybean (Glycine max L., C3 plant) field at University of Illinois Energy Farm and conducted continuous near-surface SIF measurements at canopy scale from mid-growing season of 2016. Eddy covariance flux towers were installed in parallel at both sites for canopy-scale gas exchange measurements. Relationship between SIF and flux tower photosynthesis will be analyzed to derive the empirical models for photosynthesis retrieval from SIF signals. Preliminary results indicate that canopy SIF can reflect diurnal and seasonal dynamics of photosynthesis. Mechanistic analysis on SIF fluctuations and responses to environmental variations will be conducted as well for a closer look at mechanism of photosynthetic responses. Corn and soybean SIF and photosynthesis-SIF relationship will be compared to investigate the difference between C4 and C3 plants.

  2. Reliability and validity of the Farsi version of the standardized assessment of personality-abbreviated scale

    Directory of Open Access Journals (Sweden)

    Maryam Sepehri

    2017-06-01

    Full Text Available Introduction: A short screening tool for high-risk individuals with personality disorder (PD is useful both for clinicians and researchers. The aim of this study was to assess the validity and reliability of the Farsi version of the Standardized Assessment of Personality-Abbreviated Scale (SAPAS. Methods: The original English version of the SAPAS questionnaire was translated into Farsi, and then, translated back into English by two professionals. A survey was then conducted using the questionnaire on 150 clients of primary health care centers in Tabriz, Iran. A total of 235 medical students were also studied for the reliability assessment of the questionnaire. The SAPAS was compared to the short form of Minnesota Multiphasic Personality Inventory (MMPI. The data analysis was performed using receiver operating characteristic (ROC curve technique, operating characteristic for diagnostic efficacy, Cronbach's alpha, and test-retest for reliability evaluation. Results: We found an area under the curve (AUC of 0.566 [95% confidence intervals (CI: 0.455-0.677]; sensitivity of 0.89 and specificity of 0.26 at the cut-off score of 2 and higher. The total Cronbach's alpha coefficient was 0.38 and Cohen's kappa ranged between 0.5 and 0.8. Conclusion: The current study showed that the Farsi version of the SAPAS was relatively less efficient, in term of validity and reliability, in the screening of PD in the population.

  3. Systemic Arterial-to-Pulmonary Artery Shunt Utilization

    African Journals Online (AJOL)

    multiruka1

    In certain circumstances, such as cyanotic neonates with tetralogy of Fallot (4) or cyanotic patients with. Tetralogy of Fallot and hypoplastic pulmonary arteries. (5), better outcomes are obtained if definitive surgery. (total correction or palliation) is preceded by creation of a systemic arterial-to-pulmonary artery shunt (SAPAS).

  4. Angular Normalization of Ground and Satellite Observations of Sun-induced Chlorophyll Fluorescence for Assessing Vegetation Productivity

    Science.gov (United States)

    Chen, J. M.; He, L.; Chou, S.; Ju, W.; Zhang, Y.; Joiner, J.; Liu, J.; Mo, G.

    2017-12-01

    Sun-induced chlorophyll fluorescence (SIF) measured from plant canopies originates mostly from sunlit leaves. Observations of SIF by satellite sensors, such as GOME-2 and GOSAT, are often made over large view zenith angle ranges, causing large changes in the viewed sunlit leaf fraction across the scanning swath. Although observations made by OCO-2 are near nadir, the observed sunlit leaf fraction could still vary greatly due to changes in the solar zenith angle with latitude and time of overpass. To demonstrate the importance of considering the satellite-target-view geometry in using SIF for assessing vegetation productivity, we conducted multi-angle measurements of SIF using a hyperspectral sensor mounted on an automated rotating system over a rice field near Nanjing, China. A method is developed to separate SIF measurements at each angle into sunlit and shaded leaf components, and an angularly normalized canopy-level SIF is obtained as the weighted sum of sunlit and shaded SIF. This normalized SIF is shown to be a much better proxy of GPP of the rice field measured by an eddy covariance system than the unnormalized SIF observations. The same normalization scheme is also applied to the far-red GOME-2 SIF observations on sunny days, and we found that the normalized SIF is better correlated with model-simulated GPP than the original SIF observations. The coefficient of determination (R2) is improved by 0.07±0.04 on global average using the normalization scheme. The most significant improvement in R2 by 0.09±0.04 is found in deciduous broadleaf forests, where the observed sunlit leaf fraction is highly sensitive to solar zenith angle.

  5. The influence of mineralization on the phase composition and properties of low-burned clay-dolomited composition materials

    International Nuclear Information System (INIS)

    Shirin-zade, I.N.; Ganbarov, D.M.

    2008-01-01

    With aim of acceleration of dissociation of carbonates in clay-dolomited compositions Na 2 SiF 6 was added. Addition mineralization raise stability of composition reaches 20-30 MPa. Na 2 SiF 6 mineralization makes more active decomposition of dolomite and accelerate appearance of new creations. It was experimentally proved that adding of mineralization of Na 2 SiF 6 promote to appearance in mixture of intermediate double salts which are bring down temperature of dissociation of carbonates. Accelerated action of mineralization Na 2 SiF 6 accepted by x-ray, DTA and x-ray spectroscopy

  6. Semiconductor Grade, Solar Silicon Purification Project. [photovoltaic solar energy conversion

    Science.gov (United States)

    Ingle, W. M.; Rosler, R. S.; Thompson, S. W.; Chaney, R. E.

    1979-01-01

    A low cost by-product, SiF4, is reacted with mg silicon to form SiF2 gas which is polymerized. The (SiF2)x polymer is heated forming volatile SixFy homologues which disproportionate on a silicon particle bed forming silicon and SiF4. The silicon analysis procedure relied heavily on mass spectroscopic and emission spectroscopic analysis. These analyses demonstrated that major purification had occured and some samples were indistinguishable from semiconductor grade silicon (except possibly for phosphorus). However, electrical analysis via crystal growth reveal that the product contains compensated phosphorus and boron.

  7. The 2010 Russian Drought Impact on Satellite Measurements of Solar-Induced Chlorophyll Fluorescence: Insights from Modeling and Comparisons with the Normalized Differential Vegetation Index (NDVI)

    Science.gov (United States)

    Yoshida, Y.; Joiner, J.; Tucker, C.; Berry, J.; Lee, J. -E.; Walker, G.; Reichle, R.; Koster, R.; Lyapustin, A.; Wang, Y.

    2015-01-01

    We examine satellite-based measurements of chlorophyll solar-induced fluorescence (SIF) over the region impacted by the Russian drought and heat wave of 2010. Like the popular Normalized Difference Vegetation Index (NDVI) that has been used for decades to measure photosynthetic capacity, SIF measurements are sensitive to the fraction of absorbed photosynthetically-active radiation (fPAR). However, in addition, SIF is sensitive to the fluorescence yield that is related to the photosynthetic yield. Both SIF and NDVI from satellite data show drought-related declines early in the growing season in 2010 as compared to other years between 2007 and 2013 for areas dominated by crops and grasslands. This suggests an early manifestation of the dry conditions on fPAR. We also simulated SIF using a global land surface model driven by observation-based meteorological fields. The model provides a reasonable simulation of the drought and heat impacts on SIF in terms of the timing and spatial extents of anomalies, but there are some differences between modeled and observed SIF. The model may potentially be improved through data assimilation or parameter estimation using satellite observations of SIF (as well as NDVI). The model simulations also offer the opportunity to examine separately the different components of the SIF signal and relationships with Gross Primary Productivity (GPP).

  8. Comparison of Sun-Induced Chlorophyll Fluorescence Estimates Obtained from Four Portable Field Spectroradiometers

    Science.gov (United States)

    Julitta, Tommaso; Corp, Lawrence A.; Rossini, Micol; Burkart, Andreas; Cogliati, Sergio; Davies, Neville; Hom, Milton; Mac Arthur, Alasdair; Middleton, Elizabeth M.; Rascher, Uwe; hide

    2016-01-01

    Remote Sensing of Sun-Induced Chlorophyll Fluorescence (SIF) is a research field of growing interest because it offers the potential to quantify actual photosynthesis and to monitor plant status. New satellite missions from the European Space Agency, such as the Earth Explorer 8 FLuorescence EXplorer (FLEX) mission-scheduled to launch in 2022 and aiming at SIF mapping-and from the National Aeronautics and Space Administration (NASA) such as the Orbiting Carbon Observatory-2 (OCO-2) sampling mission launched in July 2014, provide the capability to estimate SIF from space. The detection of the SIF signal from airborne and satellite platform is difficult and reliable ground level data are needed for calibration/validation. Several commercially available spectroradiometers are currently used to retrieve SIF in the field. This study presents a comparison exercise for evaluating the capability of four spectroradiometers to retrieve SIF. The results show that an accurate far-red SIF estimation can be achieved using spectroradiometers with an ultrafine resolution (less than 1 nm), while the red SIF estimation requires even higher spectral resolution (less than 0.5 nm). Moreover, it is shown that the Signal to Noise Ratio (SNR) plays a significant role in the precision of the far-red SIF measurements.

  9. Mode I Stress Intensity Factors for triangular corner crack nearby intersecting of cylindrical holes

    Directory of Open Access Journals (Sweden)

    E. Salvati

    2013-10-01

    Full Text Available In this paper triangular flaws has been taken into account at the intersection of two holes inside a specified specimen. Influence of bore hole D1/D2 and angle between their axes α are examined. Numerical analysis are performed to determine Stress Intensity factors (SIF in many geometric configurations. Afterwards, fitting weight function’s parameters with FEM results, new SIF analytics expression are shown. Finally, the accuracy of weight functions in SIF predictions for different inner pressure, has been checked as well as the comparison between the SIF of a triangular crack and that of an actual crack shape obtained through a fatigue test.

  10. 77 FR 30263 - Proposed Information Collection; Comment Request

    Science.gov (United States)

    2012-05-22

    ... proposed data collection for the Social Innovation Fund (SIF) National Evaluation. Research questions for... brief telephone surveys with 138 sub grantees to obtain contextual and explanatory information...

  11. Stress intensities for nozzle cracks in reactor vessels. Reporting period, January 1, 1976--October 31, 1976

    International Nuclear Information System (INIS)

    Smith, C.W.; Jolles, M.; Peters, W.H.

    1976-11-01

    A series of six frozen stress photoelastic tests was conducted to investigate the distribution of stress intensity factor (SIF) along a crack which occurred at the juncture of a pipe (nozzle) with a cylindrical pressure vessel. Typical photoelastic fringe patterns are shown for slices which were taken mutually orthogonal to the flaw border and the flaw surface. A typical plot of normalized apparent SIF versus square root of normalized distance from the crack tip is presented. The variation in SIF along the flaw border is given for all six different crack geometries and also the variation of SIF with varying a/T is presented. 40 references

  12. Evaluation of fingerprinting techniques to assess genotype variation among Zygosaccharomyces strains.

    Science.gov (United States)

    Dakal, Tikam Chand; Solieri, Lisa; Giudici, Paolo

    2018-06-01

    Molecular typing techniques are key tools in surveillance of food spoilage yeasts, in investigations on intra-species population diversity, and in tracing selected starters during fermentation. Unlike previous works on strain typing of Zygosaccharomyces spoilage species, here Zygosaccharomyces mellis and the Zygosaccharoymces rouxii complex yeasts, which include Z. rouxii, Zygosaccharomyces sapae, and a mosaic lineage (ML) of putatively hybrids, were evaluated by three typing methods for intra- and inter-species resolution. Overall these yeasts are relevant for food fermentation and spoilage, but are quite difficult to discriminate at strain and species level as they evolved by reticulation. A pool of 76 strains from different sources were typed by M13 and (GTG) 5 MSP-PCR fingerprinting and PCR-RFLP of ribosomal intergenic spacer region (IGS). We demonstrated that M13 overcame (GTG) 5 fingerprinting to group Z. sapae, Z. rouxii, Z. mellis and the ML isolates in congruent distinct clusters. Even if (GTG) 5 primer yielded a number of DNA fingerprints comparable with those obtained by M13 primer, it failed to discriminate Z. sapae, Z. mellis and Z. rouxii at species level. Clustering of IGS RFLP patterns obtained with three endonucleases produced groups congruent with species assignment and highlighted intra-species diversity similar to that observed by M13 fingerprinting. However, IGS PCR amplification failed for 14 ML and 6 Z. mellis strains under the experimental conditions tested here, indicating that this marker could be less easy to use in fast typing protocol. Finally, our results posit that the genetic diversity within Z. sapae and Z. mellis could be shaped by isolation source. The information generated in this study would facilitate the monitoring of these yeasts during food processing and storage, and provides preliminary evidences about Z. sapae and Z. mellis intra-species diversity. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Wavelength-dependent ability of solar-induced chlorophyll fluorescence to estimate GPP

    Science.gov (United States)

    Liu, L.

    2017-12-01

    Recent studies have demonstrated that solar-induced chlorophyll fluorescence (SIF) can offer a new way for directly estimating the terrestrial gross primary production (GPP). In this paper, the wavelength-dependent ability of SIF to estimate GPP was investigated using both simulations by SCOPE model (Soil Canopy Observation, Photochemistry and Energy fluxes) and observations at the canopy level. Firstly, the response of the remotely sensed SIF at the canopy level to the absorbed photosynthetically active radiation (APAR ) was investigated. Both the simulations and observations confirm a linear relationship between canopy SIF and APAR, while it is species-specific and affected by biochemical components and canopy structure. The ratio of SIF to APAR varies greatly for different vegetation types, which is significant larger for canopy with horizontal structure than it with vertical structure. At red band, the ratio also decreases noticeable when chlorophyll content increases. Then, the performance of SIF to estimate GPP was investigated using diurnal observations of winter wheat at different grow stages. The results showed that the diurnal GPP could be robustly estimated from the SIF spectra for winter wheat at each growth stage, while the correlation weakened greatly at red band if all the observations made at different growth stages or all simulations with different LAI values were pooled together - a situation which did not occur at the far-red band. Finally, the SIF-based GPP models derived from the 2016 observations on winter wheat were well validated using the dataset from 2015, which give better performance for SIF at far-red band than that at red band. Therefore, it is very important to correct for reabsorption and scattering of the SIF radiative transfer from the photosystem to the canopy level before the remotely sensed SIF is linked to the GPP, especially at red band.

  14. Theoretical Investigations of CO 2 and H 2 Sorption in an Interpenetrated Square-Pillared Metal–Organic Material

    KAUST Repository

    Pham, Tony; Forrest, Katherine A.; McLaughlin, Keith; Tudor, Brant; Nugent, Patrick; Hogan, Adam; Mullen, Ashley; Cioce, Christian R.; Zaworotko, Michael J.; Space, Brian

    2013-01-01

    Simulations of CO2 and H2 sorption and separation were performed in [Cu(dpa)2SiF6-i], a metal-organic material (MOM) consisting of an interpenetrated square grid of Cu2+ ions coordinated to 4,4′-dipyridylacetylene (dpa) rings and pillars of SiF6 2

  15. Social Innovation Fund: Finding What Works, Making It Work for More People

    Science.gov (United States)

    Corporation for National and Community Service, 2017

    2017-01-01

    The Social Innovation Fund (SIF), a program of the Corporation for National and Community Service (CNCS), supports the growth of effective programs, and the development of innovative approaches to solve the country's most intractable problems. The SIF directs resources towards efforts in the areas of youth development, economic opportunity, and…

  16. Stocks in the Future: An Examination of Participant Outcomes in 2014-15

    Science.gov (United States)

    Durham, Rachel E.

    2016-01-01

    This report features research on Stocks in the Future (SIF), a financial literacy program for middle-grades students. The goals of SIF are to serve underrepresented, socioeconomically disadvantaged students in schools where more than 50% are eligible for free/reduced-price meals, achieve stronger student attendance and greater attachment to…

  17. UPSCALING OF SOLAR INDUCED CHLOROPHYLL FLUORESCENCE FROM LEAF TO CANOPY USING THE DART MODEL AND A REALISTIC 3D FOREST SCENE

    Directory of Open Access Journals (Sweden)

    W. Liu

    2017-10-01

    Full Text Available Solar induced chlorophyll a fluorescence (SIF has been shown to be an excellent proxy of photosynthesis at multiple scales. However, the mechanical linkages between fluorescence and photosynthesis at the leaf level cannot be directly applied at canopy or field scales, as the larger scale SIF emission depends on canopy structure. This is especially true for the forest canopies characterized by high horizontal and vertical heterogeneity. While most of the current studies on SIF radiative transfer in plant canopies are based on the assumption of a homogeneous canopy, recently codes have been developed capable of simulation of fluorescence signal in explicit 3-D forest canopies. Here we present a canopy SIF upscaling method consisting of the integration of the 3-D radiative transfer model DART and a 3-D object model BLENDER. Our aim was to better understand the effect of boreal forest canopy structure on SIF for a spatially explicit forest canopy.

  18. Stress intensity factors of eccentric cracks in bi-materials plate under mode I loading

    Energy Technology Data Exchange (ETDEWEB)

    Ismail, A. E. [Faculty of Mechanical and Manufacturing Engineering, Universiti Tun Hussein Onn Malaysia, 86400 Batu Pahat, Johor (Malaysia)

    2015-05-15

    Bi-material plates were generally used to joint electronic devices or mechanical components requiring dissimilar materials to be attached. During services, mechanical failure can be occurred due to the formation of cracks at the interfacial joint or away from the centre. Generally, linear elastic fracture mechanics approach is used to characterize these cracks based on stress intensity factors (SIF). Based on the literature survey, the SIFs for the central cracks were easily available. However, the SIFs for eccentric cracks were difficult to obtain. Therefore, this paper presented the SIFs for eccentric cracks subjected to mode I tension loading. Three important parameters were used such as relative crack depth, a/L, relative offset distance, b/L and elastic mismatch, E{sub 1}/E{sub 2} or α. It was found that such parameters significantly affected the characteristic of SIFs and it was depend on the location of cracks.

  19. Solar-Induced Fluorescence of Maize Across A Water Stress Gradient in the Midwestern USA

    Science.gov (United States)

    Miao, G.; Guan, K.; Suyker, A.; Yang, X.; Benarcchi, C. J.; Gamon, J. A.; Berry, J. A.; DeLucia, E.; Franz, T.; Arkebauer, T. J.; Zygielbaum, A. I.; Walter-Shea, E. A.; Moore, C.; Zhang, Y.; Kim, H.; Hmimina, G.

    2017-12-01

    In the coming decades, agricultural ecosystems will be challenged by rising temperatures, changing rainfall patterns, and increasing extreme weather. Understanding how crops respond to weather variability and how humans manage agriculture to mitigate and adapt to climate change is critical for improving agricultural sustainability and supporting increasing global food demands. Accurately estimating gross primary productivity (GPP) of crops is of importance to evaluate their sustainability and capability but remains a challenge. The recent development of solar-induced fluorescence (SIF) technology is stimulating studies to use SIF to approximate GPP. It has been observed that agricultural lands have remarkably high SIF and the SIF signal could be used as an indicator of vegetation stress, which is particularly valuable for improved monitoring of crop productivity and stress. To investigate the applicability of SIF for detecting maize stress and estimating GPP, we deployed three FluoSpec2 systems in 2017 at three long-term eddy covariance flux sites across the US Corn Belt, a rain-fed maize field (AmeriFlux sites US-NE3) and an irrigated maize field (US-NE2) at Mead, Nebraska and a rain-fed maize field at Urbana, Illinois. Together these form a water stress gradient. Variations in GPP, SIF, photosynthetic efficiency (LUE), SIF yield (SIFy), and relationships between GPP and SIF, LUE and SIFy will be compared as indications of the difference in maize growth across the water stress gradient. More importantly, differences in GPP and SIF signals will be examined over multiple growth stages to assess the potential of SIF in identifying the growth stages that are mostly affected by water stress and the ones that play the most important roles on the crop yield.

  20. Evaluating the relationships between solar-induced chlorophyll fluorescence from Orbiting Carbon Observatory-2 and gross primary productivity from eddy covariance flux towers

    Science.gov (United States)

    Li, X.; Xiao, J.; He, B.

    2017-12-01

    Solar-induced chlorophyll fluorescence (SIF) opens a new perspective on the monitoring of vegetation photosynthesis from space, and has been recently used to estimate gross primary productivity (GPP). However, previous studies on SIF were mainly based on satellite observations from the Greenhouse Gases Observing Satellite (GOSAT) and Global Ozone Monitoring Experiment-2 (GOME-2), and the evaluation of these coarse-resolution SIF measurements using GPP derived from eddy covariance (EC) flux towers has been hindered by the scale mismatch between satellite and tower footprints. We use new far-red SIF observations from the Orbiting Carbon Observatory-2 (OCO-2) satellite with much finer spatial resolution and GPP data from EC flux towers from 2014 to 2016 to examine the relationship between GPP and SIF for temperate forests. The OCO-2 SIF tracked tower GPP fairly well, and had strong correlation with tower GPP at both retrieval bands (757nm and 771nm) and both instantaneous (mid-day) and daily timescales. Daily SIF at 757nm (SIF757) exhibited much stronger correlation with tower GPP compared to MODIS enhanced vegetation index (EVI) and normalized difference vegetation index (NDVI) derived from either Terra or Aqua and had a similarly strong relationship as EVI based on the bidirectional reflectance distribution function (BRDF) corrected reflectance product (Terra+Aqua). Absorbed photosynthetically active radiation (APAR) explained 85% of the variance in SIF757, while the product of APAR and two environmental scalars - fTmin and fVPD (representing minimum temperature stress and water stress) explained slightly higher variance (92%) in SIF757. This suggests that SIF mainly depends on APAR and also contains information on light use efficiency (LUE) reflecting environmental stresses and physiological or biochemical variations of vegetation. The hyperbolic model based on SIF757 estimated GPP well (R2=0.81, pmodel - the MODSI GPP algorithm. Our findings demonstrate the strong

  1. Early Diagnosis of Congenital Trypanosoma cruzi Infection, Using Shed Acute Phase Antigen, in Ushuaia, Tierra del Fuego, Argentina

    Science.gov (United States)

    Mallimaci, María Cristina; Sosa-Estani, Sergio; Russomando, Graciela; Sanchez, Zunilda; Sijvarger, Carina; Alvarez, Isabel Marcela; Barrionuevo, Lola; Lopez, Carlos; Segura, Elsa Leonor

    2010-01-01

    Chagas' disease, or American trypanosomiasis, is caused by the protozoan parasite Trypanasoma cruzi. It is estimated that 15,000 new cases of congenital T. cruzi transmission occur in the Americas each year. The aim of this study was to estimate the rate of congenital T. cruzi infection in infants born to infected women living in Ushuaia, Argentina, as well to assess a serologic test using Shed Acute Phase Antigen (SAPA) for a timely diagnosis of congenital infection. The rate of congenital infection among children in the study was 4.4% (3/68). Our results show that for infants younger than 30 days of age, matched blood samples from mother and infant were capable of identifying congenital transmission of infection using an enzyme-linked immunosorbent assay with SAPA. For infants older than 3 months, congenital infection could be ruled out using the same procedure. PMID:20064996

  2. Order of age at onset for substance use, substance use disorder, conduct disorder and psychiatric illness

    DEFF Research Database (Denmark)

    Guldager, Steen; Linneberg, Inger Holm; Hesse, Morten

    2012-01-01

    of Personality – Abbreviated Scale (SAPAS), completed the MCMI-III, the Beck Anxiety Inventory (BAI), and were rated with the Montgomery Åsberg Depression Rating Scale. Age at onset was lowest for conduct disorder/antisocial behaviour, followed by tasting alcohol, trying drugs, post-traumatic stress disorder...... for non-substance related disorder in 72%. Patients reporting that their axis I disorder predated their SUD reported more severe problems currently on the BAI and the SAPAS. Patients reporting that their conduct disorder/antisocial personality disorder criteria predated their SUD reported more aggressive......-sadistic personality traits than patients reporting that SUD predated conduct disorder/antisocial personality, but did not differ in terms of antisocial personality disorder traits. The findings are discussed in terms of their clinical implications....

  3. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (

  4. Sub-Saharan Africa Report, No. 2826

    Science.gov (United States)

    1983-07-27

    Begins Housing Sales to Blacks (Johannesburg Domestic Service, 1 Jul 83) 79 Roles of Black Farmers, U.S. Firms Discussed (SAPA, 7 Jul 83...advanced technology and superpowers. Yet how many in Africa will share his sentiment if only because it is a necessary subject about which to talk and...some of the shocks, and prevent a dangerous internationalisation . Col. Mengistu, the new OAU Chairman, who has entered the fray to criticise Zaire’s

  5. Predictors of Sexual Intercourse Frequency Among Couples Trying to Conceive.

    Science.gov (United States)

    Gaskins, Audrey J; Sundaram, Rajeshwari; Buck Louis, Germaine M; Chavarro, Jorge E

    2018-04-01

    Little is known about the predictors of sexual intercourse frequency (SIF) among couples trying to conceive despite the well-established link between SIF and fecundity. To evaluate men's and women's demographic, occupational, and lifestyle predictors of SIF among couples. 469 Couples without a history of infertility participating in the Longitudinal Investigation of Fertility and the Environment Study (2005-2009) were followed up for ≤1 year while trying to conceive. At enrollment, both partners were interviewed about demographic, occupational, lifestyle, and psychological characteristics using standardized questionnaires. Multivariable generalized linear mixed models with Poisson distribution were used to estimate the adjusted percent difference in SIF across exposure categories. SIF was recorded in daily journals and summarized as average SIF/mo. The median (interquartile range) SIF during follow-up was 6 (4-9) acts/mo. For every year increase in age for women and men, SIF decreased by -0.8% (95% CI -2.5 to 1.0%) and -1.7% (95% CI -3.1 to -0.3%). Women with high school education or less and those of non-white race had 34.4% and 16.0% higher SIF, respectively. A similar trend was seen for men's education and race. Only couples where both partners (but not just 1 partner) worked rotating shifts had -39.1% (95% CI -61.0 to -5.0%) lower SIF compared to couples where neither partner worked rotating shifts. Men's (but not women's) exercise was associated with 13.2% (95% CI 1.7-26.0%) higher SIF. Diagnosis of a mood or anxiety disorder in men (but not women) was associated with a 26.0% (95% CI -42.7 to -4.4%) lower SIF. Household income, smoking status, body mass index, night work, alcohol intake, and psychosocial stress were not associated with SIF. Even among couples trying to conceive, there was substantial variation in SIF. Both partners' age, education, race, and rotating shift work as well as men's exercise and mental health play an important role in determining

  6. New Methods for Retrieval of Chlorophyll Red Fluorescence from Hyperspectral Satellite Instruments: Simulations and Application to GOME-2 and SCIAMACHY

    Science.gov (United States)

    Joiner, Joanna; Yoshida, Yasuko; Guanter, Luis; Middleton, Elizabeth M.

    2016-01-01

    Global satellite measurements of solar-induced fluorescence (SIF) from chlorophyll over land and ocean have proven useful for a number of different applications related to physiology, phenology, and productivity of plants and phytoplankton. Terrestrial chlorophyll fluorescence is emitted throughout the red and far-red spectrum, producing two broad peaks near 683 and 736nm. From ocean surfaces, phytoplankton fluorescence emissions are entirely from the red region (683nm peak). Studies using satellite-derived SIF over land have focused almost exclusively on measurements in the far red (wavelengths greater than 712nm), since those are the most easily obtained with existing instrumentation. Here, we examine new ways to use existing hyperspectral satellite data sets to retrieve red SIF (wavelengths less than 712nm) over both land and ocean. Red SIF is thought to provide complementary information to that from the far red for terrestrial vegetation. The satellite instruments that we use were designed to make atmospheric trace-gas measurements and are therefore not optimal for observing SIF; they have coarse spatial resolution and only moderate spectral resolution (0.5nm). Nevertheless, these instruments, the Global Ozone Monitoring Instrument 2 (GOME-2) and the SCanning Imaging Absorption spectroMeter for Atmospheric CHartographY (SCIAMACHY), offer a unique opportunity to compare red and far-red terrestrial SIF at regional spatial scales. Terrestrial SIF has been estimated with ground-, aircraft-, or satellite-based instruments by measuring the filling-in of atmospheric andor solar absorption spectral features by SIF. Our approach makes use of the oxygen (O2) gamma band that is not affected by SIF. The SIF-free O2 gamma band helps to estimate absorption within the spectrally variable O2 B band, which is filled in by red SIF. SIF also fills in the spectrally stable solar Fraunhofer lines (SFLs) at wavelengths both inside and just outside the O2 B band, which further helps

  7. Drivers and variability of the Chl fluorescence emission spectrum from the leaf through the canopy

    Science.gov (United States)

    Magney, T. S.; Frankenberg, C.; Grossman, K.; Koehler, P.; North, G.; Porcar-Castell, A.; Stutz, J.; Fisher, J.

    2017-12-01

    Recent advances in the retrieval of solar induced chlorophyll fluorescence (SIF) from remote sensing platforms provide a significant step towards mapping instantaneous plant photosynthesis across space and time. However, our current understanding of the variability and controls on the shape of the chlorophyll fluorescence (ChlF) spectrum is limited. To address these uncertainties, we have developed instrumentation to make highly resolved spectral measurements of SIF from both leaf and canopy scales. At the leaf scale, we simultaneously collected active (PAM) and passive (675-850 nm) fluorescence with photosynthesis across a range of species and conditions; and at the canopy scale, diurnal and seasonal Fraunhofer-based SIF retrievals across the red and far-red spectrum are made at four different flux tower sites (Costa Rica, Iowa (2), and Colorado). From both of these scales we are able to determine (1) the variability in steady-state spectra across species and individuals; and (2) the environmental, functional, and structural controls on SIF. Here we report on the sensitivity of SIF spectra from a singular value decomposition analysis; and present on the mechanisms - pigment concentration, species, non-photochemical and photochemical quenching, and environmental conditions - controlling SIF variability. Further, we will discuss how an improved understanding of leaf-level variability can inform canopy level SIF, and ultimately how such information may enable proper interpretation of satellite retrievals.

  8. Impacts of short-term heatwaves on sun-induced chlorophyll fluorescence(SiF) in temperate tree species

    Science.gov (United States)

    Wang, F.; Gu, L.; Guha, A.; Han, J.; Warren, J.

    2017-12-01

    The current projections for global climate change forecast an increase in the intensity and frequency of extreme climatic events, such as droughts and short-term heat waves. Understanding the effects of short-term heat wave on photosynthesis process is of critical importance to predict global impacts of extreme weather event on vegetation. The diurnal and seasonal characteristics of SIF emitted from natural vegetation, e.g., forest and crop, have been studied at the ecosystem-scale, regional-scale and global-scale. However, the detailed response of SIF from different plant species under extremely weather event, especially short-term heat wave, have not been reported. The purpose of this study was to study the response of solar-induced chlorophyll fluorescence, gas exchange and continuous fluorescence at leaf scale for different temperate tree species. The short-term heatwave experiment was conducted using plant growth chamber (CMP6050, Conviron Inc., Canada). We developed an advanced spectral fitting method to obtain the plant SIF in the plant growth chamber. We compared SIF variation among different wavelength and chlorophyll difference among four temperate tree species. The diurnal variation of SIF signals at leaf-scales for temperate tree species are different under heat stress. The SIF response at leaf-scales and their difference for four temperate tree species are different during a cycle of short-term heatwave stress. We infer that SIF be used as a measure of heat tolerance for temperate tree species.

  9. Common site of subchondral insufficiency fractures of the femoral head based on three-dimensional magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Iwasaki, Kenyu; Yamamoto, Takuaki; Motomura, Goro; Karasuyama, Kazuyuki; Sonoda, Kazuhiko; Kubo, Yusuke; Iwamoto, Yukihide [Kyushu University, Department of Orthopaedic Surgery Graduate School of Medical Sciences, Higashi-ku, Fukuoka (Japan)

    2016-01-15

    The objective of this study was to investigate the common sites of subchondral insufficiency fractures of the femoral head (SIF) based on three-dimensional (3-D) reconstruction of MR images. In 33 hips of 31 consecutive patients diagnosed with SIF, 3-D reconstruction of the bone, fracture, and acetabular edge was performed using MR images. These 3-D images were used to measure the fractured areas and clarify the positional relationship between the fracture and degree of acetabular coverage. The fractured area in the anterior portion was significantly larger than in the posterior area. In 11 cases, the fractures contacted the acetabular edge and were distributed on the lateral portion. The indices of acetabular coverage (center-edge angle and acetabular head index) in these cases were less than the normal range. In the remaining 22 cases, the fractures were apart from the acetabular edge and distributed on the mediolateral centerline of the femoral head. The majority of these cases had normal acetabular coverage. The common site of SIF is the anterior portion. In addition, two types of SIF are proposed: (1) Lateral type: the contact stress between the acetabular edge and lateral portion of the femoral head causes SIF based on the insufficient acetabular coverage, and (2) Central type: the contact stress between the acetabular surface and the mediolateral center of the femoral head causes SIF independent from the insufficiency of acetabular coverage. These findings may be useful for considering the treatment and prevention of SIF. (orig.)

  10. Structure of human saposin A at lysosomal pH

    International Nuclear Information System (INIS)

    Hill, Chris H.; Read, Randy J.; Deane, Janet E.

    2015-01-01

    A 1.8 Å resolution structure of the sphingolipid activator protein saposin A has been determined at pH 4.8, the physiologically relevant lysosomal pH for hydrolase enzyme activation and lipid-transfer activity. The saposins are essential cofactors for the normal lysosomal degradation of complex glycosphingolipids by acid hydrolase enzymes; defects in either saposin or hydrolase function lead to severe metabolic diseases. Saposin A (SapA) activates the enzyme β-galactocerebrosidase (GALC), which catalyzes the breakdown of β-d-galactocerebroside, the principal lipid component of myelin. SapA is known to bind lipids and detergents in a pH-dependent manner; this is accompanied by a striking transition from a ‘closed’ to an ‘open’ conformation. However, previous structures were determined at non-lysosomal pH. This work describes a 1.8 Å resolution X-ray crystal structure determined at the physiologically relevant lysosomal pH 4.8. In the absence of lipid or detergent at pH 4.8, SapA is observeed to adopt a conformation closely resembling the previously determined ‘closed’ conformation, showing that pH alone is not sufficient for the transition to the ‘open’ conformation. Structural alignments reveal small conformational changes, highlighting regions of flexibility

  11. Structure of human saposin A at lysosomal pH

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Chris H.; Read, Randy J.; Deane, Janet E., E-mail: jed55@cam.ac.uk [University of Cambridge, Wellcome Trust/MRC Building, Cambridge Biomedical Campus, Hills Road, Cambridge CB2 0XY (United Kingdom)

    2015-06-27

    A 1.8 Å resolution structure of the sphingolipid activator protein saposin A has been determined at pH 4.8, the physiologically relevant lysosomal pH for hydrolase enzyme activation and lipid-transfer activity. The saposins are essential cofactors for the normal lysosomal degradation of complex glycosphingolipids by acid hydrolase enzymes; defects in either saposin or hydrolase function lead to severe metabolic diseases. Saposin A (SapA) activates the enzyme β-galactocerebrosidase (GALC), which catalyzes the breakdown of β-d-galactocerebroside, the principal lipid component of myelin. SapA is known to bind lipids and detergents in a pH-dependent manner; this is accompanied by a striking transition from a ‘closed’ to an ‘open’ conformation. However, previous structures were determined at non-lysosomal pH. This work describes a 1.8 Å resolution X-ray crystal structure determined at the physiologically relevant lysosomal pH 4.8. In the absence of lipid or detergent at pH 4.8, SapA is observeed to adopt a conformation closely resembling the previously determined ‘closed’ conformation, showing that pH alone is not sufficient for the transition to the ‘open’ conformation. Structural alignments reveal small conformational changes, highlighting regions of flexibility.

  12. Spaceborne Sun-Induced Vegetation Fluorescence Time Series from 2007 to 2015 Evaluated with Australian Flux Tower Measurements

    Science.gov (United States)

    Sanders, Abram F. J.; Verstraeten, Willem W.; Kooreman, Maurits L.; van Leth, Thomas C.; Beringer, Jason; Joiner, Joanna

    2016-01-01

    A global, monthly averaged time series of Sun-induced Fluorescence (SiF), spanning January 2007 to June 2015, was derived from Metop-A Global Ozone Monitoring Experiment 2 (GOME-2) spectral measurements. Far-red SiF was retrieved using the filling-in of deep solar Fraunhofer lines and atmospheric absorption bands based on the general methodology described by Joiner et al, AMT, 2013. A Principal Component (PC) analysis of spectra over non-vegetated areas was performed to describe the effects of atmospheric absorption. Our implementation (SiF KNMI) is an independent algorithm and differs from the latest implementation of Joiner et al, AMT, 2013 (SiF NASA, v26), because we used desert reference areas for determining PCs (as opposed to cloudy ocean and some desert) and a wider fit window that covers water vapour and oxygen absorption bands (as opposed to only Fraunhofer lines). As a consequence, more PCs were needed (35 as opposed to 12). The two time series (SiF KNMI and SiF NASA, v26) correlate well (overall R of 0.78) except for tropical rain forests. Sensitivity experiments suggest the strong impact of the water vapour absorption band on retrieved SiF values. Furthermore, we evaluated the SiF time series with Gross Primary Productivity (GPP) derived from twelve flux towers in Australia. Correlations for individual towers range from 0.37 to 0.84. They are particularly high for managed biome types. In the de-seasonalized Australian SiF time series, the break of the Millennium Drought during local summer of 2010/2011 is clearly observed.

  13. Red and Far-Red Solar-Induced Chlorophyll Fluorescence Observations in the Tropical Rain Forest of Costa Rica

    Science.gov (United States)

    Stutz, J.; Grossmann, K.; Seibt, U.; Dierick, D.; Magney, T. S.; Frankenberg, C.

    2017-12-01

    Solar-Induced Chlorophyll Fluorescence (SIF) is a powerful proxy for photosynthetic activity. SIF can be measured using remote sensing from the leaf to the global scale. However, the relationship between SIF, photosynthetic efficiencies, Gross Primary Productivity (GPP), and their response to environmental stress conditions remain poorly constrained. The impact of canopy radiative transfer and viewing geometry at the canopy scale also requires further study. In addition, there is an urgent need for the validation of space-borne SIF measurements, especially above the tropical rain forest where ground observations at the canopy scale are sparse. Here we present observations of SIF in the red and far-red wavelength range, as well various vegetation indices (NDVI, PRI, EVI), made by a novel ground-based spectrometer system, PhotoSpec, at La Selva Biological Station, Costa Rica. Measurements began in March 2017 and have continued ever since. PhotoSpec uses a narrow (0.7 degrees) field-of-view for the simultaneous co-aligned observations of all parameters at a time resolution of 30 seconds. The 2D scanning telescope unit of PhotoSpec was used for regular surveys of around 20 tree species, 2D-raster on canopies of individual trees, as well as elevation survey scans. SIF retrievals were performed using the in-filling of Fraunhofer lines, which allows the accurate observation of SIF under sunny as well as frequent cloudy conditions. The seasonal changes of SIF at La Selva, as well as the red / far-red SIF ratio, for different tree species are presented. 2D-raster scans allow an assessment of the representativeness of narrow field-of-view observations. We will also compare the PhotoSpec data with coincident satellite observations.

  14. Recent developments and future directions in the monitoring of terrestrial sun-induced chlorophyll fluorescence from space

    Science.gov (United States)

    Guanter, L.

    2017-12-01

    Sun-induced chlorophyll fluorescence (SIF) is an electromagnetic signal emitted by the chlorophyll-a of assimilating plants in the 650-850 nm spectral range. The SIF emission has a mechanistic link to photosynthesis and responds instantaneously to perturbations in environmental conditions such as light and water stress, which makes it a powerful proxy for plants' photosynthetic activity. Global measurements of SIF from space have been available since late 2011 from four different atmospheric satellite missions (chronologically, GOSAT, SCIAMACHY, GOME-2 and OCO-2). The potential of the derived SIF data sets to represent the photosynthetic activity of different ecosystems, including large crop belts worldwide, the Amazon rainforest and boreal evergreen forests has been demonstrated in the relatively short life-time of global SIF data. Despite the demonstrated potential of SIF data as a proxy for global terrestrial gross primary production, current observations are partly hampered by a coarse spatial resolution or the lack of spatial coverage. For this reason, great expectations are put on the upcoming TROPOMI instrument onboard the Copernicus' Sentinel 5-Precursor mission to be launched by mid-end of 2017. TROPOMI will provide daily global coverage with a spatial resolution between 3 and 7 km and continuous spectral coverage of the visible and near-infrared part of the spectrum. The recent selection of FLEX as the ESA Earth Explorer 8 to be launched around 2022 and several upcoming geostationary missions (TEMPO, Sentinel-4 and GeoCARB, covering Europe and the Americas) with potential for SIF retrievals complete an exciting near-future scenario for the monitoring of SIF from space. In this contribution, we will provide an overview of recent developments in the global monitoring of SIF and will introduce the near-future observational scenario with especial emphasis on TROPOMI and the geostationary missions to be launched in the coming years.

  15. Solar-induced chlorophyll fluorescence tracks the trend of canopy stomatal conductance and transpiration at diurnal and seasonal scales

    Science.gov (United States)

    Zhang, Y.; Shan, N.; Ju, W.; Chen, J.

    2017-12-01

    Transpiration is the process of plant water loss through the stomata on the leaf surface and plays a key role in the energy and water balance of the land surface. Plant stomata function as a control interface for regulating photosynthetic uptake of CO2 and transpiration, strongly linked to plant productivity. Stomatal conductance is fundamental to larger-scale regional prediction of carbon-water cycles and their feedbacks to climate. The widely used Ball-Berry model coupled photosynthesis to a semi-empirical model of stomatal conductance. However large uncertainties remain in simulation of carbon assimilation rate in ecosystem and regional scales. The strong correlations of solar-induced fluorescence (SIF) and GPP have been demonstrated and provides an important opportunity to accurately monitor photosynthetic activity and water exchange. In this presentation, we compared both canopy-observed SIF and satellite-derived SIF with tower-based canopy stomatal conductance from hourly to 8-day scales in forest and cropland ecosystem. Using the model of stomatal conductance based on SIF, the transpiration was estimated at hourly and daily scales and compared with flux tower measurements. The results showed that the seasonal pattern of canopy stomatal conductance agreed better with SIF compared to NDVI and their relationship was higher during sunny days for forest ecosystem. Canopy stomatal conductance correlated with both tower-observed SIF and SIF from the Global Ozone Monitoring Experiment-2. Estimation of transpiration from SIF performed well in both forest and cropland ecosystem. This remotely sensed approaches from SIF for modelling stomatal conductance opens a new era to analysis and simulation of coupled carbon and water cycles under climate change.

  16. BOREAS Elevation Contours over the NSA and SSA in ARC/INFO Generate Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set was prepared by BORIS Staff by reformatting the original data into the ARC/INFO Generate format. The original data were received in SIF at a scale of 1:50,000. BORIS staff could not find a format document or commercial software for reading SIF; the BOREAS HYD-08 team pro-vided some C source code that could read some of the SIF files. The data cover the BOREAS NSA and SSA. The original data were compiled from information available in the 1970s and 1980s. The data are available in ARC/INFO Generate format files.

  17. Genetic conservation and utilization of foxtail millet (Setaria italica (L.) Beauv. for nutritious food production: a case of sustainable agriculture responding to climate change in the mountainous region in Vietnam

    International Nuclear Information System (INIS)

    Pham Van Cuong; Hoang Viet Cuong; Nguyen Duc Doan; Duong Thi Thu Hang; Nguyen Thi Thanh Thuy; Cao Huong Giang

    2009-01-01

    Foxtail millet a plant with high nutrient and high heavy metal content in the grain, is suitable to grow under drought conditions. Using millet grain to produce food for man is necessary and will bring higher economic impacts for farmers in the mountainous regions. In this study, a total of four varieties of foxtail millet (CM1, CM9, CM10 and CM11), collected in Vietnam, are described and their botanical characters characterized. Correlations were made between photosynthetic characters and dry matter accumulation under irrigated, drought and recovering conditions in a pot experiment. A field experiment was also conducted to estimate the effect of three ecological regions such as Gialam (Red River Delta with an altitude of 5-20 meters), Bacha (northern mountainous region with an altitude of 800-1000 meters) and Sapa (northern mountainous region with an altitude of 1500-1800 meters) on several agronomic characters viz., growth duration, dry matter accumulation, grain yield and grain quality of four cultivars. The average grain yield of all millet varieties were the highest in Sapa (2.7 ton/ha), followed by Bacha (2.0 ton/ha) and Gialam (1.1 ton/ha), mainly because of the large number spikelets per panicle and the higher 1000-grain weight. The highest grain yield was observed for CM1 in Gialam, whereas it was CM9 in Bacha and Sapa. This was due to the different varietal response to temperature, water supply and/or radiation. Protein content was highest for CM1 in Hanoi (14.44%) and Sapa (12.66%) but it was CM11 in Bacha (11.69%). CM11 showed the highest starch content in all three ecological regions. In Hanoi and Sapa, CM9 manifested the highest lipid content but in Bacha, it was CM10. Four levels of N fertilizer (0, 30, 45 and 60 kg N per ha) were applied in Gialam, resulting in highest grain yield for CM1 at 60 kg N level (2.78 ton per ha), but the highest for CM10 was at 45 kg N level (3.02 ton per ha). This was due to the higher chlorophyll content at the

  18. Acknowledgements

    Science.gov (United States)

    2016-07-01

    The Meeting was sponsored by the Istituto Nazionale di Fisica Nucleare (INFN), the Società Italiana di Fisica (SIF), the European Physics Society (EPS), the University of Pisa and the University of Siena.

  19. Canopy Level Chlorophyll Fluorescence and the PRI in a Cornfield

    Science.gov (United States)

    Middleton, Elizabeth M.; Cheng, Yen-Ben; Corp, Lawrence A.; Campbell, Petya K. E.; Huemmrich, K. Fred; Zhang, Qingyuan; Kustas, William P.

    2012-01-01

    Two bio-indicators, the Photochemical Reflectance Index (PRI) and solar-induced red and far-red Chlorophyll Fluorescence (SIF), were derived from directional hyperspectral observations and studied in a cornfield on two contrasting days in the growing season. Both red and far-red SIF exhibited higher values on the day when the canopy in the early senescent stage, but only the far-red SIF showed sensitivity to viewing geometry. Consequently, the red/far-red SIF ratio varied greatly among azimuth positions while the largest values were obtained for the "hotspot" at both growth stages. This ratio was lower (approx.0.88 +/- 0.4) in early July than in August when the ratio approached equivalence (near approx.1). In concert, the PRI exhibited stronger responses to both zenith and azimuth angles and different values on the two growth stages. The potential of using these indices to monitor photosynthetic activities needs further investigation

  20. Determination of Fracture Parameters for Multiple Cracks of Laminated Composite Finite Plate

    Science.gov (United States)

    Srivastava, Amit Kumar; Arora, P. K.; Srivastava, Sharad Chandra; Kumar, Harish; Lohumi, M. K.

    2018-04-01

    A predictive method for estimation of stress state at zone of crack tip and assessment of remaining component lifetime depend on the stress intensity factor (SIF). This paper discusses the numerical approach for prediction of first ply failure load (FL), progressive failure load, SIF and critical SIF for multiple cracks configurations of laminated composite finite plate using finite element method (FEM). The Hashin and Chang failure criterion are incorporated in ABAQUS using subroutine approach user defined field variables (USDFLD) for prediction of progressive fracture response of laminated composite finite plate, which is not directly available in the software. A tensile experiment on laminated composite finite plate with stress concentration is performed to validate the numerically predicted subroutine results, shows excellent agreement. The typical results are presented to examine effect of changing the crack tip distance (S), crack offset distance (H), and stacking fiber angle (θ) on FL, and SIF .

  1. Atmospheric CO2 Observations Reveal Strong Correlation Between Regional Net Biospheric Carbon Uptake and Solar-Induced Chlorophyll Fluorescence

    Science.gov (United States)

    Shiga, Yoichi P.; Tadić, Jovan M.; Qiu, Xuemei; Yadav, Vineet; Andrews, Arlyn E.; Berry, Joseph A.; Michalak, Anna M.

    2018-01-01

    Recent studies have shown the promise of remotely sensed solar-induced chlorophyll fluorescence (SIF) in informing terrestrial carbon exchange, but analyses have been limited to either plot level ( 1 km2) or hemispheric/global ( 108 km2) scales due to the lack of a direct measure of carbon exchange at intermediate scales. Here we use a network of atmospheric CO2 observations over North America to explore the value of SIF for informing net ecosystem exchange (NEE) at regional scales. We find that SIF explains space-time NEE patterns at regional ( 100 km2) scales better than a variety of other vegetation and climate indicators. We further show that incorporating SIF into an atmospheric inversion leads to a spatial redistribution of NEE estimates over North America, with more uptake attributed to agricultural regions and less to needleleaf forests. Our results highlight the synergy of ground-based and spaceborne carbon cycle observations.

  2. PhotoSpec - Ground-based Remote Sensing of Solar-Induced Chlorophyll Fluorescence: First Results

    Science.gov (United States)

    Grossmann, K.; Magney, T. S.; Frankenberg, C.; Seibt, U.; Pivovaroff, A. L.; Hurlock, S. C.; Stutz, J.

    2016-12-01

    Solar-Induced Chlorophyll Fluorescence (SIF) emitted from vegetation can be used as a proxy for photosynthetic activity and is observable on a global scale from space. However, many issues on a leaf-to-canopy scale remain poorly understood, such as influences on the SIF signal from environmental conditions, water stress, or radiation. We have developed a novel ground-based spectrometer system for measuring SIF from natural ecosystems. The instrumental set-up, requirements, and measurement technique are based on decades of experience using Differential Optical Absorption Spectroscopy (DOAS), an established method to measure atmospheric trace gases. The instrument consists of three thermally stabilized commercial spectrometers that are linked to a 2D scanning telescope unit via optical fiber bundles, and also includes a commercial photosynthetic active radiation (PAR) sensor. The spectrometers cover a SIF retrieval wavelength range at high spectral resolution (670 - 780 nm, 0.1 nm FWHM), and also provide moderate resolution spectra (400 - 800 nm, 1.5 nm FWHM) to retrieve vegetation indices and the photochemical reflectance index (PRI). We report on results of the first continuous field measurements of this novel system at Stunt Ranch Santa Monica Mountains UC Reserve, where the PhotoSpec instrument was monitoring SIF of four native Californian shrubland species with different adaptations to seasonal summer drought. We report on the correlation with CO2 fluxes over both the growing season and the hot summer period in 2016. We also show detailed measurements of the diurnal cycle of the SIF signal of single broad leaves, as well as dark-light transitions, under controlled experimental conditions. In addition to demonstrating the instrumental set-up, retrieval algorithm, and instrument performance, our results illustrate that SIF measurements at the leaf to ecosystem scale are needed to understand and interpret the SIF signals retrieved at larger scales.

  3. Subchondral Insufficiency Fracture of the Femoral Head in a Pregnant Woman with Pre-existing Anorexia Nervosa.

    Science.gov (United States)

    Kasahara, Kyoko; Mimura, Tomohiro; Moritani, Suzuko; Kawasaki, Taku; Imai, Shinji; Tsuji, Shunichiro; Kimura, Fuminori; Murakami, Takashi

    2018-05-01

    Subchondral insufficiency fracture (SIF) is a fragility fracture secondary to osteoporosis that leads to collapse of the femoral head with no evidence of osteonecrosis. SIF of the femoral head has been reported in adults of varying ages and both sexes, but it has never been reported to occur in pregnant women. Herein, we describe a 40-year-old primiparous patient with pre-existing anorexia nervosa who developed SIF of the femoral head in the third trimester. At 29 weeks of gestation, the patient complained of sudden pain on walking in both hips. Despite the bed rest, her hip pain increased; consequently, cesarean section was performed at 36 weeks. After delivery, plain radiographs showed that the left femoral head was collapsed. Dual-energy X-ray absorptiometry indicated that the patient was osteoporotic. The magnetic resonance imaging (MRI) of her hips showed the findings that were compatible with SIF. Her left hip pain worsened during follow-up, and a radiograph showed progressive collapse of the left femoral head. The patient then underwent left bipolar hip arthroplasty 18 months after delivery, and she was diagnosed with SIF histopathologically. This is the first report of SIF in a pregnant woman that may reflect pregnancy-associated osteoporosis. SIF in pregnancy might be overlooked or misdiagnosed because the MRI findings have several overlaps with those of other hip disorders. Precise diagnosis of SIF in pregnancy may contribute to a better outcome by avoiding early arthroplasty in young women and appropriate evaluation of the osteopenic status of the patient.

  4. Application of Satellite Solar-Induced Chlorophyll Fluorescence to Understanding Large-Scale Variations in Vegetation Phenology and Function Over Northern High Latitude Forests

    Science.gov (United States)

    Jeong, Su-Jong; Schimel, David; Frankenberg, Christian; Drewry, Darren T.; Fisher, Joshua B.; Verma, Manish; Berry, Joseph A.; Lee, Jung-Eun; Joiner, Joanna

    2016-01-01

    This study evaluates the large-scale seasonal phenology and physiology of vegetation over northern high latitude forests (40 deg - 55 deg N) during spring and fall by using remote sensing of solar-induced chlorophyll fluorescence (SIF), normalized difference vegetation index (NDVI) and observation-based estimate of gross primary productivity (GPP) from 2009 to 2011. Based on GPP phenology estimation in GPP, the growing season determined by SIF time-series is shorter in length than the growing season length determined solely using NDVI. This is mainly due to the extended period of high NDVI values, as compared to SIF, by about 46 days (+/-11 days), indicating a large-scale seasonal decoupling of physiological activity and changes in greenness in the fall. In addition to phenological timing, mean seasonal NDVI and SIF have different responses to temperature changes throughout the growing season. We observed that both NDVI and SIF linearly increased with temperature increases throughout the spring. However, in the fall, although NDVI linearly responded to temperature increases, SIF and GPP did not linearly increase with temperature increases, implying a seasonal hysteresis of SIF and GPP in response to temperature changes across boreal ecosystems throughout their growing season. Seasonal hysteresis of vegetation at large-scales is consistent with the known phenomena that light limits boreal forest ecosystem productivity in the fall. Our results suggest that continuing measurements from satellite remote sensing of both SIF and NDVI can help to understand the differences between, and information carried by, seasonal variations vegetation structure and greenness and physiology at large-scales across the critical boreal regions.

  5. Energy in Italy: Problems and perspectives (1990-2020)

    International Nuclear Information System (INIS)

    Bassani, G.F.; Bianucci, M.; Carra, S.; Cifarelli, L.

    2009-01-01

    Given the importance and up-to-dateness of the subject, the Italian Physical Society-SIF has decided to reprint its White Book, Energy in Italy: problems and perspectives (1990-2020), as a special issue of Il Nuovo Cimento B. This issue is in honour of the late SIF President Giuseppe Franco Bassani, to recall his leading role in establishing a very active and authoritative Sif Energy Commission, bringing together a number of distinguished experts in the various fields. The Sif Energy Commission was able to produce this White Book, as a comprehensive study on the subject, in just one year time. It was successfully presented at the international meeting on Energy perspectives in Europe, jointly organized by the European Physical Society (Eps) and Sif. The meeting was held in Varenna, Italy, on 7-8 April 2008: it was the second of a series that eventually led to the creation in 2010 of a dedicated Eps Energy Group, budded from the existing Eps Technology Group. First printed in Italian, the White Book was than translated into English and widely circulated within the Eps. It can be downloaded in open access from the SIF web site (http://www.sif.it). In its present updated version, it is made available to the readers of Il Nuovo Cimento B. Last but not least, the White Book has inspired the so-called Energy at School set of booklets targeting Italian high-school teachers and pupils, that will shortly appear as addenda to the Sif journal Giornale di Fisica and will be freely distributed both in paper and electronic versions.

  6. Estimating Diurnal Courses of Gross Primary Production for Maize: A Comparison of Sun-Induced Chlorophyll Fluorescence, Light-Use Efficiency and Process-Based Models

    Directory of Open Access Journals (Sweden)

    Tianxiang Cui

    2017-12-01

    Full Text Available Accurately quantifying gross primary production (GPP is of vital importance to understanding the global carbon cycle. Light-use efficiency (LUE models and process-based models have been widely used to estimate GPP at different spatial and temporal scales. However, large uncertainties remain in quantifying GPP, especially for croplands. Recently, remote measurements of solar-induced chlorophyll fluorescence (SIF have provided a new perspective to assess actual levels of plant photosynthesis. In the presented study, we evaluated the performance of three approaches, including the LUE-based multi-source data synergized quantitative (MuSyQ GPP algorithm, the process-based boreal ecosystem productivity simulator (BEPS model, and the SIF-based statistical model, in estimating the diurnal courses of GPP at a maize site in Zhangye, China. A field campaign was conducted to acquire synchronous far-red SIF (SIF760 observations and flux tower-based GPP measurements. Our results showed that both SIF760 and GPP were linearly correlated with APAR, and the SIF760-GPP relationship was adequately characterized using a linear function. The evaluation of the modeled GPP against the GPP measured from the tower demonstrated that all three approaches provided reasonable estimates, with R2 values of 0.702, 0.867, and 0.667 and RMSE values of 0.247, 0.153, and 0.236 mg m−2 s−1 for the MuSyQ-GPP, BEPS and SIF models, respectively. This study indicated that the BEPS model simulated the GPP best due to its efficiency in describing the underlying physiological processes of sunlit and shaded leaves. The MuSyQ-GPP model was limited by its simplification of some critical ecological processes and its weakness in characterizing the contribution of shaded leaves. The SIF760-based model demonstrated a relatively limited accuracy but showed its potential in modeling GPP without dependency on climate inputs in short-term studies.

  7. Global and Time-Resolved Monitoring of Crop Photosynthesis with Chlorophyll Fluorescence

    Science.gov (United States)

    Guanter, Luis; Zhang, Yongguang; Jung, Martin; Joiner, Joanna; Voigt, Maximilian; Berry, Joseph A.; Frankenberg, Christian; Huete, Alfredo R.; Zarco-Tejada, Pablo; Lee, Jung-Eun; hide

    2014-01-01

    Photosynthesis is the process by which plants harvest sunlight to produce sugars from carbon dioxide and water. It is the primary source of energy for all life on Earth; hence it is important to understand how this process responds to climate change and human impact. However, model-based estimates of gross primary production (GPP, output from photosynthesis) are highly uncertain, in particular over heavily managed agricultural areas. Recent advances in spectroscopy enable the space-based monitoring of sun-induced chlorophyll fluorescence (SIF) from terrestrial plants. Here we demonstrate that spaceborne SIF retrievals provide a direct measure of the GPP of cropland and grassland ecosystems. Such a strong link with crop photosynthesis is not evident for traditional remotely sensed vegetation indices, nor for more complex carbon cycle models. We use SIF observations to provide a global perspective on agricultural productivity. Our SIF-based crop GPP estimates are 50-75% higher than results from state-of-the-art carbon cycle models over, for example, the US Corn Belt and the Indo-Gangetic Plain, implying that current models severely underestimate the role of management. Our results indicate that SIF data can help us improve our global models for more accurate projections of agricultural productivity and climate impact on crop yields. Extension of our approach to other ecosystems, along with increased observational capabilities for SIF in the near future, holds the prospect of reducing uncertainties in the modeling of the current and future carbon cycle.

  8. Metabolomic changes in follicular fluid induced by soy isoflavones administered to rats from weaning until sexual maturity

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Wenxiang [Department of Nutrition and Health Care, School of Public Health, Fujian Medical University, Fuzhou, Fujian (China); Zhang, Wenchang, E-mail: wenchang2002@sina.com [Department of Occupational and Environmental Health, School of Public Health, Fujian Medical University, Fuzhou, Fujian (China); Liu, Jin [Department of Occupational and Environmental Health, School of Public Health, Fujian Medical University, Fuzhou, Fujian (China); Sun, Yan [Center for Reproductive Medicine, Teaching Hospital of Fujian Medical University, Fujian Maternity and Child Health Hospital, Fuzhou, Fujian (China); Li, Yuchen; Li, Hong; Xiao, Shihua; Shen, Xiaohua [Department of Occupational and Environmental Health, School of Public Health, Fujian Medical University, Fuzhou, Fujian (China)

    2013-06-15

    Female Wistar rats at 21 days of age were treated with one of three concentrations of soy isoflavones (SIF) (50, 100 or 200 mg/kg body weight, orally, once per day) from weaning until sexual maturity (3 months) in order to evaluate the influence of SIF on ovarian follicle development. After treatment, the serum sex hormone levels and enumeration of ovarian follicles of the ovary were measured. The metabolic profile of follicular fluid was determined using HPLC-MS. Principal component analysis (PCA) and partial least-squares-discriminant analysis (PLS-DA) was used to identify differences in metabolites and reveal useful toxic biomarkers. The results indicated that modest doses of SIF affect ovarian follicle development, as demonstrated by decreased serum estradiol levels and increases in both ovarian follicle atresia and corpora lutea number in the ovary. SIF treatment-related metabolic alterations in follicular fluid were also found in the PCA and PLS-DA models. The 24 most significantly altered metabolites were identified, including primary sex hormones, amino acids, fatty acids and metabolites involved in energy metabolism. These findings may indicate that soy isoflavones affect ovarian follicle development by inducing metabolomic variations in the follicular fluid. - Highlights: ► Modest doses of soy isoflavones (SIF) do affect ovarian follicle development. ► SIF treatment-related metabolic alterations in follicular fluid were found. ► The 24 most significantly altered metabolites were identified.

  9. Metabolomic changes in follicular fluid induced by soy isoflavones administered to rats from weaning until sexual maturity

    International Nuclear Information System (INIS)

    Wang, Wenxiang; Zhang, Wenchang; Liu, Jin; Sun, Yan; Li, Yuchen; Li, Hong; Xiao, Shihua; Shen, Xiaohua

    2013-01-01

    Female Wistar rats at 21 days of age were treated with one of three concentrations of soy isoflavones (SIF) (50, 100 or 200 mg/kg body weight, orally, once per day) from weaning until sexual maturity (3 months) in order to evaluate the influence of SIF on ovarian follicle development. After treatment, the serum sex hormone levels and enumeration of ovarian follicles of the ovary were measured. The metabolic profile of follicular fluid was determined using HPLC-MS. Principal component analysis (PCA) and partial least-squares-discriminant analysis (PLS-DA) was used to identify differences in metabolites and reveal useful toxic biomarkers. The results indicated that modest doses of SIF affect ovarian follicle development, as demonstrated by decreased serum estradiol levels and increases in both ovarian follicle atresia and corpora lutea number in the ovary. SIF treatment-related metabolic alterations in follicular fluid were also found in the PCA and PLS-DA models. The 24 most significantly altered metabolites were identified, including primary sex hormones, amino acids, fatty acids and metabolites involved in energy metabolism. These findings may indicate that soy isoflavones affect ovarian follicle development by inducing metabolomic variations in the follicular fluid. - Highlights: ► Modest doses of soy isoflavones (SIF) do affect ovarian follicle development. ► SIF treatment-related metabolic alterations in follicular fluid were found. ► The 24 most significantly altered metabolites were identified

  10. Topical corticosteroids in the treatment of acute sunburn: a randomized, double-blind clinical trial.

    Science.gov (United States)

    Faurschou, Annesofie; Wulf, Hans C

    2008-05-01

    To examine the effect of topical corticosteroid treatment on acute sunburn. Randomized, double-blind clinical trial. University dermatology department. Twenty healthy volunteers with Fitzpatrick skin types I (highly sensitive, always burns easily, tans minimally) through III (sun-sensitive skin, sometimes burns, slowly tans to light brown). Seven 34-cm(2) areas were marked on the upper aspect of the back of each participant. An untreated area was tested to determine UV sensitivity. Two areas were treated with excess amounts (2 mg/cm(2)) of either a moderate-potency corticosteroid or a high-potency corticosteroid 30 minutes before UV-B exposure as controls. Six or 23 hours after exposure to radiation, the remaining areas were treated with the 2 corticosteroid preparations. The sunburn improvement factor (SIF) was determined by the following equation: SIF = MED (minimal erythema dose) on treated skin/MED on nontreated skin. An SIF greater than 1 indicated an effect of topical corticosteroids in sunburn relief. The SIFs in the areas treated with either topical corticosteroid 30 minutes before UV-B exposure or high-potency corticosteroid 6 hours after UV-B exposure were significantly different from SIFs in areas that received no treatment (SIF 1.1-1.7; P sunburn reaction when applied 6 or 23 hours after UV exposure.

  11. Decreased Lumbar Lordosis and Deficient Acetabular Coverage Are Risk Factors for Subchondral Insufficiency Fracture.

    Science.gov (United States)

    Jo, Woo Lam; Lee, Woo Suk; Chae, Dong Sik; Yang, Ick Hwan; Lee, Kyoung Min; Koo, Kyung Hoi

    2016-10-01

    Subchondral insufficiency fracture (SIF) of the femoral head occurs in the elderly and recipients of organ transplantation. Osteoporosis and deficient lateral coverage of the acetabulum are known risk factors for SIF. There has been no study about relation between spinopelvic alignment and anterior acetabular coverage with SIF. We therefore asked whether a decrease of lumbar lordosis and a deficiency in the anterior acetabular coverage are risk factors. We investigated 37 patients with SIF. There were 33 women and 4 men, and their mean age was 71.5 years (59-85 years). These 37 patients were matched with 37 controls for gender, age, height, weight, body mass index and bone mineral density. We compared the lumbar lordosis, pelvic incidence, pelvic tilt, sacral slope, acetabular index, acetabular roof angle, acetabular head index, anterior center-edge angle and lateral center-edge angle. Lumbar lordosis, pelvic tilt, sacral slope, lateral center edge angle, anterior center edge angle, acetabular index and acetabular head index were significantly different between SIF group and control group. Lumbar lordosis (OR = 1.11), lateral center edge angle (OR = 1.30) and anterior center edge angle (OR = 1.27) had significant associations in multivariate analysis. Decreased lumbar lordosis and deficient anterior coverage of the acetabulum are risk factors for SIF as well as decreased lateral coverage of the acetabulum.

  12. Serendipity: Global Detection and Quantification of Plant Stress

    Science.gov (United States)

    Schimel, D.; Verma, M.; Drewry, D.

    2016-12-01

    Detecting and quantifying plant stress is a grand challenge for remote sensing, and is important for understanding climate impacts on ecosystems broadly and also for early warning systems supporting food security. The long record from moderate resolution sensors providing frequent data has allowed using phenology to detect stress in forest and agroecosystems, but can fail or give ambiguous results when stress occurs during later phases of growth and in high leaf area systems. The recent recognition that greenhouse gas satellites such as GOSAT and OCO-2 observe Solar-Induced Fluorescence has added a new and complementary tool for the quantification of stress but algorithms to detect and quantify stress using SIF are in their infancy. Here we report new results showing a more complex response of SIF to stress by evaluating spaceborne SIF against in situ eddy covariance data. The response observed is as predicted by theory, and shows that SIF, used in conjunction with moderate resolution remote sensing, can detect and likely quantify stress by indexing the nonlinear part of the SIF-GPP relationship using the photochemical reflectance index and remotely observed light absorption. There are several exciting opportunities on the near horizon for the implementation of SIF, together with syngeristic measurements such as PRI and evapotranspiration that suggest the next few years will be a golden age for global ecology. Adancing the science and associated algorithms now is essential to fully exploiting the next wave of missions.

  13. Improving the Monitoring of Crop Productivity Using Spaceborne Solar-Induced Fluorescence

    Science.gov (United States)

    Guan, Kaiyu; Berry, Joseph A.; Zhang, Yongguang; Joiner, Joanna; Guanter, Luis; Badgley, Grayson; Lobell, David B.

    2015-01-01

    Large-scale monitoring of crop growth and yield has important value for forecasting food production and prices and ensuring regional food security. A newly emerging satellite retrieval, solar-induced fluorescence (SIF) of chlorophyll, provides for the first time a direct measurement related to plant photosynthetic activity (i.e. electron transport rate). Here, we provide a framework to link SIF retrievals and crop yield, accounting for stoichiometry, photosynthetic pathways, and respiration losses. We apply this framework to estimate United States crop productivity for 2007-2012, where we use the spaceborne SIF retrievals from the Global Ozone Monitoring Experiment-2 satellite, benchmarked with county-level crop yield statistics, and compare it with various traditional crop monitoring approaches. We find that a SIF-based approach accounting for photosynthetic pathways (i.e. C3 and C4 crops) provides the best measure of crop productivity among these approaches, despite the fact that SIF sensors are not yet optimized for terrestrial applications. We further show that SIF provides the ability to infer the impacts of environmental stresses on autotrophic respiration and carbon-use-efficiency, with a substantial sensitivity of both to high temperatures. These results indicate new opportunities for improved mechanistic understanding of crop yield responses to climate variability and change.

  14. Higher absorbed solar radiation partly offset the negative effects of water stress on the photosynthesis of Amazon forests during the 2015 drought

    Science.gov (United States)

    Li, Xing; Xiao, Jingfeng; He, Binbin

    2018-04-01

    Amazon forests play an important role in the global carbon cycle and Earth’s climate. The vulnerability of Amazon forests to drought remains highly controversial. Here we examine the impacts of the 2015 drought on the photosynthesis of Amazon forests to understand how solar radiation and precipitation jointly control forest photosynthesis during the severe drought. We use a variety of gridded vegetation and climate datasets, including solar-induced chlorophyll fluorescence (SIF), photosynthetic active radiation (PAR), the fraction of absorbed PAR (APAR), leaf area index (LAI), precipitation, soil moisture, cloud cover, and vapor pressure deficit (VPD) in our analysis. Satellite-derived SIF observations provide a direct diagnosis of plant photosynthesis from space. The decomposition of SIF to SIF yield (SIFyield) and APAR (the product of PAR and fPAR) reveals the relative effects of precipitation and solar radiation on photosynthesis. We found that the drought significantly reduced SIFyield, the emitted SIF per photon absorbed. The higher APAR resulting from lower cloud cover and higher LAI partly offset the negative effects of water stress on the photosynthesis of Amazon forests, leading to a smaller reduction in SIF than in SIFyield and precipitation. We further found that SIFyield anomalies were more sensitive to precipitation and VPD anomalies in the southern regions of the Amazon than in the central and northern regions. Our findings shed light on the relative and combined effects of precipitation and solar radiation on photosynthesis, and can improve our understanding of the responses of Amazon forests to drought.

  15. Reorganization of the Endosomal System in Salmonella-Infected Cells: The Ultrastructure of Salmonella-Induced Tubular Compartments

    Science.gov (United States)

    Krieger, Viktoria; Liebl, David; Zhang, Yuying; Rajashekar, Roopa; Chlanda, Petr; Giesker, Katrin; Chikkaballi, Deepak; Hensel, Michael

    2014-01-01

    During the intracellular life of Salmonella enterica, a unique membrane-bound compartment termed Salmonella-containing vacuole, or SCV, is formed. By means of translocated effector proteins, intracellular Salmonella also induce the formation of extensive, highly dynamic membrane tubules termed Salmonella-induced filaments or SIF. Here we report the first detailed ultrastructural analyses of the SCV and SIF by electron microscopy (EM), EM tomography and live cell correlative light and electron microscopy (CLEM). We found that a subset of SIF is composed of double membranes that enclose portions of host cell cytosol and cytoskeletal filaments within its inner lumen. Despite some morphological similarities, we found that the formation of SIF double membranes is independent from autophagy and requires the function of the effector proteins SseF and SseG. The lumen of SIF network is accessible to various types of endocytosed material and our CLEM analysis of double membrane SIF demonstrated that fluid phase markers accumulate only between the inner and outer membrane of these structures, a space continual with endosomal lumen. Our work reveals how manipulation of the endosomal membrane system by an intracellular pathogen results in a unique tubular membrane compartmentalization of the host cell, generating a shielded niche permissive for intracellular proliferation of Salmonella. PMID:25254663

  16. Willingness to use a supervised injection facility among young adults who use prescription opioids non-medically: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Benjamin A. Bouvier

    2017-02-01

    Full Text Available Abstract Background Supervised injection facilities (SIFs are legally sanctioned environments for people to inject drugs under medical supervision. SIFs currently operate in ten countries, but to date, no SIF has been opened in the USA. In light of increasing overdose mortality in the USA, this study evaluated willingness to use a SIF among youth who report non-medical prescription opioid (NMPO use. Methods Between January 2015 and February 2016, youth with recent NMPO use were recruited to participate in the Rhode Island Young Adult Prescription Drug Study (RAPiDS. We explored factors associated with willingness to use a SIF among participants who had injected drugs or were at risk of initiating injection drug use (defined as having a sex partner who injects drugs or having a close friend who injects. Results Among 54 eligible participants, the median age was 26 (IQR = 24–28, 70.4% were male, and 74.1% were white. Among all participants, when asked if they would use a SIF, 63.0% answered “Yes”, 31.5% answered “No”, and 5.6% were unsure. Among the 31 participants reporting injection drug use in the last six months, 27 (87.1% reported willingness to use a SIF; 15 of the 19 (78.9% who injected less than daily reported willingness, while all 12 (100.0% of the participants who injected daily reported willingness. Compared to participants who were unwilling or were unsure, participants willing to use a SIF were also more likely to have been homeless in the last six months, have accidentally overdosed, have used heroin, have used fentanyl non-medically, and typically use prescription opioids alone. Conclusions Among young adults who use prescription opioids non-medically and inject drugs or are at risk of initiating injection drug use, more than six in ten reported willingness to use a SIF. Established risk factors for overdose, including homelessness, history of overdose, daily injection drug use, heroin use, and fentanyl misuse, were

  17. Overview of Global Monitoring of Terrestrial Chlorophyll Fluorescence from Space

    Science.gov (United States)

    Guanter, Luis; Zhang, Yongguang; Kohler, Philipp; Walther, Sophia; Frankenberg, Christian; Joiner, Joanna

    2016-01-01

    Despite the critical importance of photosynthesis for the Earth system, understanding how it is influenced by factors such as climate variability, disturbance history, and water or nutrient availability remains a challenge because of the complex interactions and the lack of GPP measurements at various temporal and spatial scales. Space observations of the sun-induced chlorophyll fluorescence (SIF) electromagnetic signal emitted by plants in the 650-850nm spectral range hold the promise of providing a new view of vegetation photosynthesis on a global basis. Global retrievals of SIF from space have recently been achieved from a number of spaceborne spectrometers originally intended for atmospheric research. Despite not having been designed for land applications, such instruments have turned out to provide the necessary spectral and radiometric sensitivity for SIF retrieval from space. The first global measurements of SIF were achieved in 2011 from spectra acquired by the Japanese GOSAT mission launched in 2009. The retrieval takes advantage of the high spectral resolution provided by GOSATs Fourier Transform Spectrometer (FTS) which allows the evaluation of the in-filling of solar Fraunhofer lines by SIF. Unfortunately, GOSAT only provides a sparse spatial sampling with individual soundings separated by several hundred kilometers. Complementary, the Global Ozone Monitoring Experiment-2 (GOME-2) instruments onboard MetOp-A and MetOp-B enable SIF retrievals since 2007 with a continuous and global spatial coverage. GOME-2 measures in the red and near-infrared (NIR) spectral regions with a spectral resolution of 0.5 nm and a pixel size of up to 40x40 km2. Most recently, another global and spatially continuous data set of SIF retrievals at 740 nm spanning the 2003-2012 time frame has been produced from ENVISATSCIAMACHY. This observational scenario has been completed by the first fluorescence data from the NASA-JPL OCO-2 mission (launched in July 2014) and the upcoming

  18. OCO-2 chlorophyll fluorescence tracks late-summer photosynthesis decrease due to water stress at Missouri Ozark site

    Science.gov (United States)

    He, L.; Frankenberg, C.; Wood, J. D.; Sun, Y.

    2017-12-01

    Accurate estimate of the photosynthetic uptake of CO2, denoted gross primary productivity (GPP), is important to understand and quantify the carbon cycles at regional to global scales, and has implications in crop and forest management. Solar-induced chlorophyll fluorescence (SIF) retrieved from space was found to be strongly correlated with GPP and is now being used as a potential new technique to estimate photosynthetic rates at large scale. We selected the Missouri Ozark Site as a test bed, a well-characterized Eddy Covariance site in deciduous broadleaf forests, to explore the relationships of vegetation indices (VIs) and SIF with GPP and their response to environmental conditions. We find that both GPP fluxes and OCO-2 SIF decreased in late summer at the Ozark Site, directly related to water stress, evidenced by a progressive decrease in soil moisture and concomitant changer in leaf water potential. However, VIs (both NDVI and EVI) stayed stable during the same period. With a focus on this wet-dry transition period, we analyze driving factors of changes in GPP and SIF, which appear to be linearly related even in this period with little reflectance changes. We also used the Soil Canopy Observation, Photochemistry and Energy fluxes (SCOPE) model to compare observations of SIF and GPP against measurement. The primary motivation is not only to quantify the expected correlations between the GPP and SIF but also to validate performance of SCOPE in reproducing such correlations, which have not been tested against independent observations. This study clearly underlines the potential of SIF measurements to study moderate water stress and its impact on photosynthesis.

  19. A cost-benefit/cost-effectiveness analysis of proposed supervised injection facilities in Ottawa, Canada.

    Science.gov (United States)

    Jozaghi, Ehsan; Reid, Andrew A; Andresen, Martin A; Juneau, Alexandre

    2014-08-04

    Supervised injection facilities (SIFs) are venues where people who inject drugs (PWID) have access to a clean and medically supervised environment in which they can safely inject their own illicit drugs. There is currently only one legal SIF in North America: Insite in Vancouver, British Columbia, Canada. The responses and feedback generated by the evaluations of Insite in Vancouver have been overwhelmingly positive. This study assesses whether the above mentioned facility in the Downtown Eastside of Vancouver needs to be expanded to other locations, more specifically that of Canada's capital city, Ottawa. The current study is aimed at contributing to the existing literature on health policy by conducting cost-benefit and cost-effective analyses for the opening of SIFs in Ottawa, Ontario. In particular, the costs of operating numerous SIFs in Ottawa was compared to the savings incurred; this was done after accounting for the prevention of new HIV and Hepatitis C (HCV) infections. To ensure accuracy, two distinct mathematical models and a sensitivity analysis were employed. The sensitivity analyses conducted with the models reveals the potential for SIFs in Ottawa to be a fiscally responsible harm reduction strategy for the prevention of HCV cases--when considered independently. With a baseline sharing rate of 19%, the cumulative annual cost model supported the establishment of two SIFs and the marginal annual cost model supported the establishment of a single SIF. More often, the prevention of HIV or HCV alone were not sufficient to justify the establishment cost-effectiveness; rather, only when both HIV and HCV are considered does sufficient economic support became apparent. Funded supervised injection facilities in Ottawa appear to be an efficient and effective use of financial resources in the public health domain.

  20. A two stream radiative transfer model for scaling solar induced fluorescence from leaf to canopy

    Science.gov (United States)

    Quaife, T. L.

    2017-12-01

    Solar induced fluorescence (SIF) is becoming widely used as a proxy for gross primary productivity (GPP), in particular with the advent of its measurement by Earth Observation satellites such as OCO and GOSAT. A major attraction of SIF is that it is independent of the assumptions embedded in light use efficiency based GPP products derived from satellite missions such as MODIS. The assumptions in such products are likely not compatible with any given land surface model and hence comparing the two is problematic. On the other hand to compare land surface model predictions of GPP to satellite based SIF data requires either (a) translation of SIF into estimates of GPP, or (b) direct predictions of SIF from the land surface model itself. The former typically relies on empirical relationships, whereas the latter can make direct use of our physiological understanding of the link between photosynthesis and fluorescence at the leaf scale and is therefore preferable. Here I derive a two stream model for fluorescence that is capable of translating between leaf scale models of SIF and the canopy leaving radiance taking into account all levels of photon scattering. Other such models have been developed previously but the model described here is physically consistent with the Sellers' two stream radiative transfer scheme which is widely used in modern land surface models. Consequently any model that already employs the Sellers's scheme can use the new model without requiring modification. This includes, for example, JULES, the land surface model of the new UK Earth System Model (UKESM) and CLM, the US Community Land Model (part of the NCAR Earth System Model). The new canopy SIF model is extremely computationally efficient and can be applied to vertically inhomogeneous canopies.

  1. Dicty_cDB: SSB373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

  2. Experimental Validation of an FSW Model with an Enhanced Friction Law: Application to a Threaded Cylindrical Pin Tool

    Directory of Open Access Journals (Sweden)

    Narges Dialami

    2017-11-01

    Full Text Available This work adopts a fast and accurate two-stage computational strategy for the analysis of FSW (Friction stir welding processes using threaded cylindrical pin tools. The coupled thermo-mechanical problem is equipped with an enhanced friction model to include the effect of non-uniform pressure distribution under the pin shoulder. The overall numerical strategy is successfully validated by the experimental measurements provided by the industrial partner (Sapa. The verification of the numerical model using the experimental evidence is not only accomplished in terms of temperature evolution but also in terms of torque, longitudinal, transversal and vertical forces.

  3. Measuring Photosynthetic Response to Drought Stress using Active and Passive Fluorescence

    Science.gov (United States)

    Helm, L.; Lerdau, M.; Wang, W.; Yang, X.

    2017-12-01

    Photosynthesis, the endothermic reactions involving the absorption of light and fixation and reduction of carbon dioxide by plants, plays important roles in carbon and water cycles, food security, and even weather and climate patterns. Solar radiation provides the energy for photosynthesis, but often plants absorb more solar energy than they can use to reduce carbon dioxide. This excess energy, which is briefly stored as high-energy electrons in the chloroplast, must be removed or damage to the leaf's photosynthetic machinery will occur. One important energy dissipation pathway is for the high energy electrons to return to their lower valance state and, in doing so, release radiation (fluorescence). This fluorescence (known as solar induced fluorescence (SIF) has been found to strongly correlate with gross photosynthesis. Recent advances in the remote sensing of SIF allow for large-scale real-time estimation of photosynthesis. In a warming climate with more frequent stress, remote sensing is necessary for measuring the spatial and temporal variability of photosynthesis. However, the mechanisms that link SIF and photosynthesis are unclear, particularly how the relationship may or may not change under stress. We present data from leaf-level measurements of gas exchange, pulse amplitude modulation (PAM) fluorescence, and SIF in two major tree species in North America. Water-stressed and well-watered plants were compared to determine how SIF and carbon dioxide exchange are modulated by drought diurnally and seasonally. Secondly, photosynthesis and fluorescence under high and low oxygen concentrations were compared to determine how photorespiration alters the relationship between SIF and gross photosynthesis. We find a strong correlation between SIF and steady-state fluorescence measured with conventional PAM fluorometry. Our results also indicate that drought-stress modulates the SIF-photosynthesis relationship, and this may be driven by drought-induced changes in

  4. Long-term exposure to xenoestrogens alters some brain monoamines and both serum thyroid hormones and cortisol levels in adult male rats

    Directory of Open Access Journals (Sweden)

    Nashwa M. Saied

    2014-10-01

    Full Text Available The present study was designed to examine the effect of long-term treatment with the phytoestrogen soy isoflavone [(SIF; 43 mg/kg body weight/day] and/or the plastics component bisphenol-A [(BPA; 3 mg/kg body weight/day] on some monoamines in the forebrain and both serum thyroid hormones and cortisol levels of adult rats. Significant increases in serotonin (5-HT and norepinephrine (NE level, and significant decreases in 5-hydroxyindoleacetic acid (5-HIAA level and 5-HIAA/5-HT ratio, were observed after treatment with SIF or BPA. Level of dopamine (DA was increased in SIF-treated group and decreased in BPA-treated group. Activity of monoamine oxidase (MAO was decreased in all treated groups. The level of serum thyroid hormones (fT3 and fT4 was increased after treatment with SIF and decreased after exposure to BPA, while cortisol level was increased in all treated groups. It may be concluded that long-term exposure to SIF or BPA disrupts monoamine levels in the forebrain of adult rats through alteration in the metabolic pathways of amines and disorders of thyroid hormones and cortisol levels.

  5. Correction factor determination on failure rate equation of MacLaurin series for low and high mode application

    Directory of Open Access Journals (Sweden)

    Totok R. Biyanto

    2016-06-01

    Full Text Available Safety Instrumented Function (SIF is implemented on the system to prevent hazard in process industry. In general, most of SIF implementation in process industry works in low demand condition. Safety valuation of SIF that works in low demand can be solved by using quantitative method. The quantitative method is a simplified exponential equation form of MacLaurin series, which can be called simplified equation. Simplified equation used in high demand condition will generate a higher Safety Integrity Level (SIL and it will affect the higher safety cost. Therefore, the value of low or high demand rate limit should be determined to prevent it. The result of this research is a first order equation that can fix the error of SIL, which arises from the usage of simplified equation, without looking the demand rate limit for low and high demand. This equation is applied for SIL determination on SIF with 1oo1 vote. The new equation from this research is λ = 0.9428 λMC + 1.062E−04 H/P, with 5% average of error, where λMC is a value of λ from the simplified equation, Hazardous event frequency (H is a probabilistic frequency of hazard event and P is Probability of Failure on Demand (PFD in Independent Protection Layers (IPLs. The equation generated from this research could correct SIL of SIF in various H and P. Therefore, SIL design problem could be solved and it provides an appropriate SIL.

  6. A New Displacement-based Approach to Calculate Stress Intensity Factors With the Boundary Element Method

    Directory of Open Access Journals (Sweden)

    Marco Gonzalez

    Full Text Available Abstract The analysis of cracked brittle mechanical components considering linear elastic fracture mechanics is usually reduced to the evaluation of stress intensity factors (SIFs. The SIF calculation can be carried out experimentally, theoretically or numerically. Each methodology has its own advantages but the use of numerical methods has become very popular. Several schemes for numerical SIF calculations have been developed, the J-integral method being one of the most widely used because of its energy-like formulation. Additionally, some variations of the J-integral method, such as displacement-based methods, are also becoming popular due to their simplicity. In this work, a simple displacement-based scheme is proposed to calculate SIFs, and its performance is compared with contour integrals. These schemes are all implemented with the Boundary Element Method (BEM in order to exploit its advantages in crack growth modelling. Some simple examples are solved with the BEM and the calculated SIF values are compared against available solutions, showing good agreement between the different schemes.

  7. Linear least squares approach for evaluating crack tip fracture parameters using isochromatic and isoclinic data from digital photoelasticity

    Science.gov (United States)

    Patil, Prataprao; Vyasarayani, C. P.; Ramji, M.

    2017-06-01

    In this work, digital photoelasticity technique is used to estimate the crack tip fracture parameters for different crack configurations. Conventionally, only isochromatic data surrounding the crack tip is used for SIF estimation, but with the advent of digital photoelasticity, pixel-wise availability of both isoclinic and isochromatic data could be exploited for SIF estimation in a novel way. A linear least square approach is proposed to estimate the mixed-mode crack tip fracture parameters by solving the multi-parameter stress field equation. The stress intensity factor (SIF) is extracted from those estimated fracture parameters. The isochromatic and isoclinic data around the crack tip is estimated using the ten-step phase shifting technique. To get the unwrapped data, the adaptive quality guided phase unwrapping algorithm (AQGPU) has been used. The mixed mode fracture parameters, especially SIF are estimated for specimen configurations like single edge notch (SEN), center crack and straight crack ahead of inclusion using the proposed algorithm. The experimental SIF values estimated using the proposed method are compared with analytical/finite element analysis (FEA) results, and are found to be in good agreement.

  8. Stress Intensity Factors of Slanted Cracks in Bi-Material Plates

    Science.gov (United States)

    Ismail, Al Emran; Azhar Kamarudin, Kamarul; Nor, Nik Hisyamudin Muhd

    2017-10-01

    In this study, the stress intensity factors (SIF) of slanted cracks in bi-material plates subjected to mode I loading is numerically solved. Based on the literature survey, tremendous amount of research works are available studying the normal cracks in both similar and dissimilar plates. However, lack of SIF behavior for slanted cracks especially when it is embedded in bi-material plates. The slanted cracks are then modelled numerically using ANSYS finite element program. Two plates of different in mechanical properties are firmly bonded obliquely and then slanted edge cracks are introduced at the lower inclined edge. Isoparametric singular element is used to model the crack tip and the SIF is determined which is based on the domain integral method. Three mechanical mismatched and four slanted angles are used to model the cracks. According to the present results, the effects of mechanical mismatch on the SIF for normal cracks are not significant. However, it is played an important role when slanted angles are introduced. It is suggested that higher SIF can be obtained when the cracks are inclined comparing with the normal cracks. Consequently, accelerating the crack growth at the interface between two distinct materials.

  9. Assimilating solar-induced chlorophyll fluorescence into the terrestrial biosphere model BETHY-SCOPE v1.0: model description and information content

    Science.gov (United States)

    Norton, Alexander J.; Rayner, Peter J.; Koffi, Ernest N.; Scholze, Marko

    2018-04-01

    The synthesis of model and observational information using data assimilation can improve our understanding of the terrestrial carbon cycle, a key component of the Earth's climate-carbon system. Here we provide a data assimilation framework for combining observations of solar-induced chlorophyll fluorescence (SIF) and a process-based model to improve estimates of terrestrial carbon uptake or gross primary production (GPP). We then quantify and assess the constraint SIF provides on the uncertainty in global GPP through model process parameters in an error propagation study. By incorporating 1 year of SIF observations from the GOSAT satellite, we find that the parametric uncertainty in global annual GPP is reduced by 73 % from ±19.0 to ±5.2 Pg C yr-1. This improvement is achieved through strong constraint of leaf growth processes and weak to moderate constraint of physiological parameters. We also find that the inclusion of uncertainty in shortwave down-radiation forcing has a net-zero effect on uncertainty in GPP when incorporated into the SIF assimilation framework. This study demonstrates the powerful capacity of SIF to reduce uncertainties in process-based model estimates of GPP and the potential for improving our predictive capability of this uncertain carbon flux.

  10. Round Robin Analyses on Stress Intensity Factors of Inner Surface Cracks in Welded Stainless Steel Pipes

    Directory of Open Access Journals (Sweden)

    Chang-Gi Han

    2016-12-01

    Full Text Available Austenitic stainless steels (ASSs are widely used for nuclear pipes as they exhibit a good combination of mechanical properties and corrosion resistance. However, high tensile residual stresses may occur in ASS welds because postweld heat treatment is not generally conducted in order to avoid sensitization, which causes a stress corrosion crack. In this study, round robin analyses on stress intensity factors (SIFs were carried out to examine the appropriateness of structural integrity assessment methods for ASS pipe welds with two types of circumferential cracks. Typical stress profiles were generated from finite element analyses by considering residual stresses and normal operating conditions. Then, SIFs of cracked ASS pipes were determined by analytical equations represented in fitness-for-service assessment codes as well as reference finite element analyses. The discrepancies of estimated SIFs among round robin participants were confirmed due to different assessment procedures and relevant considerations, as well as the mistakes of participants. The effects of uncertainty factors on SIFs were deducted from sensitivity analyses and, based on the similarity and conservatism compared with detailed finite element analysis results, the R6 code, taking into account the applied internal pressure and combination of stress components, was recommended as the optimum procedure for SIF estimation.

  11. Evaluation of stress intensity factors for bi-material interface cracks using displacement jump methods

    Science.gov (United States)

    Nehar, K. C.; Hachi, B. E.; Cazes, F.; Haboussi, M.

    2017-12-01

    The aim of the present work is to investigate the numerical modeling of interfacial cracks that may appear at the interface between two isotropic elastic materials. The extended finite element method is employed to analyze brittle and bi-material interfacial fatigue crack growth by computing the mixed mode stress intensity factors (SIF). Three different approaches are introduced to compute the SIFs. In the first one, mixed mode SIF is deduced from the computation of the contour integral as per the classical J-integral method, whereas a displacement method is used to evaluate the SIF by using either one or two displacement jumps located along the crack path in the second and third approaches. The displacement jump method is rather classical for mono-materials, but has to our knowledge not been used up to now for a bi-material. Hence, use of displacement jump for characterizing bi-material cracks constitutes the main contribution of the present study. Several benchmark tests including parametric studies are performed to show the effectiveness of these computational methodologies for SIF considering static and fatigue problems of bi-material structures. It is found that results based on the displacement jump methods are in a very good agreement with those of exact solutions, such as for the J-integral method, but with a larger domain of applicability and a better numerical efficiency (less time consuming and less spurious boundary effect).

  12. Spatial-temporal consistency between gross primary productivity and solar-induced chlorophyll fluorescence of vegetation in China during 2007-2014

    Science.gov (United States)

    Ma, J.; Xiao, X.; Zhang, Y.; Chen, B.; Zhao, B.

    2017-12-01

    Great significance exists in accurately estimating spatial-temporal patterns of gross primary production (GPP) because of its important role in global carbon cycle. Satellite-based light use efficiency (LUE) models are regarded as an efficient tool in simulating spatially time-sires GPP. However, the estimation of the accuracy of GPP simulations from LUE at both spatial and temporal scales is still a challenging work. In this study, we simulated GPP of vegetation in China during 2007-2014 using a LUE model (Vegetation Photosynthesis Model, VPM) based on MODIS (moderate-resolution imaging spectroradiometer) images of 8-day temporal and 500-m spatial resolutions and NCEP (National Center for Environmental Prediction) climate data. Global Ozone Monitoring Instrument 2 (GOME-2) solar-induced chlorophyll fluorescence (SIF) data were used to compare with VPM simulated GPP (GPPVPM) temporally and spatially using linear correlation analysis. Significant positive linear correlations exist between monthly GPPVPM and SIF data over both single year (2010) and multiple years (2007-2014) in China. Annual GPPVPM is significantly positive correlated with SIF (R2>0.43) spatially for all years during 2007-2014 and all seasons in 2010 (R2>0.37). GPP dynamic trends is high spatial-temporal heterogeneous in China during 2007-2014. The results of this study indicate that GPPVPM is temporally and spatially in line with SIF data, and space-borne SIF data have great potential in validating and parameterizing GPP estimation of LUE-based models.

  13. The fluoride content of an anion exchange resin in the fluoride form

    International Nuclear Information System (INIS)

    Kleijn, J.P. de; Zanten, B. van

    1977-01-01

    The fluoride content of an anion exchange resin in the F - -form depends on the material of the equipment used for the preparation. If a glass equipment is used too much fluorine is introduced. The experimental results are explained by taking into account a competition of F - and SiF 6 2- for the hydroxyl positions of the resin (OH - ). Because SiF 6 2- is bivalent and has a lower hydration energy than F - , the resin has a much larger affinity for this species than for F - . If a higher concentration of SiF 6 2- is generated by an intensive contact of the HF solution with glass, two OH-groups may be replaced by one SiF 6 2- . This results in a resin with 3 times as much fluorine as calculated from the chloride capacity. If the formation of SiF 6 2- is impossible as for example in teflon equipment, the same capacity is obtained for chloride and fluoride. (T.G.)

  14. Round robin analysis on stress intensity factor of inner surface cracks in welded stainless steel pipes

    Energy Technology Data Exchange (ETDEWEB)

    Han, Chang Gi; Chang, Yoon Suk [Dept. of Nuclear Engineering, College of Engineering, Kyung Hee University, Yongin (Korea, Republic of); Kim, Jong Sung [Dept. of Mechanical Engineering, Sunchon National University, Sunchon (Korea, Republic of); Kim, Maan Won [Central Research Institute, Korea Hydro and Nuclear Power Company, Daejeon (Korea, Republic of)

    2016-12-15

    Austenitic stainless steels (ASSs) are widely used for nuclear pipes as they exhibit a good combination of mechanical properties and corrosion resistance. However, high tensile residual stresses may occur in ASS welds because postweld heat treatment is not generally conducted in order to avoid sensitization, which causes a stress corrosion crack. In this study, round robin analyses on stress intensity factors (SIFs) were carried out to examine the appropriateness of structural integrity assessment methods for ASS pipe welds with two types of circumferential cracks. Typical stress profiles were generated from finite element analyses by considering residual stresses and normal operating conditions. Then, SIFs of cracked ASS pipes were determined by analytical equations represented in fitness-for-service assessment codes as well as reference finite element analyses. The discrepancies of estimated SIFs among round robin participants were confirmed due to different assessment procedures and relevant considerations, as well as the mistakes of participants. The effects of uncertainty factors on SIFs were deducted from sensitivity analyses and, based on the similarity and conservatism compared with detailed finite element analysis results, the R6 code, taking into account the applied internal pressure and combination of stress components, was recommended as the optimum procedure for SIF estimation.

  15. Sustainability innovation foundry - FY13: Merging research and operations

    Energy Technology Data Exchange (ETDEWEB)

    Mizner, Jack Harry [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Passell, Howard David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Keller, Elizabeth James Kistin [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Gordon, Margaret Ellen [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); McNeish, Jerry A. [Sandia National Laboratories, Livermore, CA (United States); Sullivan, Kristina [Sandia National Laboratories, Livermore, CA (United States)

    2013-12-01

    Sustainability is a critical national security issue for the U.S. and other nations. Sandia National Laboratories (SNL) is already a global leader in sustainability science and technology (SS&T) as documented in this report. This report documents the ongoing work conducted this year as part of the Sustainability Innovation Foundry (SIF). The efforts of the SIF support Sandia's national and international security missions related to sustainability and resilience revolving around energy use, water use, and materials, both on site at Sandia and externally. The SIF leverages existing Sandia research and development (R&D) in sustainability science and technology to support new solutions to complex problems. The SIF also builds on existing Sandia initiatives to support transformation of Sandia into a fully sustainable entity in terms of materials, energy, and water use. In the long term, the SIF will demonstrate the efficacy of sustainability technology developed at Sandia through prototyping and test bed approaches and will provide a common platform for support of solutions to the complex problems surrounding sustainability. Highlights from this year include the Sustainability Idea Challenge, improvements in facilities energy use, lectures and presentations from relevant experts in sustainability [Dr. Barry Hughes, University of Denver], and significant development of the Institutional Transformation (IX) modeling tools to support evaluation of proposed modifications to the SNL infrastructure to realize energy savings.

  16. Topical corticosteroids in the treatment of acute sunburn - A randomized, double-blind clinical trial

    DEFF Research Database (Denmark)

    Faurschou, A.; Wulf, Hans Chr.

    2008-01-01

    Objective: To examine the effect of topical corticosteroid treatment on acute sunburn. Design: Randomized, double-blind clinical trial. Setting: University dermatology department. Patients: Twenty healthy volunteers with Fitzpatrick skin types I (highly sensitive, always burns easily, tans...... minimally) through III (sun-sensitive skin, sometimes burns, slowly tans to light brown). Intervention: Seven 34-cm(2) areas were marked on the upper aspect of the back of each participant. An untreated area was tested to determine UV sensitivity. Two areas were treated with excess amounts (2 mg/cm(2......) was determined by the following equation: SIF=MED(minimal erythema dose) on treated skin/MED on nontreated skin. An SIF greater than 1 indicated an effect of topical corticosteroids in sunburn relief. Results: The SIFs in the areas treated with either topical corticosteroid 30 minutes before UV-B exposure...

  17. Stochastic modelling of thermal fatigue crack growth for applying in the structural reliability of nuclear piping

    International Nuclear Information System (INIS)

    Radu, V.

    2016-01-01

    The problem of thermal fatigue in mixing areas arises in nuclear piping where a turbulent mixing or vortices produce rapid fluid temperature fluctuations with random frequencies. The assessment of fatigue crack growth due to cyclic thermal loads arising from turbulent mixing presents significant challenges, principally due to the difficulty of establishing the actual loading spectrum. To apply the Stochastic approach of thermal fatigue, a frequency temperature response function is proposed. For the elastic thermal stresses distribution solutions, the magnitude of the frequency response function is first derived and checked against the prediction by FEA. The connection between SIF.s power spectral density (PSD) and temperature.s PSD is assured with SIF frequency response function modulus. The frequency of the peaks of each magnitude for KI is supposed to be a stationary narrow-band Gaussian process. The probabilities of failure are estimated by means of the Monte Carlo methods considering a limit state function. (authors)

  18. Fracture analysis of a transversely isotropic high temperature superconductor strip based on real fundamental solutions

    International Nuclear Information System (INIS)

    Gao, Zhiwen; Zhou, Youhe

    2015-01-01

    Highlights: • We studied fracture problem in HTS based on real fundamental solutions. • When the thickness of HTS strip increases the SIF decrease. • A higher applied field leads to a larger stress intensity factor. • The greater the critical current density is, the smaller values of the SIF is. - Abstract: Real fundamental solution for fracture problem of transversely isotropic high temperature superconductor (HTS) strip is obtained. The superconductor E–J constitutive law is characterized by the Bean model where the critical current density is independent of the flux density. Fracture analysis is performed by the methods of singular integral equations which are solved numerically by Gauss–Lobatto–Chybeshev (GSL) collocation method. To guarantee a satisfactory accuracy, the convergence behavior of the kernel function is investigated. Numerical results of fracture parameters are obtained and the effects of the geometric characteristics, applied magnetic field and critical current density on the stress intensity factors (SIF) are discussed

  19. Study on the relationship between stress intensity factor and J integral for mixed mode crack with arbitrary inclination based on SBFEM

    International Nuclear Information System (INIS)

    Zhu, C L; Li, J B; Lin, G; Zhong, H

    2010-01-01

    The J integral and the stress intensity factor (SIF) K are both important research objects of fracture mechanics, and are often employed to establish criteria for crackpropagation. The relationship between them has always been a research hotspot. In this paper, the SIF can be obtained conveniently by the scaled boundary finite element method (SBFEM) due to the fact that analytical solution can be obtained along the radial direction for stress singularity problems. The J integral can be solved analytically using the formulae between J and K for mixed mode crack with arbitrary inclination in elastic materials. Moreover, the J integral values obtained by this method are more accurate and convenient than by its definition. Factors that affect the accuracy of SIF and J integral, such as the distance between the crack and outer boundary, size of the discretized elements and partition of the domain into super-elements, are examined.

  20. Crack tip field in circumferentially-cracked round bar (CCRB in tension affected by loss of axial symmetry

    Directory of Open Access Journals (Sweden)

    J. Toribio

    2017-07-01

    Full Text Available In this paper, the stress intensity factor (SIF is computed in a circumferentially-cracked round bar (CCRB subjected to tensile loading, considering that the resistant ligament is circular and exhibits certain eccentricity in relation to the cylinder axis. The computation was performed by means of the finite element method (FEM using a three dimensional (3D model and the J-integral, the analyzed variable being the eccentricity of the circular ligament. Results show that the SIF is higher at the deepest point of the crack and that an increase of eccentricity (in relation to the bar axis raises the difference between the SIF values along the crack front. From a certain value of the misalignment a bending effect appears, so that the crack remains closed in the area near the point of lower depth.

  1. [Comparison between colorimetry and HPLC on the stability test of roxithromycin].

    Science.gov (United States)

    Wei, Z P; Mao, S R; Bi, D Z

    2000-11-01

    To compare the stability of roxithromycin in solutions of different pH. Roxithromycin solutions of different pH were prepared with water, simulate intestinal fluid (SIF) and simulate gastric fluid (SGF) shown to be the stability of these solutions were tested by colorimetry and HPLC. Roxithromycin was stable in water, SGF and SIF determined by colorimetry. However, it was found to be stable only in water and SIF but unstable in SGF as determined by HPLC. Roxithromycin is unstable in acidic medium like SGF. The metabolite of roxithromycin showed unfavorable interference on the assay of roxithromycin when colorimetry was used. Colorimetry can not be used for the determination and assay of roxithromycin in acidic solution like SGF.

  2. Metal plasmon enhanced europium complex luminescence

    International Nuclear Information System (INIS)

    Liu Feng; Aldea, Gabriela; Nunzi, Jean-Michel

    2010-01-01

    The plasmon enhanced luminescence of a rare-earth complex Tris(6, 6, 7, 7, 8, 8, 8-heptafluoro-2, 2-dimethyl-3, 5-octanedionato) europium (Eu(fod) 3 ) was investigated. A polyvinyl alcohol (PVA) thin film was successfully adopted as a spacer to separate the Eu complex from the silver island film (SIF), and five-fold enhancement of the radiative decay rate of the Eu complex on SIF was demonstrated based on the luminescence intensity and lifetime measurement. Investigation of the distance dependent luminescence indicates that 7 nm is an optimal distance for SIF enhanced Eu luminescence. Plasmon enhanced rare-earth luminescence based on an organic film spacer would find potential applications in plasmon enhanced organic light emitting diode (OLED) devices.

  3. Two-photon induced fluorescence of Cy5-DNA in buffer solution and on silver island films

    International Nuclear Information System (INIS)

    Lukomska, Joanna; Gryczynski, Ignacy; Malicka, Joanna; Makowiec, Slawomir; Lakowicz, Joseph R.; Gryczynski, Zygmunt

    2005-01-01

    We report the observation of a strong two-photon induced fluorescence emission of Cy5-DNA within the tunable range of a Ti:Sapphire laser. The estimated two-photon cross-section for Cy5-DNA of 400 GM is about 3.5-fold higher than it was reported for rhodamine B. The fundamental anisotropies of Cy5-DNA are close to the theoretical limits of 2/5 and 4/7 for one- and two-photon excitation, respectively. We also observed an enhanced two-photon induced fluorescence (TPIF) of Cy5-DNA deposited on silver island films (SIFs). In the presence of SIFs, the TPIF is about 100-fold brighter. The brightness increase of Cy5-DNA TPIF near SIFs is mostly due to enhanced local field

  4. Exploring the Poverty Reduction Potential of Social Marketing in Tourism Development

    Directory of Open Access Journals (Sweden)

    Dao V. Truong

    2015-12-01

    Full Text Available Although social marketing has been demonstrated to be an effective tool of behavior change in a variety of contexts, its poverty reduction potential in tourism development has captured limited research attention. This paper explores the potential contribution of social marketing to tourism-related poverty alleviation in Sapa, Vietnam. It does so by creating an understanding of how local residents perceive poverty, then exploring whether social marketing could be a potential solution in the case of Sapa. Through participant observations and semi-structured interviews, this study reveals that local people perceive poverty as a lack of rice and/or income and ascribe it to both internal and external factors. Local women often follow tourists to sell handicrafts, causing discomfort for tourists and driving them away from certain destinations. Insufficient capital and farming land are also identified as a critical barrier to poverty reduction. This study argues that by understanding the poor people’s perspectives on poverty, we can identify meaningful approaches to poverty alleviation. Thereby, social marketing can be one of the tools to bring the marginalized voice of poor people to the attention of decision-makers.

  5. Spatial-temporal consistency between gross primary productivity and solar-induced chlorophyll fluorescence of vegetation in China during 2007-2014.

    Science.gov (United States)

    Ma, Jun; Xiao, Xiangming; Zhang, Yao; Doughty, Russell; Chen, Bangqian; Zhao, Bin

    2018-10-15

    Accurately estimating spatial-temporal patterns of gross primary production (GPP) is important for the global carbon cycle. Satellite-based light use efficiency (LUE) models are regarded as an efficient tool in simulating spatial-temporal dynamics of GPP. However, the accuracy assessment of GPP simulations from LUE models at both spatial and temporal scales remains a challenge. In this study, we simulated GPP of vegetation in China during 2007-2014 using a LUE model (Vegetation Photosynthesis Model, VPM) based on MODIS (moderate-resolution imaging spectroradiometer) images with 8-day temporal and 500-m spatial resolutions and NCEP (National Center for Environmental Prediction) climate data. Global Ozone Monitoring Instrument 2 (GOME-2) solar-induced chlorophyll fluorescence (SIF) data were used to compare with VPM simulated GPP (GPP VPM ) temporally and spatially using linear correlation analysis. Significant positive linear correlations exist between monthly GPP VPM and SIF data over a single year (2010) and multiple years (2007-2014) in most areas of China. GPP VPM is also significantly positive correlated with GOME-2 SIF (R 2  > 0.43) spatially for seasonal scales. However, poor consistency was detected between GPP VPM and SIF data at yearly scale. GPP dynamic trends have high spatial-temporal variation in China during 2007-2014. Temperature, leaf area index (LAI), and precipitation are the most important factors influence GPP VPM in the regions of East Qinghai-Tibet Plateau, Loss Plateau, and Southwestern China, respectively. The results of this study indicate that GPP VPM is temporally and spatially in line with GOME-2 SIF data, and space-borne SIF data have great potential for evaluating LUE-based GPP models. Copyright © 2018 Elsevier B.V. All rights reserved.

  6. European Space Agency's Fluorescence Explorer Mission: Concept and Applications

    Science.gov (United States)

    Mohammed, G.; Moreno, J. F.; Goulas, Y.; Huth, A.; Middleton, E.; Miglietta, F.; Nedbal, L.; Rascher, U.; Verhoef, W.; Drusch, M.

    2012-12-01

    The Fluorescence Explorer (FLEX) is a dedicated satellite for the detection and measurement of solar-induced fluorescence (SIF). It is one of two candidate missions currently under evaluation by ESA for deployment in its Earth Explorer 8 program, with Phase A/B1 assessments now underway. FLEX is planned as a tandem mission with ESA's core mission Sentinel-3, and would carry an instrument, FLORIS, optimized for discrimination of the fluorescence signal in terrestrial vegetation. The FLEX mission would be the first to be focussed upon optimization of SIF detection in terrestrial vegetation, and using finer spatial resolution than is available with current satellites. It would open up a novel avenue for monitoring photosynthetic function from space, with diverse potential applications. Plant photosynthetic tissues absorbing sunlight in the wavebands of photosynthetically active radiation (400 to 700 nm) emit fluorescence in the form of red and far-red light. This signal confers a small but measurable contribution to apparent reflectance spectra, and with appropriate analysis it may be detected and quantified. Over the last 15-20 years, techniques for SIF detection have progressed from contact or near-contact methods using single leaves to remote techniques using airborne sensors and towers over plant canopies. Ongoing developments in instrumentation, atmospheric correction procedures, signal extraction techniques, and utilization of the SIF signal itself are all critical aspects of progress in this area. The FLEX mission would crystallize developments to date into a state-of-the-art pioneering mission targeting actual photosynthetic function. This compares to existing methods which address only potential function. Thus, FLEX could serve to provide real-time data on vegetation health and stress status, and inputs for parameterization of photosynthetic models (e.g. with measures of light-use efficiency). SIF might be correlated or modelled to photosynthetic rates or

  7. Magnetic resonance perfusion and diffusion imaging characteristics of transient bone marrow edema, avascular necrosis and subchondral insufficiency fractures of the proximal femur

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Dirk, E-mail: d.mueller@uk-koeln.de [Department of Radiology, University of Cologne (Germany); Department of Radiology, Technische Universität München (Germany); Schaeffeler, Christoph, E-mail: schaeffeler@me.com [Department of Radiology, Cantonal Hospital Graubuenden, Chur (Switzerland); Department of Radiology, Cantonal Hospital Graubuenden, Chur (Switzerland); Baum, Thomas, E-mail: thomas-baum@gmx.de [Department of Radiology, Technische Universität München (Germany); Walter, Flavia, E-mail: flavia_walter2000@yahoo.de [Department of Radiology, Technische Universität München (Germany); Rechl, Hans, E-mail: rechl@tum.de [Department of Orthopaedics, Technische Universität München (Germany); Rummeny, Ernst J., E-mail: rummeny@tum.de [Department of Radiology, Technische Universität München (Germany); Woertler, Klaus, E-mail: klaus.woertler@tum.de [Department of Radiology, Technische Universität München (Germany)

    2014-10-15

    Highlights: • DCE-MRI may add information to the pathophysiology of bone marrow edema (BME) of the proximal femur. • Patients with transient bone marrow edema (TBME) or subchondral insufficiency fractures (SIF) and avascular osteonecrosis (AVN) showed different MR perfusion patterns. • Perfusion characteristics suggest different pathophysiology for AVN compared with TBME or SIF. • Diffusion weighted imaging (DWI) was not able to discriminate necrotic from edematous bone marrow. • DWI is of limited value to evaluate BME of the proximal femur. - Abstract: Purpose: To evaluate magnetic resonance (MR) perfusion and diffusion imaging characteristics in patients with transient bone marrow edema (TBME), avascular necrosis (AVN), or subchondral insufficiency fractures (SIF) of the proximal femur. Materials and methods: 29 patients with painful hip and bone marrow edema pattern of the proximal femur on non-contrast MR imaging were examined using diffusion-weighted and dynamic gadolinium-enhanced sequences. Apparent diffusion coefficients (ADCs) and perfusion parameters were calculated for different regions of the proximal femur. Regional distribution and differences in ADC values and perfusion parameters were evaluated. Results: Seven patients presented with TBME, 15 with AVN and seven with SIF of the proximal femur. Perfusion imaging showed significant differences for maximum enhancement values (E{sub max}), slope (E{sub slope}) and time to peak (TTP) between the three patient groups (p < 0.05). In contrast, no significant differences for ADC values were calculated when comparing TBME, AVN, and SIF patients. Conclusion: Diffusion weighted imaging of bone marrow of the proximal femur did not show significant differences between patients with TBME, AVN or SIF. In contrast, MR perfusion imaging demonstrated significant differences for the different patient groups and may as a complementary imaging technique add information to the understanding of the pathophysiology

  8. Magnetic resonance perfusion and diffusion imaging characteristics of transient bone marrow edema, avascular necrosis and subchondral insufficiency fractures of the proximal femur

    International Nuclear Information System (INIS)

    Mueller, Dirk; Schaeffeler, Christoph; Baum, Thomas; Walter, Flavia; Rechl, Hans; Rummeny, Ernst J.; Woertler, Klaus

    2014-01-01

    Highlights: • DCE-MRI may add information to the pathophysiology of bone marrow edema (BME) of the proximal femur. • Patients with transient bone marrow edema (TBME) or subchondral insufficiency fractures (SIF) and avascular osteonecrosis (AVN) showed different MR perfusion patterns. • Perfusion characteristics suggest different pathophysiology for AVN compared with TBME or SIF. • Diffusion weighted imaging (DWI) was not able to discriminate necrotic from edematous bone marrow. • DWI is of limited value to evaluate BME of the proximal femur. - Abstract: Purpose: To evaluate magnetic resonance (MR) perfusion and diffusion imaging characteristics in patients with transient bone marrow edema (TBME), avascular necrosis (AVN), or subchondral insufficiency fractures (SIF) of the proximal femur. Materials and methods: 29 patients with painful hip and bone marrow edema pattern of the proximal femur on non-contrast MR imaging were examined using diffusion-weighted and dynamic gadolinium-enhanced sequences. Apparent diffusion coefficients (ADCs) and perfusion parameters were calculated for different regions of the proximal femur. Regional distribution and differences in ADC values and perfusion parameters were evaluated. Results: Seven patients presented with TBME, 15 with AVN and seven with SIF of the proximal femur. Perfusion imaging showed significant differences for maximum enhancement values (E max ), slope (E slope ) and time to peak (TTP) between the three patient groups (p < 0.05). In contrast, no significant differences for ADC values were calculated when comparing TBME, AVN, and SIF patients. Conclusion: Diffusion weighted imaging of bone marrow of the proximal femur did not show significant differences between patients with TBME, AVN or SIF. In contrast, MR perfusion imaging demonstrated significant differences for the different patient groups and may as a complementary imaging technique add information to the understanding of the pathophysiology of

  9. Validation of surface crack stress intensity factors of a tubular K-joint

    International Nuclear Information System (INIS)

    Lie, S.T.; Lee, C.K.; Chiew, S.P.; Shao, Y.B.

    2005-01-01

    Tubular K-joints are encountered widely in offshore structures, and the prediction of damaged joints depends very much on the accuracy of stress intensity factor solutions (SIFs). No parametric equations and very few results have been proposed and published in the literature for estimating the SIFs of any K-joints subjected to complex loading conditions. In this paper, a mesh generation method proposed previously for the Y-joint and T-joint has been extended to the K-joint. This method is realized by dividing the K-joint into several sub-zones with each zone consisting of different types of elements and mesh densities. This method has a distinct advantage of controlling the mesh quality, and most importantly the aspect ratio of the elements along the crack front. When the mesh of all the sub-zones has been generated automatically and completely, they are merged to form the complete model. The two most commonly used methods, namely the J-integral and displacement extrapolation, are used to evaluate the SIF values along the crack front of a typical K-joint. To validate the accuracy of these computed SIFs, a full-scale K-joint specimen was tested to failure under fatigue loading conditions. The standard alternating current potential drop (ACPD) technique was used to monitor the rate of crack propagation of the surface crack located at the hot spot stress region. Using the given material parameters C and m, the experimental SIFs were deduced, and they are found to be in good agreement with the computed SIFs obtained from the generated models. Hence, the proposed finite element models are both efficient and reliable

  10. Simulated digestion for testing the stability of edible vaccine based on Cucumber mosaic virus (CMV) chimeric particle display Hepatitis C virus (HCV) peptide.

    Science.gov (United States)

    Vitti, Antonella; Nuzzaci, Maria; Condelli, Valentina; Piazzolla, Pasquale

    2014-01-01

    Edible vaccines must survive digestive process and preserve the specific structure of the antigenic peptide to elicit effective immune response. The stability of a protein to digestive process can be predicted by subjecting it to the in vitro assay with simulated gastric fluid (SGF) and simulated intestinal fluid (SIF). Here, we describe the protocol of producing and using chimeric Cucumber mosaic virus (CMV) displaying Hepatitis C virus (HCV) derived peptide (R9) in double copy as an oral vaccine. Its stability after treatment with SGF and SIF and the preservation of the antigenic properties were verified by SDS-PAGE and immuno western blot techniques.

  11. Comparative Study on Crack Initiation and Propagation of Glass under Thermal Loading

    Directory of Open Access Journals (Sweden)

    Yu Wang

    2016-09-01

    Full Text Available This paper explores the fracture process based on finite element simulation. Both probabilistic and deterministic methods are employed to model crack initiation, and several commonly used criteria are utilized to predict crack growth. It is concluded that the criteria of maximum tensile stress, maximum normal stress, and maximum Mises stress, as well as the Coulomb-Mohr criterion are able to predict the initiation of the first crack. The mixed-mode criteria based on the stress intensity factor (SIF, energy release rate, and the maximum principal stress, as well as the SIF-based maximum circumferential stress criterion are suitable to predict the crack propagation.

  12. THE REGIONAL DIFFERENCES OF GPP ESTIMATION BY SOLAR INDUCED FLUORESCENCE

    Directory of Open Access Journals (Sweden)

    X. Wang

    2018-04-01

    Full Text Available Estimating gross primary productivity (GPP at large spatial scales is important for studying the global carbon cycle and global climate change. In this study, the relationship between solar-induced chlorophyll fluorescence (SIF and GPP is analysed in different levels of annual average temperature and annual total precipitation respectively using simple linear regression analysis. The results showed high correlation between SIF and GPP, when the area satisfied annual average temperature in the range of −5 °C to 15 °C and the annual total precipitation is higher than 200 mm. These results can provide a basis for future estimation of GPP research.

  13. The Regional Differences of Gpp Estimation by Solar Induced Fluorescence

    Science.gov (United States)

    Wang, X.; Lu, S.

    2018-04-01

    Estimating gross primary productivity (GPP) at large spatial scales is important for studying the global carbon cycle and global climate change. In this study, the relationship between solar-induced chlorophyll fluorescence (SIF) and GPP is analysed in different levels of annual average temperature and annual total precipitation respectively using simple linear regression analysis. The results showed high correlation between SIF and GPP, when the area satisfied annual average temperature in the range of -5 °C to 15 °C and the annual total precipitation is higher than 200 mm. These results can provide a basis for future estimation of GPP research.

  14. Investigation into the Effects of Weapon Setback on Various Materials and Geometries.

    Science.gov (United States)

    1978-07-01

    taking the Laplace Transform of the dynamic equation, rearrangement and taking the inverse transform to find the time-dependent strain. The "dynamic...taking the inverse transform of the above equation: ■»-«fa-to*« 1 E’ ♦ ¥®*> B’ (s+-fj- )(S2+f )T If we neglect the residual strain on the system...partial fractions yields: *t) --f (fr JC-> K, K2 —L_ + + K3 »+-^ s+i(f) s-i(f) performing the inverse transform yields: 4©[K,^> ♦ K2

  15. Solvated copper(I) hexafluorosilicate π-complexes based on [Cu2(amtd)2]2+ (amtd = 2-allylamino-5-methyl-1,3,4-thiadiazole) dimer

    OpenAIRE

    Goreshnik, E.A.; Veryasov, G.; Morozov, Dmitry; Slyvka, Yu.; Ardan, B.; Mys'kiv, M.G.

    2016-01-01

    [Cu2(amdt)2]SiF6·C6H6 and [Cu2(amdt)2(H2O)2]SiF6·CH3CN·2H2O (amdt = 2-allylamino-5- methyl-1,3,4-thiadiazole) were obtained by alternating-current electrochemical synthesis, starting from water–acetonitrile–benzene mixtures containing 2-allylamino-5-methyl-1,3,4- thiadiazole and CuSiF6·4H2O. The electrochemical reduction of the saturated copper hexafluorosilicate water solution beneath the neatly poured layer of acetonitrile-benzene amdt solution resulted in the formation of cr...

  16. The analogy between photonic crystal fibres and step index fibres

    DEFF Research Database (Denmark)

    Birks, T.A.; Mogilevtsev, D.; Knight, J.C.

    1999-01-01

    The propagation constant of a photonic crystal fiber (PCF) can be approximated by substituting the effective V-value and NA into a formula valid for step index fibers (SIF), provided the V-value is defined with a core radius of 0.625 $Lambda@. V$PRM and NA must still be computed. Care must be taken...

  17. The Potential Role of Social Innovation Financing in Career and Technical Education

    Science.gov (United States)

    Overholster, George; Klein, Steven

    2015-01-01

    A new class of financial tools is being developed to promote human capital investments that benefit society. Social innovation financing (SIF) entails raising private capital to support promising social interventions, with the expectation that those providing the funding will eventually be repaid. Funds are allocated based on service providers'…

  18. Lessons from the Social Innovation Fund: Supporting Evaluation to Assess Program Effectiveness and Build a Body of Research Evidence

    Science.gov (United States)

    Zandniapour, Lily; Deterding, Nicole M.

    2018-01-01

    Tiered evidence initiatives are an important federal strategy to incentivize and accelerate the use of rigorous evidence in planning, implementing, and assessing social service investments. The Social Innovation Fund (SIF), a program of the Corporation for National and Community Service, adopted a public-private partnership approach to tiered…

  19. A linear least squares approach for evaluation of crack tip stress field parameters using DIC

    Science.gov (United States)

    Harilal, R.; Vyasarayani, C. P.; Ramji, M.

    2015-12-01

    In the present work, an experimental study is carried out to estimate the mixed-mode stress intensity factors (SIF) for different cracked specimen configurations using digital image correlation (DIC) technique. For the estimation of mixed-mode SIF's using DIC, a new algorithm is proposed for the extraction of crack tip location and coefficients in the multi-parameter displacement field equations. From those estimated coefficients, SIF could be extracted. The required displacement data surrounding the crack tip has been obtained using 2D-DIC technique. An open source 2D DIC software Ncorr is used for the displacement field extraction. The presented methodology has been used to extract mixed-mode SIF's for specimen configurations like single edge notch (SEN) specimen and centre slant crack (CSC) specimens made out of Al 2014-T6 alloy. The experimental results have been compared with the analytical values and they are found to be in good agreement, thereby confirming the accuracy of the algorithm being proposed.

  20. Comparison of the toxicity of fluoridation compounds in the nematode Caenorhabditis elegans.

    Science.gov (United States)

    Rice, Julie R; Boyd, Windy A; Chandra, Dave; Smith, Marjolein V; Den Besten, Pamela K; Freedman, Jonathan H

    2014-01-01

    Fluorides are commonly added to drinking water in the United States to decrease the incidence of dental caries. Silicofluorides, such as sodium hexafluorosilicate (Na2 SiF6 ) and fluorosilicic acid (H2 SiF6 ), are mainly used for fluoridation, although fluoride salts such as sodium fluoride (NaF) are also used. Interestingly, only the toxicity of NaF has been examined and not that of the more often used silicofluorides. In the present study, the toxicities of NaF, Na2 SiF6 , and H2 SiF6 were compared. The toxicity of these fluorides on the growth, feeding, and reproduction in the alternative toxicological testing organism Caenorhabditis elegans was examined. Exposure to these compounds produced classic concentration-response toxicity profiles. Although the effects of the fluoride compounds varied among the 3 biological endpoints, no differences were found between the 3 compounds, relative to the fluoride ion concentration, in any of the assays. This suggests that silicofluorides have similar toxicity to NaF. © 2013 SETAC.

  1. Influence of different methods of internal bone fixation on characteristics of bone callus in experimental animals

    Directory of Open Access Journals (Sweden)

    Gajdobranski Đorđe

    2014-01-01

    Full Text Available Introduction. Correct choice of osteosynthesis method is a very important factor in providing the optimal conditions for appropriate healing of the fracture. There are still disagreements about the method of stabilization of some long bone fractures. Critically observed, no method of fracture fixation is ideal. Each osteosynthesis method has both advantages and weaknesses. Objective. The objective of this study was to compare the results of the experimental application of three different internal fixation methods: plate fixation, intramedullary nail fixation and self-dynamisable internal fixator (SIF. Methods. A series of 30 animals were used (Lepus cuniculus as experimental animals, divided into three groups of ten animals each. Femoral diaphysis of each animal was osteotomized and fixed with one of three implants. Ten weeks later all animals were sacrificed and each specimen underwent histological and biomechanical testing. Results. Histology showed that the healing process with SIF was more complete and bone callus was more mature in comparison to other two methods. During biomechanical investigation (computerized bending stress test, it was documented with high statistical significance that using SIF led to stronger healing ten weeks after the operation. Conclusion. According to the results obtained in this study, it can be concluded that SIF is a suitable method for fracture treatment.

  2. Charnockitic magmatism in southern India

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    phosed under medium-high pressure (6–10kbar;. Harris et al ..... material has been thrust into deeper levels of the crust or ..... variation range of the particular charnockite mas- sif can be .... Andersen D J, Lindsley D H and Davidson P M 1993.

  3. Effect of Compressive Mode I on the Mixed Mode I/II Fatigue Crack Growth Rate of 42CrMo4

    Science.gov (United States)

    Heirani, Hasan; Farhangdoost, Khalil

    2018-01-01

    Subsurface cracks in mechanical contact loading components are subjected to mixed mode I/II, so it is necessary to evaluate the fatigue behavior of materials under mixed mode loading. For this purpose, fatigue crack propagation tests are performed with compact tension shear specimens for several stress intensity factor (SIF) ratios of mode I and mode II. The effect of compressive mode I loading on mixed mode I/II crack growth rate and fracture surface is investigated. Tests are carried out for the pure mode I, pure mode II, and two different mixed mode loading angles. On the basis of the experimental results, mixed mode crack growth rate parameters are proposed according to Tanaka and Richard with Paris' law. Results show neither Richard's nor Tanaka's equivalent SIFs are very useful because these SIFs depend strongly on the loading angle, but Richard's equivalent SIF formula is more suitable than Tanaka's formula. The compressive mode I causes the crack closure, and the friction force between the crack surfaces resists against the crack growth. In compressive loading with 45° angle, d a/d N increases as K eq decreases.

  4. Improved Formula for the Stress Intensity Factor of Semi-Elliptical Surface Cracks in Welded Joints under Bending Stress

    Science.gov (United States)

    Peng, Yang; Wu, Chao; Zheng, Yifu; Dong, Jun

    2017-01-01

    Welded joints are prone to fatigue cracking with the existence of welding defects and bending stress. Fracture mechanics is a useful approach in which the fatigue life of the welded joint can be predicted. The key challenge of such predictions using fracture mechanics is how to accurately calculate the stress intensity factor (SIF). An empirical formula for calculating the SIF of welded joints under bending stress was developed by Baik, Yamada and Ishikawa based on the hybrid method. However, when calculating the SIF of a semi-elliptical crack, this study found that the accuracy of the Baik-Yamada formula was poor when comparing the benchmark results, experimental data and numerical results. The reasons for the reduced accuracy of the Baik-Yamada formula were identified and discussed in this paper. Furthermore, a new correction factor was developed and added to the Baik-Yamada formula by using theoretical analysis and numerical regression. Finally, the predictions using the modified Baik-Yamada formula were compared with the benchmark results, experimental data and numerical results. It was found that the accuracy of the modified Baik-Yamada formula was greatly improved. Therefore, it is proposed that this modified formula is used to conveniently and accurately calculate the SIF of semi-elliptical cracks in welded joints under bending stress. PMID:28772527

  5. Survival of B. longum Bb-46 in simulated gastrointestinal fluids

    CSIR Research Space (South Africa)

    Thantsha, MS

    2009-01-01

    Full Text Available complexes formed in supercritical carbon dioxide (scCO2). Bacteria were exposed sequentially to simulated gastric fluid (SGF, pH 2) for 2 h and simulated intestinal fluid (SIF, pH 6.8) for 6 or 24 h. Total encapsulated bacteria were determined by suspending...

  6. Subchondral insufficiency fractures of the femoral head: associated imaging findings and predictors of clinical progression

    Energy Technology Data Exchange (ETDEWEB)

    Hackney, Lauren A.; Joseph, Gabby B.; Link, Thomas M. [University of California, San Francisco, Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); Lee, Min Hee [University of California, San Francisco, Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); University of Ulsan College of Medicine, Department of Radiology and Research Institute of Radiology, Asan Medical Center, Seoul (Korea, Republic of); Vail, Thomas P. [University of California, Department of Orthopaedic Surgery, San Francisco, CA (United States)

    2016-06-15

    To characterize the morphology and imaging findings of femoral head subchondral insufficiency fractures (SIF), and to investigate clinical outcomes in relation to imaging findings. Fifty-one patients with hip/pelvis magnetic resonance (MR) images and typical SIF characteristics were identified and reviewed by two radiologists. Thirty-five patients had follow-up documentation allowing assessment of clinical outcome. Subgroup comparisons were performed using regression models adjusted for age and body mass index. SIF were frequently associated with cartilage loss (35/47, 74.5 %), effusion (33/42, 78.6 %), synovitis (29/44, 66 %), and bone marrow oedema pattern (BMEP) (average cross-sectional area 885.7 ± 730.2 mm{sup 2}). Total hip arthroplasty (THA) was required in 16/35 patients, at an average of 6 months post-MRI. Compared to the THA cohort, the non-THA group had significantly (p < 0.05) smaller overlying cartilage defect size (10 mm vs. 29 mm), smaller band length ratio and fracture diameters, and greater incidence of parallel fracture morphology (p < 0.05). Male gender and increased age were significantly associated with progression, p < 0.05. SIF were associated with synovitis, cartilage loss, effusion, and BMEP. Male gender and increased age had a significant association with progression to THA, as did band length ratio, fracture diameter, cartilage defect size, and fracture deformity/morphology. (orig.)

  7. Qualitative and Quantitative Evaluation of Multi-source Piroxicam ...

    African Journals Online (AJOL)

    The qualitative and quantitative evaluation of eleven brands of piroxicam capsules marketed in Nigeria is presented. The disintegration time, dissolution rate and absolute drug content were determined in simulated intestinal fluid (SIF) and simulated gastric fluid (SGF) without enzymes. Weight uniformity test was also ...

  8. Oxygen transmittance correction for solar-induced chlorophyll fluorescence measured on proximal sensing: application to the NASA-GSFC fusion tower

    Science.gov (United States)

    Since oxygen (O2) absorption of light becomes more pronounced at higher pressure levels, even a few meters distance between the target and the sensor can strongly affect canopy leaving Solar-Induced chlorophyll Fluorescence (SIF) retrievals. This study was conducted to quantify the consequent error ...

  9. FluorWPS: A Monte Carlo ray-tracing model to compute sun-induced chlorophyll fluorescence of three-dimensional canopy

    Science.gov (United States)

    A model to simulate radiative transfer (RT) of sun-induced chlorophyll fluorescence (SIF) of three-dimensional (3-D) canopy, FluorWPS, was proposed and evaluated. The inclusion of fluorescence excitation was implemented with the ‘weight reduction’ and ‘photon spread’ concepts based on Monte Carlo ra...

  10. The Use of Tomosynthesis in the Global Study of Knee Subchondral Insufficiency Fractures.

    Science.gov (United States)

    Nelson, Fred; Bokhari, Omaima; Oravec, Daniel; Kim, Woong; Flynn, Michael; Lumley, Catherine; McPhilamy, Austin; Yeni, Yener N

    2017-02-01

    Subchondral insufficiency fractures (SIF), previously termed spontaneous osteonecrosis of the knee, are marked by a sudden onset of severe pain. Other than the size of the lesion, prediction for progression to joint replacement is difficult. The objective was to determine if quantitative analysis of bone texture using digital tomosynthesis imaging would be useful in predicting more rapid progression to joint replacement. Tomosynthesis studies of 30 knees with documented SIF were quantified by fractal, mean intercept length (MIL), and line fraction deviation analyses. Fractal dimension, lacunarity, MIL, and line fraction deviation variables measured from these analyses were then correlated to short interval progression to joint replacement surgery. Higher odds for joint replacement were related to higher values of the standard deviation of slope lacunarity and to morphometric measures (eg, MIL). Using digital tomosynthesis images for bone texture assessment may help distinguish condylar bone response in SIF, potentially acting as a clinically relevant predictive tool. In the future, contrasting SIF to the more gradual long-term process of osteoarthritis, there may be a better understanding of the different mechanisms for the two conditions. Copyright © 2017 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.

  11. Evaluation of the use of a standard input function for compartment analysis of [123I]iomazenil data. Factors influencing the quantitative results

    International Nuclear Information System (INIS)

    Seike, Yujiro; Hashikawa, Kazuo; Oku, Naohiko

    2004-01-01

    Adoption of standard input function (SIF) has been proposed for kinetic analysis of receptor binding potential (BP), instead of invasive frequent arterial samplings. The purpose of this study was to assess the SIP method in quantitative analysis of [ 123 I]iomazenil (IMZ), a central benzodiazepine antagonist, for SPECT. SPECT studies were performed on 10 patients with cerebrovascular disease or Alzheimer disease. Intermittent dynamic SPECT scans were performed from 0 to 201 min after IMZ-injection. BPs calculated from SIFs obtained from normal volunteers (BP s ) were compared with those of individual arterial samplings (BP O ). Good correlations were shown between BP O s and BP S s in the 9 subjects, but maximum BP S s were four times larger than the corresponding BP O s in one case. There were no abnormal laboratory data in this patient, but the relative arterial input count in the late period was higher than the SIF. Simulation studies with modified input functions revealed that height in the late period can produce significant errors in estimated BPs. These results suggested that the simplified method with one-point arterial sampling and SIF can not be applied clinically. One additional arterial sampling in the late period may be useful. (author)

  12. Stress intensity factors for deep cracks emanating from the corner formed by a hole intersecting a plate surface

    Science.gov (United States)

    Mcgowan, J. J.; Smith, C. W.

    1976-01-01

    The stress intensity factors (SIFs) at the end points of flaws emanating from the corner formed by the intersection of a plate with a hole were determined using stress freezing photoelasticity and a numerical technique known as the Taylor series correction method to extract the SIF values from the photoelastic data. The geometries studied were crack depth to thickness ratios of about 0.2, 0.5, and 0.75; crack depth to crack length ratios of about 1.0 to 2.0; and crack length to hole radius ratios of about 0.5 to 2.0. The SIFs were determined at the intersection of the flaw border with the plate surface (KS) and with the edge of the hole (KH). It is shown that extension of a crack emanating from a corner of intersection of a hole with a plate under monotonically increasing load is not self-similar and that as the flaw depth increases, KH decreases and KS increases. Existing theories and design criteria significantly overestimate the SIF at both the hole and the surface except for shallow flaws at the hole and deep flaws at the surface.

  13. Impact of 3D Canopy Structure on Remote Sensing Vegetation Index and Solar Induced Chlorophyll Fluorescence

    Science.gov (United States)

    Zeng, Y.; Berry, J. A.; Jing, L.; Qinhuo, L.

    2017-12-01

    Terrestrial ecosystem plays a critical role in removing CO2 from atmosphere by photosynthesis. Remote sensing provides a possible way to monitor the Gross Primary Production (GPP) at the global scale. Vegetation Indices (VI), e.g., NDVI and NIRv, and Solar Induced Fluorescence (SIF) have been widely used as a proxy for GPP, while the impact of 3D canopy structure on VI and SIF has not be comprehensively studied yet. In this research, firstly, a unified radiative transfer model for visible/near-infrared reflectance and solar induced chlorophyll fluorescence has been developed based on recollision probability and directional escape probability. Then, the impact of view angles, solar angles, weather conditions, leaf area index, and multi-layer leaf angle distribution (LAD) on VI and SIF has been studied. Results suggest that canopy structure plays a critical role in distorting pixel-scale remote sensing signal from leaf-scale scattering. In thin canopy, LAD affects both of the remote sensing estimated GPP and real GPP, while in dense canopy, SIF variations are mainly due to canopy structure, instead of just due to physiology. At the microscale, leaf angle reflects the plant strategy to light on the photosynthesis efficiency, and at the macroscale, a priori knowledge of leaf angle distribution for specific species can improve the global GPP estimation by remote sensing.

  14. Towards a Solid Foundation of Using Remotely Sensed Solar-Induced Chlorophyll Fluorescence for Crop Monitoring and Yield Forecast

    Science.gov (United States)

    Chen, Y.; Sun, Y.; You, L.; Liu, Y.

    2017-12-01

    The growing demand for food production due to population increase coupled with high vulnerability to volatile environmental changes poses a paramount challenge for mankind in the coming century. Real-time crop monitoring and yield forecasting must be a key part of any solution to this challenge as these activities provide vital information needed for effective and efficient crop management and for decision making. However, traditional methods of crop growth monitoring (e.g., remotely sensed vegetation indices) do not directly relate to the most important function of plants - photosynthesis and therefore crop yield. The recent advance in the satellite remote sensing of Solar-Induced chlorophyll Fluorescence (SIF), an integrative photosynthetic signal from molecular origin and a direct measure of plant functions holds great promise for real-time monitoring of crop growth conditions and forecasting yields. In this study, we use satellite measurements of SIF from both the Global Ozone Monitoring Experiment-2 (GOME-2) onboard MetOp-A and the Orbiting Carbon Observatory-2 (OCO-2) satellites to estimate crop yield using both process-based and statistical models. We find that SIF-based crop yield well correlates with the global yield product Spatial Production Allocation Model (SPAM) derived from ground surveys for all major crops including maize, soybean, wheat, sorghum, and rice. The potential and challenges of using upcoming SIF satellite missions for crop monitoring and prediction will also be discussed.

  15. The Treatment of Complex Urethral Strictures Using Ventral Onlay ...

    African Journals Online (AJOL)

    Objectives: To compare the outcome of free onlay Buccal Mucosa Graft (BMG) with onlay penile Skin Island Flap (SIF) urethroplasty in the treatment of complex urethral strictures. Patients and Methods: A prospective comparative study was conducted at the Universitas Academic Hospital in Bloemfontein, South Africa.

  16. Noninvasive quantification of cerebral metabolic rate for glucose in rats using 18F-FDG PET and standard input function

    Science.gov (United States)

    Hori, Yuki; Ihara, Naoki; Teramoto, Noboru; Kunimi, Masako; Honda, Manabu; Kato, Koichi; Hanakawa, Takashi

    2015-01-01

    Measurement of arterial input function (AIF) for quantitative positron emission tomography (PET) studies is technically challenging. The present study aimed to develop a method based on a standard arterial input function (SIF) to estimate input function without blood sampling. We performed 18F-fluolodeoxyglucose studies accompanied by continuous blood sampling for measurement of AIF in 11 rats. Standard arterial input function was calculated by averaging AIFs from eight anesthetized rats, after normalization with body mass (BM) and injected dose (ID). Then, the individual input function was estimated using two types of SIF: (1) SIF calibrated by the individual's BM and ID (estimated individual input function, EIFNS) and (2) SIF calibrated by a single blood sampling as proposed previously (EIF1S). No significant differences in area under the curve (AUC) or cerebral metabolic rate for glucose (CMRGlc) were found across the AIF-, EIFNS-, and EIF1S-based methods using repeated measures analysis of variance. In the correlation analysis, AUC or CMRGlc derived from EIFNS was highly correlated with those derived from AIF and EIF1S. Preliminary comparison between AIF and EIFNS in three awake rats supported an idea that the method might be applicable to behaving animals. The present study suggests that EIFNS method might serve as a noninvasive substitute for individual AIF measurement. PMID:25966947

  17. A database to evaluate stress intensity factors of elbows with throughwall flaws under combined internal pressure and bending moment

    International Nuclear Information System (INIS)

    Chattopadhyay, J.; Dutta, B.K.; Kushwaha, H.S.; Mahajan, S.C.; Kakodkar, A.

    1993-01-01

    The advent of Leak-Before-Break (LBB) concept has replaced the traditional design basis event of Double Ended Guillotine Break (DEGB) in the design of primary heat transport (PHT) piping. The use of LBB concept requires postulation of largest credible cracks at highly stressed locations and demonstration of its stability under the maximum credible loading conditions. Stress analysis of PHT piping in nuclear power plants shows that the highly stressed piping components are normally elbows and branch tees. This necessitates detailed fracture mechanics evaluation of piping connections by computing Stress Intensity Factor (SIF) and/or J-integral. Simple analytical solutions for evaluation of SIF and J-integral for cracks in straight pipes are readily available in literature. However, the same type of solutions for elbows and tees are limited in open literature. In the present work, a database is generated to evaluate SIF for throughwall circumferential and longitudinal cracks under combined internal pressure and bending moment. Different parameters to characterise a cracked elbow are pipe factor (h), pipe bore radius to thickness ratio (r/t) and crack length. Another parameter (σ) is used to consider the relative magnitude of stresses due to internal pressure and remote bending moment. The database has been used to derive closed form expressions to evaluate SIF for elbow with cracks in terms of the aforementioned parameters. (author). 8 refs., 12 figs., 3 tabs

  18. Baltika tulevik on lõpuks kindlustatud? / Fredy-Edwin Esse

    Index Scriptorium Estoniae

    Esse, Fredy-Edwin

    2011-01-01

    13. juulil on Baltika aktsionärid KJK Fund Sicav-SIF, E.Miroglio S.A. ja East Capital Baltic Fund garanteerinud 4,63 miljoni täiendava aktsia märkimise ning lisaraha kaasamise ettevõttesse, kuid firma tulevikus ei saa ikkagi kindel olla. Graafik

  19. De første danske erfaringer med det mobile stofindtagelsesrum

    DEFF Research Database (Denmark)

    Axelsson, Anna Karin Irene; Hvam, Frank; Bonde, Maria

    2012-01-01

    Intravenous drug abuse is a major health concern. The National Board of Health estimates the number of injecting drug users (IDUs) in Denmark to be 13,000. Supervised injecting facilities (SIF) reduce the risk behaviour and bacterial infections and also increase the rate of detoxification and acc...

  20. Mapping the Conformation Space of Wildtype and Mutant H-Ras with a Memetic, Cellular, and Multiscale Evolutionary Algorithm.

    Directory of Open Access Journals (Sweden)

    Rudy Clausen

    2015-09-01

    Full Text Available An important goal in molecular biology is to understand functional changes upon single-point mutations in proteins. Doing so through a detailed characterization of structure spaces and underlying energy landscapes is desirable but continues to challenge methods based on Molecular Dynamics. In this paper we propose a novel algorithm, SIfTER, which is based instead on stochastic optimization to circumvent the computational challenge of exploring the breadth of a protein's structure space. SIfTER is a data-driven evolutionary algorithm, leveraging experimentally-available structures of wildtype and variant sequences of a protein to define a reduced search space from where to efficiently draw samples corresponding to novel structures not directly observed in the wet laboratory. The main advantage of SIfTER is its ability to rapidly generate conformational ensembles, thus allowing mapping and juxtaposing landscapes of variant sequences and relating observed differences to functional changes. We apply SIfTER to variant sequences of the H-Ras catalytic domain, due to the prominent role of the Ras protein in signaling pathways that control cell proliferation, its well-studied conformational switching, and abundance of documented mutations in several human tumors. Many Ras mutations are oncogenic, but detailed energy landscapes have not been reported until now. Analysis of SIfTER-computed energy landscapes for the wildtype and two oncogenic variants, G12V and Q61L, suggests that these mutations cause constitutive activation through two different mechanisms. G12V directly affects binding specificity while leaving the energy landscape largely unchanged, whereas Q61L has pronounced, starker effects on the landscape. An implementation of SIfTER is made available at http://www.cs.gmu.edu/~ashehu/?q=OurTools. We believe SIfTER is useful to the community to answer the question of how sequence mutations affect the function of a protein, when there is an

  1. Estimation of vegetation photosynthetic capacity from space-based measurements of chlorophyll fluorescence for terrestrial biosphere models.

    Science.gov (United States)

    Zhang, Yongguang; Guanter, Luis; Berry, Joseph A; Joiner, Joanna; van der Tol, Christiaan; Huete, Alfredo; Gitelson, Anatoly; Voigt, Maximilian; Köhler, Philipp

    2014-12-01

    Photosynthesis simulations by terrestrial biosphere models are usually based on the Farquhar's model, in which the maximum rate of carboxylation (Vcmax ) is a key control parameter of photosynthetic capacity. Even though Vcmax is known to vary substantially in space and time in response to environmental controls, it is typically parameterized in models with tabulated values associated to plant functional types. Remote sensing can be used to produce a spatially continuous and temporally resolved view on photosynthetic efficiency, but traditional vegetation observations based on spectral reflectance lack a direct link to plant photochemical processes. Alternatively, recent space-borne measurements of sun-induced chlorophyll fluorescence (SIF) can offer an observational constraint on photosynthesis simulations. Here, we show that top-of-canopy SIF measurements from space are sensitive to Vcmax at the ecosystem level, and present an approach to invert Vcmax from SIF data. We use the Soil-Canopy Observation of Photosynthesis and Energy (SCOPE) balance model to derive empirical relationships between seasonal Vcmax and SIF which are used to solve the inverse problem. We evaluate our Vcmax estimation method at six agricultural flux tower sites in the midwestern US using spaced-based SIF retrievals. Our Vcmax estimates agree well with literature values for corn and soybean plants (average values of 37 and 101 μmol m(-2)  s(-1) , respectively) and show plausible seasonal patterns. The effect of the updated seasonally varying Vcmax parameterization on simulated gross primary productivity (GPP) is tested by comparing to simulations with fixed Vcmax values. Validation against flux tower observations demonstrate that simulations of GPP and light use efficiency improve significantly when our time-resolved Vcmax estimates from SIF are used, with R(2) for GPP comparisons increasing from 0.85 to 0.93, and for light use efficiency from 0.44 to 0.83. Our results support the use of

  2. Theoretical Investigations of CO 2 and H 2 Sorption in an Interpenetrated Square-Pillared Metal–Organic Material

    KAUST Repository

    Pham, Tony

    2013-05-16

    Simulations of CO2 and H2 sorption and separation were performed in [Cu(dpa)2SiF6-i], a metal-organic material (MOM) consisting of an interpenetrated square grid of Cu2+ ions coordinated to 4,4′-dipyridylacetylene (dpa) rings and pillars of SiF6 2- ions. This class of water stable MOMs shows great promise in practical gas sorption/separation with especially high selectivity for CO2 and variable selectivity for other energy related gases. Simulated CO2 sorption isotherms and isosteric heats of adsorption, Qst, at ambient temperatures were in excellent agreement with the experimental measurements at all pressures considered. Further, it was observed that the Qst for CO2 increases as a function of uptake in [Cu(dpa)2SiF6-i]. This suggests that nascently sorbed CO2 molecules within a channel contribute to a more energetically favorable site for additional CO2 molecules, i.e., in stark contrast to typical behavior, sorbate intermolecular interactions enhance sorption energetics with increased loading. The simulated structure at CO2 saturation shows a loading with tight packing of 8 CO2 molecules per unit cell. The CO2 molecules can be seen alternating between a vertical and horizontal alignment within a channel, with each CO2 molecule coordinating to an equatorial fluorine MOM atom. Calculated H 2 sorption isotherms and Qst values were also in good agreement with the experimental measurements in [Cu(dpa)2SiF 6-i]. H2 saturation corresponds to 10 H2 molecules per unit cell for the studied structure. Moreover, there were two observed binding sites for hydrogen sorption in [Cu(dpa)2SiF 6-i]. Simulations of a 30:70 CO2/H2 mixture, typical of syngas, in [Cu(dpa)2SiF6-i] showed that the MOM exhibited a high uptake and selectivity for CO2. In addition, it was observed that the presence of H2O had a negligible effect on the CO2 uptake and selectivity in [Cu(dpa)2SiF6-i], as simulations of a mixture containing CO2, H2, and small amounts of CO, N2, and H2O produced comparable

  3. Contrasting Patterns of rDNA Homogenization within the Zygosaccharomyces rouxii Species Complex

    Science.gov (United States)

    Chand Dakal, Tikam; Giudici, Paolo; Solieri, Lisa

    2016-01-01

    Arrays of repetitive ribosomal DNA (rDNA) sequences are generally expected to evolve as a coherent family, where repeats within such a family are more similar to each other than to orthologs in related species. The continuous homogenization of repeats within individual genomes is a recombination process termed concerted evolution. Here, we investigated the extent and the direction of concerted evolution in 43 yeast strains of the Zygosaccharomyces rouxii species complex (Z. rouxii, Z. sapae, Z. mellis), by analyzing two portions of the 35S rDNA cistron, namely the D1/D2 domains at the 5’ end of the 26S rRNA gene and the segment including the internal transcribed spacers (ITS) 1 and 2 (ITS regions). We demonstrate that intra-genomic rDNA sequence variation is unusually frequent in this clade and that rDNA arrays in single genomes consist of an intermixing of Z. rouxii, Z. sapae and Z. mellis-like sequences, putatively evolved by reticulate evolutionary events that involved repeated hybridization between lineages. The levels and distribution of sequence polymorphisms vary across rDNA repeats in different individuals, reflecting four patterns of rDNA evolution: I) rDNA repeats that are homogeneous within a genome but are chimeras derived from two parental lineages via recombination: Z. rouxii in the ITS region and Z. sapae in the D1/D2 region; II) intra-genomic rDNA repeats that retain polymorphisms only in ITS regions; III) rDNA repeats that vary only in their D1/D2 domains; IV) heterogeneous rDNA arrays that have both polymorphic ITS and D1/D2 regions. We argue that an ongoing process of homogenization following allodiplodization or incomplete lineage sorting gave rise to divergent evolutionary trajectories in different strains, depending upon temporal, structural and functional constraints. We discuss the consequences of these findings for Zygosaccharomyces species delineation and, more in general, for yeast barcoding. PMID:27501051

  4. Multi-institutional MicroCT image comparison of image-guided small animal irradiators

    Science.gov (United States)

    Johnstone, Chris D.; Lindsay, Patricia; E Graves, Edward; Wong, Eugene; Perez, Jessica R.; Poirier, Yannick; Ben-Bouchta, Youssef; Kanesalingam, Thilakshan; Chen, Haijian; E Rubinstein, Ashley; Sheng, Ke; Bazalova-Carter, Magdalena

    2017-07-01

    To recommend imaging protocols and establish tolerance levels for microCT image quality assurance (QA) performed on conformal image-guided small animal irradiators. A fully automated QA software SAPA (small animal phantom analyzer) for image analysis of the commercial Shelley micro-CT MCTP 610 phantom was developed, in which quantitative analyses of CT number linearity, signal-to-noise ratio (SNR), uniformity and noise, geometric accuracy, spatial resolution by means of modulation transfer function (MTF), and CT contrast were performed. Phantom microCT scans from eleven institutions acquired with four image-guided small animal irradiator units (including the commercial PXi X-RAD SmART and Xstrahl SARRP systems) with varying parameters used for routine small animal imaging were analyzed. Multi-institutional data sets were compared using SAPA, based on which tolerance levels for each QA test were established and imaging protocols for QA were recommended. By analyzing microCT data from 11 institutions, we established image QA tolerance levels for all image quality tests. CT number linearity set to R 2  >  0.990 was acceptable in microCT data acquired at all but three institutions. Acceptable SNR  >  36 and noise levels  1.5 lp mm-1 for MTF  =  0.2) was obtained at all but four institutions due to their large image voxel size used (>0.275 mm). Ten of the eleven institutions passed the set QA tolerance for geometric accuracy (2000 HU for 30 mgI ml-1). We recommend performing imaging QA with 70 kVp, 1.5 mA, 120 s imaging time, 0.20 mm voxel size, and a frame rate of 5 fps for the PXi X-RAD SmART. For the Xstrahl SARRP, we recommend using 60 kVp, 1.0 mA, 240 s imaging time, 0.20 mm voxel size, and 6 fps. These imaging protocols should result in high quality images that pass the set tolerance levels on all systems. Average SAPA computation time for complete QA analysis for a 0.20 mm voxel, 400 slice Shelley phantom microCT data set

  5. New era of satellite chlorophyll fluorescence and soil moisture observations leads to advances in the predictive understanding of global terrestrial coupled carbon-water cycles

    Science.gov (United States)

    Qiu, B.; Xue, Y.; Fisher, J.; Guo, W.

    2017-12-01

    The terrestrial carbon cycle and water cycle are coupled through a multitude of connected processes among soil, roots, leaves, and the atmosphere. The strength and sensitivity of these couplings are not yet well known at the global scale, which contributes to uncertainty in predicting the terrestrial water and carbon budgets. For the first time, we now have synchronous, high fidelity, global-scale satellite observations of critical terrestrial carbon and water cycle components: sun-induced chlorophyll fluorescence (SIF) and soil moisture. We used these observations within the framework of a well-established global terrestrial biosphere model (Simplified Simple Biosphere Model version 2.0, SSiB2) to investigate carbon-water coupling processes. We updated SSiB2 to include a mechanistic representation of SIF and tested the sensitivity of model parameters to improve the simulation of both SIF and soil moisture with the ultimate objective of improving the first-order terrestrial carbon component, gross primary production (GPP). Although several vegetation parameters, such as leaf area index (LAI) and green leaf fraction, improved the simulated SIF, and several soil parameters, such as hydraulic conductivity, improved simulated soil moisture, their effects were mainly limited to their respective cycles. One parameter emerged as the key coupler between the carbon and water cycles: the wilting point. Updates to the wilting point significantly improved the simulations for both soil moisture and SIF, as well as GPP. This study demonstrates the value of synchronous global measurements of the terrestrial carbon and water cycles in improving the understanding of coupled carbon-water cycles.

  6. Study of multiplet structures of Mn4+ activated in fluoride crystals

    International Nuclear Information System (INIS)

    Novita, Mega; Honma, Tetsuo; Hong, Byungchul; Ohishi, Atsushi; Ogasawara, Kazuyoshi

    2016-01-01

    We investigated the optical properties of Mn 4+ in some fluoride crystals such as Cs 2 MnF 6 , Cs 2 GeF 6 , Rb 2 GeF 6 , Cs 2 SiF 6 , K 2 SiF 6 , Rb 2 MnF 6 , Rb 2 SiF 6 , K 2 GeF 6 , K 2 TiF 6 , Li 2 MnF 6 , Na 2 GeF 6 , Na 2 SiF 6 , and Na 2 TiF 6 based on the first-principle calculation using the discrete-variational multi-electron method. In order to estimate the lattice relaxation, we performed EXAFS measurement of Mn 4+ doped in K 2 SiF 6 , K 2 TiF 6 , and K 2 GeF 6 . The relaxation rates of A 2 BF 6 :Mn 4+ were fixed to be the above estimated values, 102.24%, 107.37% or 96.80% for crystal having Si, Ge, or Ti at the B cation site, respectively. In this work, we also considered some corrections such as configuration dependent correction and correlation correction to improve the theoretical energies. It has been shown that to reproduce multiplet energy levels quantitatively, the lattice relaxation is very important. On the other hand, for a qualitative prediction of the tendencies of the multiplet energies, the combination of lattice relaxation effect, configuration dependent correction, and correlation correction is effective. - Highlights: • Multiplet structures of A 2 BF 6 :Mn 4+ were calculated from first-principles. • Lattice relaxation was estimated based on EXAFS experiment. • Lattice relaxation is important to reproduce multiplet energies quantitatively. • CDC and CC are important to reproduce tendencies of multiplet energies.

  7. Chlorophyll fluorescence, photochemical reflective index and normalized difference vegetative index during plant senescence.

    Science.gov (United States)

    Cordon, Gabriela; Lagorio, M Gabriela; Paruelo, José M

    2016-07-20

    The relationship between the Photochemical Reflectance Index (PRI), Normalized Difference Vegetation Index (NDVI) and chlorophyll fluorescence along senescence was investigated in this work. Reflectance and radiance measurements were performed at canopy level in grass species presenting different photosynthetic metabolism: Avena sativa (C3) and Setaria italica (C4), at different stages of the natural senescence process. Sun induced-chlorophyll fluorescence at 760nm (SIF 760 ) and the apparent fluorescence yield (SIF 760 /a, with a=irradiance at time of measurement) were extracted from the radiance spectra of canopies using the Fraunhofer Line Discrimination-method. The photosynthetic parameters derived from Kautsky kinetics and pigment content were also calculated at leaf level. Whilst stand level NDVI patterns were related to changes in the structure of canopies and not in pigment content, stand level PRI patterns suggested changes both in terms of canopy and of pigment content in leaves. Both SIF 760 /a and Φ PSII decreased progressively along senescence in both species. A strong increment in NPQ was evident in A. sativa while in S. italica NPQ values were lower. Our most important finding was that two chlorophyll fluorescence signals, Φ PSII and SIF 760 /a, correlated with the canopy PRI values in the two grasses assessed, even when tissues at different ontogenic stages were present. Even though significant changes occurred in the Total Chlr/Car ratio along senescence in both studied species, significant correlations between PRI and chlorophyll fluorescence signals might indicate the usefulness of this reflectance index as a proxy of photosynthetic RUE, at least under the conditions of this study. The relationships between stand level PRI and the fluorescence estimators (Φ PSII and SIF 760 /a) were positive in both cases. Therefore, an increase in PRI values as in the fluorescence parameters would indicate higher RUE. Copyright © 2016 Elsevier GmbH. All

  8. Consistency Between Sun-Induced Chlorophyll Fluorescence and Gross Primary Production of Vegetation in North America

    Science.gov (United States)

    Zhang, Yao; Xiao, Xiangming; Jin, Cui; Dong, Jinwei; Zhou, Sha; Wagle, Pradeep; Joiner, Joanna; Guanter, Luis; Zhang, Yongguang; Zhang , Geli; hide

    2016-01-01

    Accurate estimation of the gross primary production (GPP) of terrestrial ecosystems is vital for a better understanding of the spatial-temporal patterns of the global carbon cycle. In this study,we estimate GPP in North America (NA) using the satellite-based Vegetation Photosynthesis Model (VPM), MODIS (Moderate Resolution Imaging Spectrometer) images at 8-day temporal and 500 meter spatial resolutions, and NCEP-NARR (National Center for Environmental Prediction-North America Regional Reanalysis) climate data. The simulated GPP (GPP (sub VPM)) agrees well with the flux tower derived GPP (GPPEC) at 39 AmeriFlux sites (155 site-years). The GPP (sub VPM) in 2010 is spatially aggregated to 0.5 by 0.5-degree grid cells and then compared with sun-induced chlorophyll fluorescence (SIF) data from Global Ozone Monitoring Instrument 2 (GOME-2), which is directly related to vegetation photosynthesis. Spatial distribution and seasonal dynamics of GPP (sub VPM) and GOME-2 SIF show good consistency. At the biome scale, GPP (sub VPM) and SIF shows strong linear relationships (R (sup 2) is greater than 0.95) and small variations in regression slopes ((4.60-5.55 grams Carbon per square meter per day) divided by (milliwatts per square meter per nanometer per square radian)). The total annual GPP (sub VPM) in NA in 2010 is approximately 13.53 petagrams Carbon per year, which accounts for approximately 11.0 percent of the global terrestrial GPP and is within the range of annual GPP estimates from six other process-based and data-driven models (11.35-22.23 petagrams Carbon per year). Among the seven models, some models did not capture the spatial pattern of GOME-2 SIF data at annual scale, especially in Midwest cropland region. The results from this study demonstrate the reliable performance of VPM at the continental scale, and the potential of SIF data being used as a benchmark to compare with GPP models.

  9. Modeling the influence of the BRDF characteristics of vegetation on the retrieval of solar-induced chlorophyll fluorescence under different illumination conditions

    Science.gov (United States)

    Liu, Xinjie; Liu, Liangyun

    2017-04-01

    The Fraunhofer Line Discrimination (FLD) principle is the main approach used for the retrieval of solar-induced chlorophyll fluorescence (SIF). The basic assumption of the FLD principle is that the apparent reflectance spectra without SIF in-filling are smooth in the region of the absorption bands. However, in fact, this assumption is not valid due to the so-called "direct radiation in-filling" effect caused by the non-linear contribution of direct and diffuse radiation at the oxygen absorption bands, which are widely used for ground-based SIF retrieval. In this study, we first analyzed the physical mechanism of the direct radiation in-filling effect on the oxygen absorption bands and found that the bias in the SIF retrieval caused by the direct radiation in-filling effect at the O2-A band was less than 20% based on the use of a simulated dataset. Secondly, we established a simple correction model of the direct radiation in-filling effect. We found that the direct radiation in-filling effect at the O2-A band was directly proportional to the difference between the reflectance of the direct and diffuse radiation, and that the coefficient of proportionality was well correlated with the diffuse-to-global radiation ratio in the form of a quadratic function. The coefficient of determination (R-squared) for this correlation was 0.97. Finally, the model was validated using both simulated and field datasets. The validation results show that the bias in the SIF retrieval caused by the direct radiation in-filling effect can be efficiently corrected using the model proposed in this paper. This study thus provides a possible approach to estimating and correcting for the direct radiation-infilling effect using prior knowledge of the BRDF characteristics of direct and diffuse radiation for specific targets.

  10. Lysosomal degradation of membrane lipids.

    Science.gov (United States)

    Kolter, Thomas; Sandhoff, Konrad

    2010-05-03

    The constitutive degradation of membrane components takes place in the acidic compartments of a cell, the endosomes and lysosomes. Sites of lipid degradation are intralysosomal membranes that are formed in endosomes, where the lipid composition is adjusted for degradation. Cholesterol is sorted out of the inner membranes, their content in bis(monoacylglycero)phosphate increases, and, most likely, sphingomyelin is degraded to ceramide. Together with endosomal and lysosomal lipid-binding proteins, the Niemann-Pick disease, type C2-protein, the GM2-activator, and the saposins sap-A, -B, -C, and -D, a suitable membrane lipid composition is required for degradation of complex lipids by hydrolytic enzymes. Copyright 2009 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  11. Effects of operating conditions and fuel properties on emission performance and combustion efficiency of a swirling fluidized-bed combustor fired with a biomass fuel

    International Nuclear Information System (INIS)

    Kuprianov, Vladimir I.; Kaewklum, Rachadaporn; Chakritthakul, Songpol

    2011-01-01

    This work reports an experimental study on firing 80 kg/h rice husk in a swirling fluidized-bed combustor (SFBC) using an annular air distributor as the swirl generator. Two NO x emission control techniques were investigated in this work: (1) air staging of the combustion process, and (2) firing rice husk as moisturized fuel. In the first test series for the air-staged combustion, CO, NO and C x H y emissions and combustion efficiency were determined for burning 'as-received' rice husk at fixed excess air of 40%, while secondary-to-primary air ratio (SA/PA) was ranged from 0.26 to 0.75. The effects of SA/PA on CO and NO emissions from the combustor were found to be quite weak, whereas C x H y emissions exhibited an apparent influence of air staging. In the second test series, rice husks with the fuel-moisture content of 8.4% to 35% were fired at excess air varied from 20% to 80%, while the flow rate of secondary air was fixed. Radial and axial temperature and gas concentration (O 2 , CO, NO) profiles in the reactor, as well as CO and NO emissions, are discussed for the selected operating conditions. The temperature and gas concentration profiles for variable fuel quality exhibited significant effects of both fuel-moisture and excess air. As revealed by experimental results, the emission of NO from this SFBC can be substantially reduced through moisturizing rice husk, while CO is effectively mitigated by injection of secondary air into the bed splash zone, resulting in a rather low emission of CO and high (over 99%) combustion efficiency of the combustor for the ranges of operating conditions and fuel properties.

  12. Stress induced martensite at the crack tip in NiTi alloys during fatigue loading

    Directory of Open Access Journals (Sweden)

    E. Sgambitterra

    2014-10-01

    Full Text Available Crack tip stress-induced phase transformation mechanisms in nickel-titanium alloys (NiTi were analyzed by Digital Image Correlation (DIC, under fatigue loads. In particular, Single Edge Crack (SEC specimens, obtained from a commercial pseudoelastic NiTi sheet, and an ad-hoc experimental setup were used, for direct measurements of the near crack tip displacement field by the DIC technique. Furthermore, a fitting procedure was developed to calculate the mode I Stress Intensity Factor (SIF, starting from the measured displacement field. Finally, cyclic tensile tests were performed at different operating temperature, in the range 298-338 K, and the evolution of the SIF was studied, which revealed a marked temperature dependence.

  13. Numerical and experimental analysis of the directional stability on crack propagation under biaxial stresses

    International Nuclear Information System (INIS)

    RodrIguez-MartInez, R; Urriolagoitia-Calderon, G; Urriolagoitia-Sosa, G; Hernandez-Gomez, L H; Merchan-Cruz, E A; RodrIguez-Canizo, R G; Sandoval-Pineda, J M

    2009-01-01

    In this paper, the case of Single Edge Notch (SEN) specimens subject to opening/compressive loading was analyzed; The loads are applied in several ratios to evaluate the influence of the specimen geometry, and the Stress Intensity Factor (SIF) K 1 values on the directional stability of crack propagation. The main purpose of this work is to evaluate the behaviour of the fracture propagation, when modifying the geometry of the SEN specimen and different relationships of load tension/compression are applied. Additionally, the precision of the numerical and experimental analysis is evaluated to determine its reliability when solving this type of problems. The specimens are subjected to biaxial opening/compression loading; both results (numerical and experimental) are compared in order to evaluate the condition of directional stability on crack propagation. Finally, an apparent transition point related to the length of specimens was identified, in which the behaviour of values of SIF changes for different loading ratios.

  14. Assessing boreal forest photosynthetic dynamics through space-borne measurements of greenness, chlorophyll fluorescence and model GPP

    Science.gov (United States)

    Walther, Sophia; Guanter, Luis; Voigt, Maximilian; Köhler, Philipp; Jung, Martin; Joiner, Joanna

    2015-04-01

    sophia.walther@gfz-potsdam.de The seasonality of photosynthesis of boreal forests is an essential driver of the terrestrial carbon, water and energy cycles. However, current carbon cycle model results only poorly represent interannual variability and predict very different magnitudes and timings of carbon fluxes between the atmosphere and the land surface (e.g. Jung et al. 2011, Richardson et al. 2012). Reflectance-based satellite measurements, which give an indication of the amount of green biomass on the Earth's surface, have so far been used as input to global carbon cycle simulations, but they have limitations as they are not directly linked to instantaneous photosynthesis. As an alternative, space-borne retrievals of sun-induced chlorophyll fluorescence (SIF) boast the potential to provide a direct indication of the seasonality of boreal forest photosynthetic activity and thus to improve carbon model performances. SIF is a small electromagnetic signal that is re-emitted from the photosystems in the chloroplasts, which results in a direct relationship to photosynthetic efficiency. In this contribution we examine the seasonality of the boreal forests with three different vegetation parameters, namely greenness, SIF and model simulations of gross primary production (gross carbon flux into the plants by photosynthesis, GPP). We use the enhanced vegetation index (EVI) to represent green biomass. EVI is calculated from NBAR MODIS reflectance measurements (0.05deg, 16 days temporal resolution) for the time from January 2007-May 2013. SIF data originate from GOME-2 measurements on board the MetOp-A satellite in a spatial resolution of 0.5deg for the time from 2007-2011 (Joiner et al. (2013), Köhler et al. (2014)). As a third data source, data-driven GPP model results are used for the time from 2006-2012 with 0.5deg spatial resolution. The method to quantify phenology developed by Gonsamo et al. (2013) is applied to infer the main phenological phases (greenup/onset of

  15. Simultaneous analysis of residual stress and stress intensity factor in a resist after UV-nanoimprint lithography based on electron moiré fringes

    International Nuclear Information System (INIS)

    Wang, Qinghua; Kishimoto, Satoshi

    2012-01-01

    In this study, the residual stress in a resist (PAK01) film and the stress intensity factor (SIF) of an induced crack are simultaneously estimated during ultraviolet nanoimprint lithography (UV-NIL) based on electron moiré fringes. A micro grid in a triangular arrangement on the resist film fabricated by UV-NIL is directly used as the model grid. Electron moiré fringes formed by the interference between the fabricated grid and the electron scan beam are used to measure the displacement distribution around the tip of a crack induced by the residual stress in the resist. The SIF of the crack is estimated using a displacement extrapolation method. The residual strain fields and the corresponding residual stress in the resist film far from the crack are determined and analyzed. This method is effective for evaluating the grid quality fabricated by the UV-NIL technique. (paper)

  16. Mechanism of Fatigue Crack Growth of Bridge Steel Structures

    Directory of Open Access Journals (Sweden)

    Zhu H.

    2016-12-01

    Full Text Available This study was carried out on the background of Sutong Bridge project based on fracture mechanics, aiming at analyzing the growth mechanism of fatigue cracks of a bridge under the load of vehicles. Stress intensity factor (SIF can be calculated by various methods. Three steel plates with different kinds of cracks were taken as the samples in this study. With the combination of finite element analysis software ABAQUS and the J integral method, SIF values of the samples were calculated. After that, the extended finite element method in the simulation of fatigue crack growth was introduced, and the simulation of crack growth paths under different external loads was analyzed. At last, we took a partial model from the Sutong Bridge and supposed its two dangerous parts already had fine cracks; then simulative vehicle load was added onto the U-rib to predict crack growth paths using the extended finite element method.

  17. Numerical and experimental analysis of the directional stability on crack propagation under biaxial stresses

    Energy Technology Data Exchange (ETDEWEB)

    RodrIguez-MartInez, R; Urriolagoitia-Calderon, G; Urriolagoitia-Sosa, G; Hernandez-Gomez, L H [Instituto Politecnico Nacional Seccion de Estudios de Posgrado e Investigacion (SEPI), Escuela Superior de IngenierIa Mecanica y Electrica (ESIME), Edificio 5. 2do Piso, Unidad Profesional Adolfo Lopez Mateos ' Zacatenco' Col. Lindavista, C.P. 07738, Mexico, D.F. (Mexico); Merchan-Cruz, E A; RodrIguez-Canizo, R G; Sandoval-Pineda, J M, E-mail: rrodriguezm@ipn.m, E-mail: urrio332@hotmail.co, E-mail: guiurri@hotmail.co, E-mail: luishector56@hotmail.co, E-mail: eamerchan@gmail.co, E-mail: ricname@hotmail.co, E-mail: jsandovalp@ipn.m [Instituto Politecnico Nacional Seccion de Estudios de Posgrado e Investigacion (SEPI), Escuela Superior de IngenierIa Mecanica y Electrica (ESIME). Unidad profesional, AZCAPOTZALCO, Av. de las Granjas No. 682, Col. Sta. Catarina Azcapotzalco, C.P. 02550, Mexico D.F. (Mexico)

    2009-08-01

    In this paper, the case of Single Edge Notch (SEN) specimens subject to opening/compressive loading was analyzed; The loads are applied in several ratios to evaluate the influence of the specimen geometry, and the Stress Intensity Factor (SIF) K{sub 1} values on the directional stability of crack propagation. The main purpose of this work is to evaluate the behaviour of the fracture propagation, when modifying the geometry of the SEN specimen and different relationships of load tension/compression are applied. Additionally, the precision of the numerical and experimental analysis is evaluated to determine its reliability when solving this type of problems. The specimens are subjected to biaxial opening/compression loading; both results (numerical and experimental) are compared in order to evaluate the condition of directional stability on crack propagation. Finally, an apparent transition point related to the length of specimens was identified, in which the behaviour of values of SIF changes for different loading ratios.

  18. Enhancement of in-vitro drug dissolution of ketoconazole for its optimal in-vivo absorption using Nanoparticles and Solid Dispersion forms of the drug

    Science.gov (United States)

    Syed, Mohammed Irfan

    Ketoconazole is one of the most widely prescribed oral antifungal drugs for the systemic treatment of various fungal infections. However, due its hydrophobic nature and poor solubility profiles in the gastro-intestinal fluids, variations in its bioavailability have been documented. Therefore, to enhance its dissolution in the biological fluids, this study was initiated to develop and evaluate Nanoparticles and Solid Dispersion forms of the drug. Nanoparticles of ketoconazole were developed by Wet Bead Milling technique using PVP-10k as the stabilizing material at a weight ratio of (2:1). Solid dispersion powder was prepared by Hot Melt method using PEG-8000 at a weight ratio of (1:2). A commercial product containing 200mg of ketoconazole tablet and pure drug powder were used as the control for comparison purposes. The dissolution studies were carried out in SGF, SIF, USP; and SIF with 0.2% sodium lauryl sulfate using the USP-II method for a 2 hours period. Physical characterizations were carried out using SEM, DSC, XRD and FTIR studies. Wet Bead Milling method yielded nanoparticles in the particles size range of (100-300nm.). First all samples were evaluated for their in-vitro dissolution in SGF at pH=1.2. After 15 minutes, the amounts of drug dissolved were observed to be 27% from both the pure powder and commercial tablet (control), 29% from solid dispersion and 100% from the Nanoparticles dosage form. This supports the fact that Nanoparticles had a strong influence on the dissolution rate of the drug and exhibited much faster dissolution of ketoconazole. When the same formulations were studied in the SIF, USP medium, the control formulation gave 3%, solid dispersion 8% and Nanoparticles 8% drug dissolution after 2 hours period. This could be because the weakly basic ketoconazole drug remained un-dissociated in the alkaline medium. Since this medium was unable to clearly distinguish the dissolution profiles from different formulation of the drug, the SIF solution

  19. Spectral intensities in cubic systems. I. Progressions based upon parity vibrational modes

    International Nuclear Information System (INIS)

    Acevedo, R.; Vasquez, S.O.; Meruane, T.; Poblete, V.; Pozo, J.

    1998-01-01

    The well-resolved emission and absorption spectra of centrosymmetric coordination compounds of the transition metal ions have been used widely to provide the experimental data against which to test theoretical models of vibronic intensities. With reference to the 2 E g → 4 A 2g luminescence transition, at a perfect octahedral site in Cs 2 SiF 6 , over than one hundred vibronic lines are observed with line widths of a few wavenumber spread over some 3000 cm -1 . This paper reports a through examination of both the electronic and vibrational factors, which influences the observed vibronic intensities of the various assigned and identified lines in the spectra of the MnF 6 2- complex ion in the Cs 2 SiF 6 cubic lattice. The origin and nature of higher order vibronic interactions are analysed on the basis of a symmetrized vibronic crystal field-ligand polarization model. (Author)

  20. Degradation and dielectric properties of sulfur hexafluoride

    International Nuclear Information System (INIS)

    Fluck, Eric

    1985-01-01

    Sparking potential of sulfur hexafluoride is studied as a function of its decomposition by electrical discharges. The analysis of the gas is performed by mass spectrometry. The quantity of products resulting from spark discharges as a function of charge transported is plotted for SO_2F_2, SiF_4, SOF_4; it shows a linear increase with charge transported. Production rates of fluoride gases strongly increase with quantity of water vapor present at the beginning of the spark discharges. Decomposition of the gas, even at high levels (20%) does not exhibit measurable variations of sparking potential (at constant pressure). Production of SiF_4 by degradation of glass walls by hydrofluoric acid produced by discharges shows the important role played by this acid in the decomposition of the gas. It is necessary to use a gas containing water impurities at a level as small as possible. (author)

  1. FRACTURE MECHANICS UNCERTAINTY ANALYSIS IN THE RELIABILITY ASSESSMENT OF THE REACTOR PRESSURE VESSEL: (2D SUBJECTED TO INTERNAL PRESSURE

    Directory of Open Access Journals (Sweden)

    Entin Hartini

    2016-06-01

    Full Text Available ABSTRACT FRACTURE MECHANICS UNCERTAINTY ANALYSIS IN THE RELIABILITY ASSESSMENT OF THE REACTOR PRESSURE VESSEL: (2D SUBJECTED TO INTERNAL PRESSURE. The reactor pressure vessel (RPV is a pressure boundary in the PWR type reactor which serves to confine radioactive material during chain reaction process. The integrity of the RPV must be guaranteed either  in a normal operation or accident conditions. In analyzing the integrity of RPV, especially related to the crack behavior which can introduce break to the reactor pressure vessel, a fracture mechanic approach should be taken for this assessment. The uncertainty of input used in the assessment, such as mechanical properties and physical environment, becomes a reason that the assessment is not sufficient if it is perfomed only by deterministic approach. Therefore, the uncertainty approach should be applied. The aim of this study is to analize the uncertainty of fracture mechanics calculations in evaluating the reliability of PWR`s reactor pressure vessel. Random character of input quantity was generated using probabilistic principles and theories. Fracture mechanics analysis is solved by Finite Element Method (FEM with  MSC MARC software, while uncertainty input analysis is done based on probability density function with Latin Hypercube Sampling (LHS using python script. The output of MSC MARC is a J-integral value, which is converted into stress intensity factor for evaluating the reliability of RPV’s 2D. From the result of the calculation, it can be concluded that the SIF from  probabilistic method, reached the limit value of  fracture toughness earlier than SIF from  deterministic method.  The SIF generated by the probabilistic method is 105.240 MPa m0.5. Meanwhile, the SIF generated by deterministic method is 100.876 MPa m0.5. Keywords: Uncertainty analysis, fracture mechanics, LHS, FEM, reactor pressure vessels   ABSTRAK ANALISIS KETIDAKPASTIAN FRACTURE MECHANIC PADA EVALUASI KEANDALAN

  2. Soudage de bois feuillus par friction rotationnelle

    OpenAIRE

    Belleville, Benoît

    2012-01-01

    Les différentes colles utilisées actuellement par l’industrie du meuble au Canada nécessitent des temps de polymérisation constituant un goulot dans la production des meubles et limitant l’atteinte de la production unitaire. Ces adhésifs synthétiques généralement issus de la pétrochimie nécessitent énormément d’énergie lors de leur confection. L’utilisation de connecteurs métalliques ou plastiques, quant à elle, limite les phases de découpage et sablage subséquentes. La présence d’adhésifs et...

  3. Stress intensities in flawed pressure vessels

    International Nuclear Information System (INIS)

    Smith, C.W.; Jolles, M.; Peters, W.H.

    1977-01-01

    A technique for determining the stess intensity factor (SIF) near pressure vessel flaws or cracks experimentally from photoelastic data for use in two-dimensional problems was developed in the 1950's. This technique was modified and extended to a variety of two-dimensional problems. The technique has been refined further and what has evolved may be regarded as a hybrid technique which affects a marriage between ''frozen stress'' photoelastic results and a simple least-squares digital computer program for estimating SIF values in three-dimensional problems. This technique, in its original modified form, has been shown to be applicable to a study of surface flaws and the applicability of the method to complex crack body geometries of current technological importance are discussed. The analytical foundations of the method are reviewed

  4. Two intestinal specific nuclear factors binding to the lactase-phlorizin hydrolase and sucrase-isomaltase promoters are functionally related oligomeric molecules

    DEFF Research Database (Denmark)

    Troelsen, J T; Mitchelmore, C; Sjöström, H

    1994-01-01

    Lactase-phlorizin hydrolase (LPH) and sucrase-isomaltase (SI) are enterocyte-specific gene products. The identification of regulatory cis-elements in the promoter of these two genes has enabled us to carry out comparative studies of the corresponding intestinal-specific nuclear factors (NF-LPH1...... and SIF1-BP). Electrophoretic mobility shift assays demonstrated that the two nuclear factors compete for binding on the same cis-elements. The molecular size of the DNA binding polypeptide is estimated to be approximately 50 kDa for both factors. In the native form the factors are found as 250 k......Da oligomeric complexes. Based on these results NF-LPH1 and SIF1-BP are suggested to be either identical or closely related molecules....

  5. Correlation of fracture parameters during onset of crack in middle tension specimen

    Directory of Open Access Journals (Sweden)

    M.S. Starvin

    2017-07-01

    Full Text Available The present study addresses the implementation of finite element analysis and the prediction of fracture parameters in a middle tension (MT specimen that was fabricated using AISI 4140 steel. The correlation of fracture parameters with external loads and crack sizes was investigated. A Finite Element code was developed to simulate the fracture model. The contour integral method was applied in the calculation of stress intensity factor and J-integral in the cracked specimen. The ASTM standard empirical formula was used to calculate the stress intensity factor (SIF and the numerical predictions were validated. A standard laboratory experiment was also carried out using the MT specimen to calculate the crack growth rate in this specific material. The SIF values were almost linear with external load but it was decreasing as the crack size increases. The crack requires minimum load for crack propagation as the crack size increases. Similarly the J-integral was accelerated with increase in crack size.

  6. Comparison between genetic fuzzy system and neuro fuzzy system to select oil wells for hydraulic fracturing; Comparacao entre genetic fuzzy system e neuro fuzzy system para selecao de pocos de petroleo para fraturamento hidraulico

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Antonio Orestes de Salvo [PETROBRAS, Rio de Janeiro, RJ (Brazil); Ferreira Filho, Virgilio Jose Martins [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil)

    2004-07-01

    The hydraulic fracture operation is wide used to increase the oil wells production and to reduce formation damage. Reservoir studies and engineer analysis are made to select the wells for this kind of operation. As the reservoir parameters have some diffuses characteristics, Fuzzy Inference Systems (SIF) have been tested for this selection processes in the last few years. This paper compares the performance of a neuro fuzzy system and a genetic fuzzy system used for hydraulic Fracture well selection, with knowledge acquisition from an operational data base to set the SIF membership functions. The training data and the validation data used were the same for both systems. We concluded that, in despite of the genetic fuzzy system would be a younger process, it got better results than the neuro fuzzy system. Another conclusion was that, as the genetic fuzzy system can work with constraints, the membership functions setting kept the consistency of variables linguistic values. (author)

  7. Qualidade de méis produzidos por apicultores e méis provenientes de entrepostos registrados no Serviço de Inspeção Federal

    Directory of Open Access Journals (Sweden)

    M.B.L. Silva

    2011-08-01

    Full Text Available This study was carried out to compare the physiochemical quality of honeys from beekeepers in northern Zona da Mata, MG, and honeys from warehouses registered at the Serviço de Inspeção Federal (SIF in the State of Minas Gerais. Physiochemical analysis involving 39 samples were done, with three samples from each of the 13 beekeepers and 18 samples from warehouses registered at SIF-MG. Differences in quality from the two origins occurred in: free acidity, ashes, hydroxymethylfurfural, apparent sucrose and insoluble solids, where honeys from warehouses were of better quality. In addition, for free acidity and insoluble solids, two samples from northern Zona da Mata showed values above the established by the Instrução Normativa n°11 relative to the year 2000, whereas the values for insoluble solids in 11 samples from northern Zona da Mata and 2 samples from warehouses were in disagreement with this legislation.

  8. Investigation of Stress Indices and Directional Loading of Eccentric Reducers

    International Nuclear Information System (INIS)

    Carter, R.; Wais, E.A.; Rodabaugh, E.C.

    2003-01-01

    OAK- B135 Engineering for fatigue is an essential concern in piping systems. Addressing this concern, the ASME Section III and ANSI B31.1 Codes provide stress indices and stress intensification factors (SIFs) to be used in the design and evaluation of Class 1, 2 and 3 systems. In recent research cosponsored by EPRI and the U.S. DOE, new test data have been developed for comparison with the ASME stress indices and SIFs. This report presents the results of fatigue tests on eccentric reducers, taking into account the directionality of the loading. As detailed in the report, the results can help to improve the evaluation of reducers and can help to reduce unnecessary conservatism in piping system design

  9. Probabilistic fracture failure analysis of nuclear piping containing defects using R6 method

    International Nuclear Information System (INIS)

    Lin, Y.C.; Xie, Y.J.; Wang, X.H.

    2004-01-01

    Failure analysis of in-service nuclear piping containing defects is an important subject in the nuclear power plants. Considering the uncertainties in various internal operating loadings and external forces, including earthquake and wind, flaw sizes, material fracture toughness and flow stress, this paper presents a probabilistic assessment methodology for in-service nuclear piping containing defects, which is especially designed for programming. A general sampling computation method of the stress intensity factor (SIF), in the form of the relationship between the SIF and the axial force, bending moment and torsion, is adopted in the probabilistic assessment methodology. This relationship has been successfully used in developing the software, Safety Assessment System of In-service Pressure Piping Containing Flaws (SAPP-2003), based on a well-known engineering safety assessment procedure R6. A numerical example is given to show the application of the SAPP-2003 software. The failure probabilities of each defect and the whole piping can be obtained by this software

  10. Bis[bis(3,5-diamino-1H-1,2,4-triazol-4-ium)copper(I)] tris(hexafluoridosilicate)

    OpenAIRE

    Marian Mys'kiv; Evgeny Goreshnik

    2010-01-01

    In the title compound, [Cu(C2H6N5)2]2(SiF6)3, the asymmetric unit is composed of one [Cu(HL)2]3+ cation (where L is 3,5-diamino-1,2,4-triazole) and one and a half SiF62− anions. The rather large positively charged guanazole ligand moiety promotes the low metal coordination number of 2 for the CuI atom. The compound was obtained using the electrochemical alternating-current technique starting from an ethanol–methanol solution of CuSiF6·4H2O and guanazole. In the cr...

  11. Identification of diacetonamine from soybean curd residue as a sporulation-inducing factor toward Bacillus spp.

    Science.gov (United States)

    Ikeda, Aki; Kim, Dongyeop; Hashidoko, Yasuyuki

    2017-12-01

    Under bioassay-guided investigation, a sporulation-inducing factor (SIF) toward Bacillus spp. was searched for in methanol (MeOH) extracts of soybean curd residues, and diacetonamine (1) was identified as the active compound. SIF was first isolated as a monoacetylated derivative (2, 4.1 mg from 655 g soybean curd residues), and its chemical structure was elucidated by field desorption mass spectrometry, electron ionization mass spectrometry, and nuclear magnetic resonance (NMR) analyses. After 48-h incubation, 40 µM diacetonamine hydrochloride (1b) exhibited sporulation-inducing activity with 35% sporulation frequency toward a Bacillus amyloliquefaciens wild-type strain (AHU 2170), whereas 40 µM diacetone acrylamide (3) showed 99% sporulation induction, which was much higher than that of 1b. Although Bacillus megaterium NBRC 15308 was sporulated by the treatment with 400 µM 1b with 36 and 70% sporulation frequency after 72- and 96-h incubation respectively, 3 at the same concentration showed only 2% sporulation after 72-h incubation. Hence, diacetonamine (1) was characterized as a genuine SIF from soybean curd residues, but it was uncertain whether 1 is a natural product or an artifact. Spores of B. amyloliquefaciens induced by 1b survived after treatment with heating at 95 °C for 10 min, also suggesting that 1 is genuine SIF in soybean curd residue. As sporulation induction is likely linked to activation of antibiotic production in some spore-forming Firmicutes bacteria, compound 1 would be a possible chemical tool to develop an effective fermentation technology in Bacillus species.

  12. Effect of composition of simulated intestinal media on the solubility of poorly soluble compounds investigated by design of experiments

    DEFF Research Database (Denmark)

    Madsen, Cecilie Maria; Feng, Kung-I; Leithead, Andrew

    2018-01-01

    The composition of the human intestinal fluids varies both intra- and inter-individually. This will influence the solubility of orally administered drug compounds, and hence, the absorption and efficacy of compounds displaying solubility limited absorption. The purpose of this study was to assess...... studies feasible compared to single SIF solubility studies. Applying this DoE approach will lead to a better understanding of the impact of intestinal fluid composition on the solubility of a given drug compound....

  13. Josephson tunnel junctions with ferromagnetic interlayer

    International Nuclear Information System (INIS)

    Weides, M.P.

    2006-01-01

    Superconductivity and ferromagnetism are well-known physical properties of solid states that have been widely studied and long thought about as antagonistic phenomena due to difference in spin ordering. It turns out that the combination of both superconductor and ferromagnet leads to a very rich and interesting physics. One particular example, the phase oscillations of the superconducting order parameter inside the ferromagnet, will play a major role for the devices discussed in this work. In this thesis, I present Josephson junctions with a thin Al 2 O 3 tunnel barrier and a ferromagnetic interlayer, i.e. superconductor-insulator-ferromagnet-superconductor (SIFS) stacks. The fabrication of junctions was optimized regarding the insulation of electrodes and the homogeneity of the current transport. The junctions were either in the 0 or π coupled ground state, depending on the thickness of the ferromagnetic layer and on temperature. The influence of ferromagnetic layer thickness on the transport properties and the coupling (0, π) of SIFS tunnel junctions was studied. Furthermore, using a stepped ferromagnetic layer with well-chosen thicknesses, I obtained the so-called 0-π Josephson junction. At a certain temperature this 0-π junction can be made perfectly symmetric. In this case the ground state corresponds to a vortex of supercurrent creating a magnetic flux which is a fraction of the magnetic flux quantum Φ 0 . Such structures allow to study the physics of fractional vortices and to build various electronic circuits based on them. The SIFS junctions presented here have an exponentially vanishing damping at T → 0. The SIFS technology developed within the framework of this work may be used to construct classical and quantum devices such as oscillators, memory cells and qubits. (orig.)

  14. An Empiric Linear Formula between the Internal Tetrahedron Symmetric Stretch Frequency and the Al Content in the Framework of KL Molecular Sieves

    Institute of Scientific and Technical Information of China (English)

    Nong Yue HE; Chun YANG; Jian Xin TANG; Peng Feng XIAO; Hong CHEN

    2003-01-01

    KL molecular sieves with different framework compositions were secondarily synthesized by substituting Si for Al with a solution of (NH4)2SiF6. The internal tetrahedron symmetric stretch frequency, at ν770 cm-1, is linear with the molar fraction of Al (XAl= Al/(Si+Al)) in the framework of KL samples: XAl = -7.309×10-3 (υ770-760) + 0.3242.

  15. Volcanic Eruption Observations from an Elevated Point of the Stromboli Using Thermal Infrared Hyperspectral Imaging

    Science.gov (United States)

    Morton, V.; Gagnon, M. A.; Marcotte, F.; Gouhier, M.; Smekens, J. F.

    2017-12-01

    Many urban areas are located near active volcanoes around the world. Therefore, scientific research on different indicators of imminent eruptions is carried out on an ongoing basis. Due to the hazardous and unpredictable behavior of volcanoes, remote sensing technologies are normally preferred for investigations. Over the years, the Telops Hyper-Cam, a high-performance infrared hyperspectral camera, has established itself as a reference tool for investigating gas clouds over large distances. In order to illustrate the benefits of standoff infrared hyperspectral imaging for characterizing volcanic processes, many different measurements were carried out from an elevated point ( 800 m) of the Stromboli volcano (Italy) by researchers from the Université Blaise-Pascal (Clermont-Ferrand, France). The Stromboli volcano is well known for its periodic eruptions of small magnitude containing various proportions of ash, lava and gases. Imaging was carried out at a relatively high spectral and spatial resolution before and during eruptions from the North-East (NE) craters. Both sulfur dioxide (SO2) and sulfur tetrafluoride (SiF4) could be successfully identified within the volcano's plume from their distinct spectral features. During the passive degassing phase, a total amount of 3.3 kg of SO2 and 0.8 g of SiF4 were estimated. A violent eruption from NE1 crater was then observed and a total of 45 g and and 7 g of SO2 and SiF4 were estimated respectively. These results are in good agreement with previous work using a UV-SO2 camera. Finally, a smaller eruption from NE2 crater was observed. Total amounts of 3 kg and 17 g of SO2 and SiF4 were estimated respectively. Quantitative chemical maps for both gases will be presented. The results show that standoff thermal infrared hyperspectral imaging provides unique insights for a better understanding of volcanic eruptions.

  16. Phase transition and luminescence properties from vapor etched silicon

    International Nuclear Information System (INIS)

    Aouida, S.; Saadoun, M.; Ben Saad, K.; Bessais, B.

    2006-01-01

    In this work, we present a study on the structure and photoluminescence (PL) properties of a non-conventional ammonium hexafluorosilicate (NH 4 ) 2 SiF 6 (white powder) obtained from HNO 3 /HF chemical vapor etching (CVE) of silicon wafers. The CVE method leads either to the formation of luminescent Porous Silicon (PS) or SiO x /Si-containing (NH 4 ) 2 SiF 6 depending on the experimental conditions. At specific conditions (i.e., HNO 3 / HF volume ratio > 1 / 4), the CVE technique can generate instead of PS, a (NH 4 ) 2 SiF 6 phase where SiO x /Si particles are embedded. The (NH 4 ) 2 SiF 6 marketed powder is not luminescent, while that obtained from silicon vapor-etching presents a noticeable intense and stable photoluminescence (PL), which was found to have mainly two shoulders at 1.98 and 2.1 eV. Two processes have been proposed to explain this PL property. First, the visible luminescence around 1.98 eV would come from silicon nanoparticles embedded in the powder, having a distribution size that does not allow SiO x species to influence their own PL. Second, the PL shoulder around 2.1 eV would originate from small silicon nanoparticles trapped in SiO x features, leading to oxide related states that may trap electrons or excitons, depending on the silicon nanoparticle size, wherein radiative recombination occurs. The PL shoulder could become broader at low temperatures suggesting the existence of radiative recombination in SiO x related defects

  17. Simulated rat intestinal fluid improves oral exposure prediction for poorly soluble compounds over a wide dose range

    Directory of Open Access Journals (Sweden)

    Joerg Berghausen

    2016-03-01

    Full Text Available Solubility can be the absorption limiting factor for drug candidates and is therefore a very important input parameter for oral exposure prediction of compounds with limited solubility. Biorelevant media of the fasted and fed state have been published for humans, as well as for dogs in the fasted state. In a drug discovery environment, rodents are the most common animal model to assess the oral exposure of drug candidates. In this study a rat simulated intestinal fluid (rSIF is proposed as a more physiologically relevant media to describe drug solubility in rats. Equilibrium solubility in this medium was tested as input parameter for physiologically-based pharmacokinetics (PBPK simulations of oral pharmacokinetics in the rat. Simulations were compared to those obtained using other solubility values as input parameters, like buffer at pH 6.8, human simulated intestinal fluid and a comprehensive dissolution assay based on rSIF. Our study on nine different compounds demonstrates that the incorporation of rSIF equilibrium solubility values into PBPK models of oral drug exposure can significantly improve the reliability of simulations in rats for doses up to 300 mg/kg compared to other media. The comprehensive dissolution assay may help to improve further simulation outcome, but the greater experimental effort as compared to equilibrium solubility may limit its use in a drug discovery environment. Overall, PBPK simulations based on solubility in the proposed rSIF medium can improve prioritizing compounds in drug discovery as well as planning dose escalation studies, e.g. during toxicological investigations.

  18. Design and Synthesis of Hybrid Ceramic Foams with Tailored Porosity

    OpenAIRE

    Capasso, Ilaria

    2017-01-01

    Alkali activated ceramic foams have been produced by using metakaolin and/or diatomite as aluminosilicate source, an aqueous sodium silicate solution as alkali activator and Na2SiF6 as a catalyst that promotes the gelification of the entire system. Two different techniques of direct foaming have been coupled, one based on chemical reactions with gas production and the other one based on a mechanical foaming. Then, other levels of hierarchical porosity (nanometric and macrometric scale) have b...

  19. Chlorophyll fluorescence tracks seasonal variations of photosynthesis from leaf to canopy in a temperate forest.

    Science.gov (United States)

    Yang, Hualei; Yang, Xi; Zhang, Yongguang; Heskel, Mary A; Lu, Xiaoliang; Munger, J William; Sun, Shucun; Tang, Jianwu

    2017-07-01

    Accurate estimation of terrestrial gross primary productivity (GPP) remains a challenge despite its importance in the global carbon cycle. Chlorophyll fluorescence (ChlF) has been recently adopted to understand photosynthesis and its response to the environment, particularly with remote sensing data. However, it remains unclear how ChlF and photosynthesis are linked at different spatial scales across the growing season. We examined seasonal relationships between ChlF and photosynthesis at the leaf, canopy, and ecosystem scales and explored how leaf-level ChlF was linked with canopy-scale solar-induced chlorophyll fluorescence (SIF) in a temperate deciduous forest at Harvard Forest, Massachusetts, USA. Our results show that ChlF captured the seasonal variations of photosynthesis with significant linear relationships between ChlF and photosynthesis across the growing season over different spatial scales (R 2  = 0.73, 0.77, and 0.86 at leaf, canopy, and satellite scales, respectively; P chlorophyll content (R 2  = 0.65 for canopy GPP SIF and chlorophyll content; P < 0.0001), leaf area index (LAI) (R 2  = 0.35 for canopy GPP SIF and LAI; P < 0.0001), and normalized difference vegetation index (NDVI) (R 2  = 0.36 for canopy GPP SIF and NDVI; P < 0.0001). Our results suggest that ChlF can be a powerful tool to track photosynthetic rates at leaf, canopy, and ecosystem scales. © 2016 John Wiley & Sons Ltd.

  20. Josephson tunnel junctions with ferromagnetic interlayer

    Energy Technology Data Exchange (ETDEWEB)

    Weides, M.P.

    2006-07-01

    Superconductivity and ferromagnetism are well-known physical properties of solid states that have been widely studied and long thought about as antagonistic phenomena due to difference in spin ordering. It turns out that the combination of both superconductor and ferromagnet leads to a very rich and interesting physics. One particular example, the phase oscillations of the superconducting order parameter inside the ferromagnet, will play a major role for the devices discussed in this work. In this thesis, I present Josephson junctions with a thin Al{sub 2}O{sub 3} tunnel barrier and a ferromagnetic interlayer, i.e. superconductor-insulator-ferromagnet-superconductor (SIFS) stacks. The fabrication of junctions was optimized regarding the insulation of electrodes and the homogeneity of the current transport. The junctions were either in the 0 or {pi} coupled ground state, depending on the thickness of the ferromagnetic layer and on temperature. The influence of ferromagnetic layer thickness on the transport properties and the coupling (0, {pi}) of SIFS tunnel junctions was studied. Furthermore, using a stepped ferromagnetic layer with well-chosen thicknesses, I obtained the so-called 0-{pi} Josephson junction. At a certain temperature this 0-{pi} junction can be made perfectly symmetric. In this case the ground state corresponds to a vortex of supercurrent creating a magnetic flux which is a fraction of the magnetic flux quantum {phi}{sub 0}. Such structures allow to study the physics of fractional vortices and to build various electronic circuits based on them. The SIFS junctions presented here have an exponentially vanishing damping at T {yields} 0. The SIFS technology developed within the framework of this work may be used to construct classical and quantum devices such as oscillators, memory cells and qubits. (orig.)

  1. Targeting PRMT5 as a Novel Radiosensitization Approach for Primary and Recurrent Prostate Cancer Treatment

    Science.gov (United States)

    2016-10-01

    pressor programmed cell death 4, Cancer Res. 71 (2011) 5579–5587. [8] C. Nicholas , J. Yang, S.B. Peters, M.A. Bill, R.A. Baiocchi, F. Yan, S. Sif, S...Biochim. Biophys. Acta 1839 (2014) 1330–1340. [13] C.M. Koh, M. Bezzi, D.H. Low, W.X. Ang, S.X. Teo, F.P. Gay, M. Al-Haddawi, S.Y. Tan , M. Osato, A. Sabo

  2. Oxidation of refractory sulfur compounds over Ti-containing mesoporous molecular sieves prepared by using a fluorosilicon compound.

    Science.gov (United States)

    Jeong, Kwang-Eun; Cho, Chin-Soo; Chae, Ho-Jeong; Kim, Chul-Ung; Jeong, Soon-Yong

    2010-05-01

    Titanium containing mesoporous molecular sieve (Ti-MMS) catalysts were studied for the oxidative desulfurization of refractory sulfur compounds. Ti-MMS catalysts were synthesized from fluorosilicon compounds and Ti with the hydrolysis reaction of H2SiF6 in an ammonia-surfactant mixed solution. The solid products were characterized by XRD, XRF, nitrogen adsorption, and diffuse reflectance UV-vis spectroscopy. Effects of Ti loading and oxidant/sulfur mole ratio, and sulfur species on ODS activity were investigated.

  3. Evidence of chromaffin oxygen sensing in neuroblastoma.

    Science.gov (United States)

    Hedborg, F; Franklin, G; Norrman, J; Grimelius, L; Wassberg, E; Hero, B; Schilling, F; Berthold, F; Harms, D; Sandstedt, B

    2001-01-01

    With the aid of IGF2 and VEGF in situ hybridization; tyrosine hydroxylase, chromogranin A, and Ki67 immunohistochemistry; and TUNEL staining applied to a large series of clinical neuroblastomas and to an animal model, we show here that stroma-poor neuroblastomas show evidence of chromaffin differentiation similar to that of type 1 small intensely fluorescent (SIF) cells and that this occurs in a vascular-dependent fashion, indicating a role for local tumor hypoxia in the differentiation process.

  4. Genome-Wide Search for Genes Required for Bifidobacterial Growth under Iron-Limitation

    Science.gov (United States)

    Lanigan, Noreen; Bottacini, Francesca; Casey, Pat G.; O'Connell Motherway, Mary; van Sinderen, Douwe

    2017-01-01

    Bacteria evolved over millennia in the presence of the vital micronutrient iron. Iron is involved in numerous processes within the cell and is essential for nearly all living organisms. The importance of iron to the survival of bacteria is obvious from the large variety of mechanisms by which iron may be acquired from the environment. Random mutagenesis and global gene expression profiling led to the identification of a number of genes, which are essential for Bifidobacterium breve UCC2003 survival under iron-restrictive conditions. These genes encode, among others, Fe-S cluster-associated proteins, a possible ferric iron reductase, a number of cell wall-associated proteins, and various DNA replication and repair proteins. In addition, our study identified several presumed iron uptake systems which were shown to be essential for B. breve UCC2003 growth under conditions of either ferric and/or ferrous iron chelation. Of these, two gene clusters encoding putative iron-uptake systems, bfeUO and sifABCDE, were further characterised, indicating that sifABCDE is involved in ferrous iron transport, while the bfeUO-encoded transport system imports both ferrous and ferric iron. Transcription studies showed that bfeUO and sifABCDE constitute two separate transcriptional units that are induced upon dipyridyl-mediated iron limitation. In the anaerobic gastrointestinal environment ferrous iron is presumed to be of most relevance, though a mutation in the sifABCDE cluster does not affect B. breve UCC2003's ability to colonise the gut of a murine model. PMID:28620359

  5. Genome-Wide Search for Genes Required for Bifidobacterial Growth under Iron-Limitation

    Directory of Open Access Journals (Sweden)

    Noreen Lanigan

    2017-05-01

    Full Text Available Bacteria evolved over millennia in the presence of the vital micronutrient iron. Iron is involved in numerous processes within the cell and is essential for nearly all living organisms. The importance of iron to the survival of bacteria is obvious from the large variety of mechanisms by which iron may be acquired from the environment. Random mutagenesis and global gene expression profiling led to the identification of a number of genes, which are essential for Bifidobacterium breve UCC2003 survival under iron-restrictive conditions. These genes encode, among others, Fe-S cluster-associated proteins, a possible ferric iron reductase, a number of cell wall-associated proteins, and various DNA replication and repair proteins. In addition, our study identified several presumed iron uptake systems which were shown to be essential for B. breve UCC2003 growth under conditions of either ferric and/or ferrous iron chelation. Of these, two gene clusters encoding putative iron-uptake systems, bfeUO and sifABCDE, were further characterised, indicating that sifABCDE is involved in ferrous iron transport, while the bfeUO-encoded transport system imports both ferrous and ferric iron. Transcription studies showed that bfeUO and sifABCDE constitute two separate transcriptional units that are induced upon dipyridyl-mediated iron limitation. In the anaerobic gastrointestinal environment ferrous iron is presumed to be of most relevance, though a mutation in the sifABCDE cluster does not affect B. breve UCC2003's ability to colonise the gut of a murine model.

  6. Evidence of a robust relationship between solar-induced chlorophyll fluorescence and gross primary productivity across dryland ecosystems of southwestern North America

    Science.gov (United States)

    Smith, W. K.; Biederman, J. A.; Scott, R. L.; Moore, D. J.; Kimball, J. S.; He, M.; Yan, D.; Hudson, A.; Barnes, M.; MacBean, N.; Fox, A. M.; Litvak, M. E.

    2017-12-01

    Satellite remote sensing provides unmatched spatiotemporal information on multiple facets of vegetation dynamics including seasonal to interannual total photosynthesis, termed gross primary productivity (GPP). Yet, our understanding of the relationship between GPP and remote sensing observations - and how this relationship changes with scale, biophysical constraint, vegetation type, etc. - remains limited. This knowledge gap is especially apparent for dryland ecosystems, which have high spatial and temporal variability and are under-represented by long-term, continuous field measurements. Here, utilizing a new synthesis of eddy covariance flux tower data for southwestern North America, we present a first assessment of the ability of novel satellite remote sensing vegetation proxies to accurately capture seasonal to interannual GPP dynamics across the region. We evaluate the greenness-based Enhanced Vegetation Index (EVI) and emerging proxies linked to plant physiological function, Solar-Induced Fluorescence (SIF) and Photochemical Reflectivity Index (PRI). We find that SIF observations more consistently correlate with seasonal GPP dynamics (R = 0.90) compared to EVI (R = 0.85) and PRI (R = 0.78). More, we find that SIF observations are also more sensitive to interannual GPP variability (linear slope = 0.80) relative to EVI (linear slope = 0.63) and PRI (linear slope = 0.35). This is likely due to increased sensitivity of SIF to GPP during periods of decoupling between greenness and photosynthesis due to water-limitation / stomatal closure. Conversely, EVI and PRI observations better capture spatial GPP variability between flux tower sites. These results suggest that combinations of these independent vegetation growth proxies could yield synergistic improvements in satellite-based GPP estimates.

  7. Imaging and histopathological evaluation of a cystlike formation in subchondral insufficiency fracture of the femoral head: A case report and literature review.

    Science.gov (United States)

    Fukui, Kiyokazu; Kaneuji, Ayumi; Fukushima, Mana; Matsumoto, Tadami

    2014-01-01

    In the majority of subchondral insufficiency fractures (SIFs) of the femoral head, T1-weighted magnetic resonance imaging shows an irregular, serpiginous, low-intensity band that is convex to the articular surface. We report a case of a cystlike formation in SIF of the femoral head in an elderly woman. A 71-year-old woman reported right hip pain without any history of antecedent trauma. The initial radiograph showed a slight narrowing of the joint space in the right hip. The patient was treated with conservative therapy for 2 months. Radiographs obtained 3 months after the onset of pain showed non-progressive joint-space narrowing. T1-weighted magnetic resonance images obtained 2 months after pain onset revealed a round, cystlike, low-intensity area just beneath the articular cartilage. The patient underwent total hip arthroplasty. Histopathological examination showed fracture callus and granulation tissue in the subchondral area, surrounded by vascular-rich granulation tissue and fibrous tissue, which corresponded to the round, low-intensity band observed on the T1-weighted image. This case was a rare SIF of the femoral head which had a cystlike formation with a low signal intensity on T1-weighted images and a very high signal intensity on STIR sequences in the superolateral portion of the femoral head, surrounded by a pattern of edema in the bone marrow. To our knowledge, no similar cases were cited in the literature. It is important for surgeons to keep in mind that sometimes SIFs of the femoral head can appear as a round cystlike formation. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  8. The Creep of Frozen Sands: Qualitative and Quantitative Models.

    Science.gov (United States)

    1981-03-01

    values. / Accession For ?PTIS GFRA&l DTIC TAB El Unannounced 0 justificatio B y Di stribution/ Availabilit " Cr4c Dist Unclassified SCCUI CL AS SIF ICA...for his support throughout the project; and Al Tice, for carrying out the NMR unfrozen water content determinations. Also, I thank the undergraduate...Results of Creep Tests on Glass Beads ................. 296 A.4 Results of Unfrozen Water Content Determinations of MS-M Glass Beads

  9. Numerical simulation of flow over bariers in complex terrain

    Czech Academy of Sciences Publication Activity Database

    Bodnár, Tomáš; Beneš, L.; Kozel, Karel

    2008-01-01

    Roč. 31, 5-6 (2008), s. 619-632 ISSN 1124-1896 R&D Projects: GA AV ČR 1ET400760405 Institutional research plan: CEZ:AV0Z20760514 Keywords : boundary layer * complex terrain * finite difference Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.277, year: 2008 http://prometeo.sif.it:8080/papers/?pid=ncc9331

  10. Pengaruh Perbedaan Jenis Asam dan Waktu Demineralisasi pada Nilai Rendemen dan Sifat Fisiko Kimia Gelatin Tulang Sapi Bali.

    OpenAIRE

    Ramadani, Dewi

    2014-01-01

    2014 Dewi Ramadani (I 411 10 267). Pengaruh Perbedaan Jenis Asam dan Waktu Demineralisasi pada Nilai Rendemen dan Sifat Fisiko Kimia Gelatin Tulang Sapi Bali. Muhammad Irfan Said Sebagai Pembimbing Utama dan Farida Nur Yuliati Sebagai Pembimbing Anggota. Gelatin merupakan senyawa hasil hidrolisis serabut kolagen secara persial. Tujuan dari penelitian ini adalah untuk melihat pengaruh jenis larutan dan waktu demineralisasi pada nilai rendemen dan sif...

  11. Variability of sun-induced chlorophyll fluorescence according to stand age-related processes in a managed loblolly pine forest.

    Science.gov (United States)

    Colombo, Roberto; Celesti, Marco; Bianchi, Remo; Campbell, Petya K E; Cogliati, Sergio; Cook, Bruce D; Corp, Lawrence A; Damm, Alexander; Domec, Jean-Christophe; Guanter, Luis; Julitta, Tommaso; Middleton, Elizabeth M; Noormets, Asko; Panigada, Cinzia; Pinto, Francisco; Rascher, Uwe; Rossini, Micol; Schickling, Anke

    2018-02-20

    Leaf fluorescence can be used to track plant development and stress, and is considered the most direct measurement of photosynthetic activity available from remote sensing techniques. Red and far-red sun-induced chlorophyll fluorescence (SIF) maps were generated from high spatial resolution images collected with the HyPlant airborne spectrometer over even-aged loblolly pine plantations in North Carolina (United States). Canopy fluorescence yield (i.e., the fluorescence flux normalized by the light absorbed) in the red and far-red peaks was computed. This quantifies the fluorescence emission efficiencies that are more directly linked to canopy function compared to SIF radiances. Fluorescence fluxes and yields were investigated in relation to tree age to infer new insights on the potential of those measurements in better describing ecosystem processes. The results showed that red fluorescence yield varies with stand age. Young stands exhibited a nearly twofold higher red fluorescence yield than mature forest plantations, while the far-red fluorescence yield remained constant. We interpreted this finding in a context of photosynthetic stomatal limitation in aging loblolly pine stands. Current and future satellite missions provide global datasets of SIF at coarse spatial resolution, resulting in intrapixel mixture effects, which could be a confounding factor for fluorescence signal interpretation. To mitigate this effect, we propose a surrogate of the fluorescence yield, namely the Canopy Cover Fluorescence Index (CCFI) that accounts for the spatial variability in canopy structure by exploiting the vegetation fractional cover. It was found that spatial aggregation tended to mask the effective relationships, while the CCFI was still able to maintain this link. This study is a first attempt in interpreting the fluorescence variability in aging forest stands and it may open new perspectives in understanding long-term forest dynamics in response to future climatic

  12. Fat-suppressed T2-weighted MRI appearance of subchondral insufficiency fracture of the femoral head

    Energy Technology Data Exchange (ETDEWEB)

    Sonoda, Kazuhiko; Yamamoto, Takuaki; Motomura, Goro; Karasuyama, Kazuyuki; Kubo, Yusuke; Iwamoto, Yukihide [Kyushu University, Department of Orthopaedic Surgery, Graduate School of Medical Sciences, Higashi-ku, Fukuoka (Japan)

    2016-11-15

    Our aims were to investigate the imaging appearance of subchondral insufficiency fracture (SIF) of the femoral head based on fat-suppressed T2-weighted MRI, and evaluate its correlation with the clinical outcomes following conservative treatment. We retrospectively evaluated 40 hips in 37 patients with SIF of the femoral head (12 males and 25 females; mean age 55.8 years, range 22-78 years). MRI examinations were performed within 3 months after the onset of hip pain. Using fat-suppressed T2-weighted imaging, we evaluated the hips for the intensity of the subchondral bone (corresponding to the area superior to the low intensity band on T1-weighted images) as well as bone marrow edema, joint effusion, and presence of the band lesion. We then correlated the intensity of the subchondral bone with clinical outcomes. The hips were classified into three types based on subchondral intensity on fat-suppressed T2-weighted images: type 1 (21 hips) showed high intensity, type 2 (eight hips) showed heterogeneous intensity, and type 3 (11 hips) showed low intensity. The mean period between pain onset and MRI examination was significantly longer for type 2 hips than for type 1. Healing rates were 86 % for type 1, 75 % for type 2, and 18 % for type 3. SIF cases were classified into three types based on subchondral intensity on fat-suppressed T2-weighted imaging performed within 3 months after pain onset. Type 3 SIF tended to be intractable to conservative treatment compared to type 1 and type 2. (orig.)

  13. Photoionization of atoms and small molecules using synchrotron radiation

    International Nuclear Information System (INIS)

    Ferrett, T.A.

    1986-11-01

    The combination of synchrotron radiation and time-of-flight electron spectroscopy has been used to study the photoionization dynamics of atoms (Li) and small molecules (SF 6 , SiF 4 , and SO 2 ). Partial cross sections and angular distribution asymmetry parameters have been measured for Auger electrons and photoelectrons as functions of photon energy. Emphasis is on the basic understanding of electron correlation and resonant effects as manifested in the photoemission spectra for these systems. 254 refs., 46 figs., 10 tabs

  14. Hydrometallurgical extraction of Al and Si from kaolinitic clays

    Directory of Open Access Journals (Sweden)

    Eliana G. Pinna

    Full Text Available Abstract Herein is presented the results of a study on the hydrometallurgic extraction and recovery of aluminum and silicon by leaching of kaolinitic clays with HF. The studied extraction parameters were: temperature, reaction time, solid/liquid ratio, concentration, and precipitating agent mass. In the leaching process, mineral dissolutions near 100% were obtained when working at 348 K, solid/liquid ratio 2% w/v, HF 12% v/v, for 120 minutes. The HF leach liquor generated from the dissolution of kaolinitic clays contains H2SiF6and H3AlF6. Studies were conducted to recover the two valuable fluorides as K2SiF6and Na3AlF6by precipitation with alkaline salts from the leach liquor. Phases of precipitated fluorides were identified by XRD and surface morphology by SEM. The purity of the K2SiF6precipitate was 98.8%, whereas for Na3AlF6, it was 89.3%. Also, both synthesized solids are of high commercial value due to their industrial applications.

  15. Impact of proof test interval and coverage on probability of failure of safety instrumented function

    International Nuclear Information System (INIS)

    Jin, Jianghong; Pang, Lei; Hu, Bin; Wang, Xiaodong

    2016-01-01

    Highlights: • Introduction of proof test coverage makes the calculation of the probability of failure for SIF more accurate. • The probability of failure undetected by proof test is independently defined as P TIF and calculated. • P TIF is quantified using reliability block diagram and simple formula of PFD avg . • Improving proof test coverage and adopting reasonable test period can reduce the probability of failure for SIF. - Abstract: Imperfection of proof test can result in the safety function failure of safety instrumented system (SIS) at any time in its life period. IEC61508 and other references ignored or only elementarily analyzed the imperfection of proof test. In order to further study the impact of the imperfection of proof test on the probability of failure for safety instrumented function (SIF), the necessity of proof test and influence of its imperfection on system performance was first analyzed theoretically. The probability of failure for safety instrumented function resulted from the imperfection of proof test was defined as probability of test independent failures (P TIF ), and P TIF was separately calculated by introducing proof test coverage and adopting reliability block diagram, with reference to the simplified calculation formula of average probability of failure on demand (PFD avg ). Research results show that: the shorter proof test period and the higher proof test coverage indicate the smaller probability of failure for safety instrumented function. The probability of failure for safety instrumented function which is calculated by introducing proof test coverage will be more accurate.

  16. Publication rates following pancreas meetings.

    Science.gov (United States)

    Timmer, A; Blum, T; Lankisch, P G

    2001-08-01

    Publication rates and determinants of publication were studied based on abstracts presented at pancreatic meetings. All abstracts presented at the 1994 and 1995 annual meetings of the European Pancreatic Club (EPC) and the American Pancreatic Association (APA) were followed up by searching MEDLINE. Publication rates were compared using log-rank tests and multiple logistic regression. The prestige of the publishing journals was compared using Kruskal-Wallis tests on scientific impact factors (SIF). Overall, 340 abstracts were presented at the EPC, and 254 were presented at the APA. Of these, 203 (59.7%, EPC) and 138 (54.3%, APA) were later published in peer-reviewed journals. Publication rates did not differ by study type or country region of origin. In addition, median SIFs were similar by conference (APA vs. EPC) and research type (basic science vs. clinical studies) (overall, 1.7). However, North American and North/West European articles were published in higher impact journals as compared with those from other countries. Publication rates and median journal SIFs in pancreas research are similar to those reported from other medical specialty meetings. There is no difference by conference, type of research, or origin (North American vs. European).

  17. The analysis of optimal crack ratio for PWR pressure vessel cladding using genetic algorithm

    International Nuclear Information System (INIS)

    Mike Susmikanti; Roziq Himawan; Jos Budi Sulistyo

    2018-01-01

    Several aspects of material failure have been investigated, especially for materials used in Reactor Pressure Vessel (RPV) cladding. One aspect that needs to be analyzed is the crack ratio. The crack ratio is a parameter that compares the depth of the gap to its width. The optimal value of the crack ratio reflects the material's resistance to the fracture. Fracture resistance of the material to fracture mechanics is indicated by the value of Stress Intensity Factor (SIF). This value can be obtained from a J-integral calculation that expresses the energy release rate. The detection of the crack ratio is conducted through the calculation of J-integral value. The Genetic Algorithm (GA) is one way to determine the optimal value for a problem. The purpose of this study is to analyze the possibility of fracture caused by crack. It was conducted by optimizing the crack ratio of AISI 308L and AISI 309L stainless steels using GA. Those materials are used for RPV cladding. The minimum crack ratio and J-Integral values were obtained for AISI 308L and AISI 309L. The SIF value was derived from the J-Integral calculation. The SIF value was then compared with the fracture toughness of those material. With the optimal crack ratio, it can be predicted that the material boundaries are protected from damaged events. It can be a reference material for the durability of a mechanical fracture event. (author)

  18. Establishment of a sensor testbed at NIST for plant productivity monitoring

    Science.gov (United States)

    Allen, D. W.; Hutyra, L.; Reinmann, A.; Trlica, A.; Marrs, J.; Jones, T.; Whetstone, J. R.; Logan, B.; Reblin, J.

    2017-12-01

    Accurate assessments of biogenic carbon fluxes is challenging. Correlating optical signatures to plant activity allows for monitoring large regions. New methods, including solar-induced fluorescence (SIF), promise to provide more timely and accurate estimate of plant activity, but we are still developing a full understanding of the mechanistic leakage between plant assimilation of carbon and SIF. We have initiated a testbed to facilitate the evaluation of sensors and methods for remote monitoring of plant activity at the NIST headquarters. The test bed utilizes a forested area of mature trees in a mixed urban environment. A 1 hectare plot within the 26 hectare forest has been instrumented for ecophysiological measurements with an edge (100 m long) that is persistently monitored with multimodal optical sensors (SIF spectrometers, hyperspectral imagers, thermal infrared imaging, and lidar). This biological testbed has the advantage of direct access to the national scales maintained by NIST of measurements related to both the physical and optical measurements of interest. We offer a description of the test site, the sensors, and preliminary results from the first season of observations for ecological, physiological, and remote sensing based estimates of ecosystem productivity.

  19. VALIDATION OF CRACK INTERACTION LIMIT MODEL FOR PARALLEL EDGE CRACKS USING TWO-DIMENSIONAL FINITE ELEMENT ANALYSIS

    Directory of Open Access Journals (Sweden)

    R. Daud

    2013-06-01

    Full Text Available Shielding interaction effects of two parallel edge cracks in finite thickness plates subjected to remote tension load is analyzed using a developed finite element analysis program. In the present study, the crack interaction limit is evaluated based on the fitness of service (FFS code, and focus is given to the weak crack interaction region as the crack interval exceeds the length of cracks (b > a. Crack interaction factors are evaluated based on stress intensity factors (SIFs for Mode I SIFs using a displacement extrapolation technique. Parametric studies involved a wide range of crack-to-width (0.05 ≤ a/W ≤ 0.5 and crack interval ratios (b/a > 1. For validation, crack interaction factors are compared with single edge crack SIFs as a state of zero interaction. Within the considered range of parameters, the proposed numerical evaluation used to predict the crack interaction factor reduces the error of existing analytical solution from 1.92% to 0.97% at higher a/W. In reference to FFS codes, the small discrepancy in the prediction of the crack interaction factor validates the reliability of the numerical model to predict crack interaction limits under shielding interaction effects. In conclusion, the numerical model gave a successful prediction in estimating the crack interaction limit, which can be used as a reference for the shielding orientation of other cracks.

  20. Plant functional traits and canopy structure control the relationship between photosynthetic CO2 uptake and far-red sun-induced fluorescence in a Mediterranean grassland under different nutrient availability.

    Science.gov (United States)

    Migliavacca, Mirco; Perez-Priego, Oscar; Rossini, Micol; El-Madany, Tarek S; Moreno, Gerardo; van der Tol, Christiaan; Rascher, Uwe; Berninger, Anna; Bessenbacher, Verena; Burkart, Andreas; Carrara, Arnaud; Fava, Francesco; Guan, Jin-Hong; Hammer, Tiana W; Henkel, Kathrin; Juarez-Alcalde, Enrique; Julitta, Tommaso; Kolle, Olaf; Martín, M Pilar; Musavi, Talie; Pacheco-Labrador, Javier; Pérez-Burgueño, Andrea; Wutzler, Thomas; Zaehle, Sönke; Reichstein, Markus

    2017-05-01

    Sun-induced fluorescence (SIF) in the far-red region provides a new noninvasive measurement approach that has the potential to quantify dynamic changes in light-use efficiency and gross primary production (GPP). However, the mechanistic link between GPP and SIF is not completely understood. We analyzed the structural and functional factors controlling the emission of SIF at 760 nm (F 760 ) in a Mediterranean grassland manipulated with nutrient addition of nitrogen (N), phosphorous (P) or nitrogen-phosphorous (NP). Using the soil-canopy observation of photosynthesis and energy (SCOPE) model, we investigated how nutrient-induced changes in canopy structure (i.e. changes in plant forms abundance that influence leaf inclination distribution function, LIDF) and functional traits (e.g. N content in dry mass of leaves, N%, Chlorophyll a+b concentration (Cab) and maximum carboxylation capacity (V cmax )) affected the observed linear relationship between F 760 and GPP. We conclude that the addition of nutrients imposed a change in the abundance of different plant forms and biochemistry of the canopy that controls F 760 . Changes in canopy structure mainly control the GPP-F 760 relationship, with a secondary effect of Cab and V cmax . In order to exploit F 760 data to model GPP at the global/regional scale, canopy structural variability, biodiversity and functional traits are important factors that have to be considered. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  1. Strong constraint on modelled global carbon uptake using solar-induced chlorophyll fluorescence data.

    Science.gov (United States)

    MacBean, Natasha; Maignan, Fabienne; Bacour, Cédric; Lewis, Philip; Peylin, Philippe; Guanter, Luis; Köhler, Philipp; Gómez-Dans, Jose; Disney, Mathias

    2018-01-31

    Accurate terrestrial biosphere model (TBM) simulations of gross carbon uptake (gross primary productivity - GPP) are essential for reliable future terrestrial carbon sink projections. However, uncertainties in TBM GPP estimates remain. Newly-available satellite-derived sun-induced chlorophyll fluorescence (SIF) data offer a promising direction for addressing this issue by constraining regional-to-global scale modelled GPP. Here, we use monthly 0.5° GOME-2 SIF data from 2007 to 2011 to optimise GPP parameters of the ORCHIDEE TBM. The optimisation reduces GPP magnitude across all vegetation types except C4 plants. Global mean annual GPP therefore decreases from 194 ± 57 PgCyr -1 to 166 ± 10 PgCyr -1 , bringing the model more in line with an up-scaled flux tower estimate of 133 PgCyr -1 . Strongest reductions in GPP are seen in boreal forests: the result is a shift in global GPP distribution, with a ~50% increase in the tropical to boreal productivity ratio. The optimisation resulted in a greater reduction in GPP than similar ORCHIDEE parameter optimisation studies using satellite-derived NDVI from MODIS and eddy covariance measurements of net CO 2 fluxes from the FLUXNET network. Our study shows that SIF data will be instrumental in constraining TBM GPP estimates, with a consequent improvement in global carbon cycle projections.

  2. Fracture analysis of a central crack in a long cylindrical superconductor with exponential model

    Science.gov (United States)

    Zhao, Yu Feng; Xu, Chi

    2018-05-01

    The fracture behavior of a long cylindrical superconductor is investigated by modeling a central crack that is induced by electromagnetic force. Based on the exponential model, the stress intensity factors (SIFs) with the dimensionless parameter p and the length of the crack a/R for the zero-field cooling (ZFC) and field-cooling (FC) processes are numerically simulated using the finite element method (FEM) and assuming a persistent current flow. As the applied field Ba decreases, the dependence of p and a/R on the SIFs in the ZFC process is exactly opposite to that observed in the FC process. Numerical results indicate that the exponential model exhibits different characteristics for the trend of the SIFs from the results obtained using the Bean and Kim models. This implies that the crack length and the trapped field have significant effects on the fracture behavior of bulk superconductors. The obtained results are useful for understanding the critical-state model of high-temperature superconductors in crack problem.

  3. Morphology and Surface Energy of a Si Containing Semifluorinated Di-block Copolymer Thin Films.

    Science.gov (United States)

    Shrestha, Umesh; Clarson, Stephen; Perahia, Dvora

    2013-03-01

    The structure and composition of an interface influence stability, adhesiveness and response to external stimuli of thin polymeric films. Incorporation of fluorine affects interfacial energy as well as thermal and chemical stability of the layers. The incompatibility between the fluorinated and non-fluorinated blocks induces segregation that leads to long range correlations where the tendency of the fluorine to migrate to interfaces impacts the surface tension of the films. Concurrently Si in a polymeric backbone enhances the flexibility of polymeric chains. Our previous studies of poly trifluoro propyl methyl siloxane-polystyrene thin films with SiF fraction 0.03-0.5 as a function of temperature have shown that the SiF block drives layering parallel to the surface of the diblock. Here in we report the structure and interfacial energies of SiF-PS in the plane of the films, as a function of the volume fraction of the SiF block obtained from Atomic Force microscopy and contact angle measurement studies. This work is supported by NSF DMR - 0907390

  4. Modeling stochasticity and robustness in gene regulatory networks.

    Science.gov (United States)

    Garg, Abhishek; Mohanram, Kartik; Di Cara, Alessandro; De Micheli, Giovanni; Xenarios, Ioannis

    2009-06-15

    Understanding gene regulation in biological processes and modeling the robustness of underlying regulatory networks is an important problem that is currently being addressed by computational systems biologists. Lately, there has been a renewed interest in Boolean modeling techniques for gene regulatory networks (GRNs). However, due to their deterministic nature, it is often difficult to identify whether these modeling approaches are robust to the addition of stochastic noise that is widespread in gene regulatory processes. Stochasticity in Boolean models of GRNs has been addressed relatively sparingly in the past, mainly by flipping the expression of genes between different expression levels with a predefined probability. This stochasticity in nodes (SIN) model leads to over representation of noise in GRNs and hence non-correspondence with biological observations. In this article, we introduce the stochasticity in functions (SIF) model for simulating stochasticity in Boolean models of GRNs. By providing biological motivation behind the use of the SIF model and applying it to the T-helper and T-cell activation networks, we show that the SIF model provides more biologically robust results than the existing SIN model of stochasticity in GRNs. Algorithms are made available under our Boolean modeling toolbox, GenYsis. The software binaries can be downloaded from http://si2.epfl.ch/ approximately garg/genysis.html.

  5. Integration of satellite-induced fluorescence and vegetation optical depth to improve the retrieval of land evaporation

    Science.gov (United States)

    Pagán, B. R.; Martens, B.; Maes, W. H.; Miralles, D. G.

    2017-12-01

    Global satellite-based data sets of land evaporation overcome limitations in coverage of in situ measurements while retaining some observational nature. Although their potential for real world applications are promising, their value during dry conditions is still poorly understood. Most evaporation retrieval algorithms are not directly sensitive to soil moisture. An exception is the Global Land Evaporation Amsterdam Model (GLEAM), which uses satellite surface soil moisture and precipitation to account for land water availability. The existing methodology may greatly benefit from the optimal integration of novel observations of the land surface. Microwave vegetation optical depth (VOD) and near-infrared solar-induced fluorescence (SIF) are expected to reflect different aspects of evaporative stress. While the former is considered to be a proxy of vegetation water content, the latter is indicative of the activity of photosynthetic machinery. As stomata regulate both photosynthesis and transpiration, we expect a relationship between SIF and transpiration. An important motivation to incorporate observations in land evaporation calculations is that plant transpiration - usually the largest component of the flux - is extremely challenging to model due to species-dependent responses to drought. Here we present an innovative integration of VOD and SIF into the GLEAM evaporative stress function. VOD is utilized as a measurement of isohydricity to improve the representation of species specific drought responses. SIF is used for transpiration modelling, a novel application, and standardized by incoming solar radiation to better account for radiation-limited periods. Results are validated with global FLUXNET and International Soil Moisture Network data and demonstrate that the incorporation of VOD and SIF can yield accurate estimates of transpiration over large-scales, which are essential to further understand ecosystem-atmosphere feedbacks and the response of terrestrial

  6. Bis(1,3-dimethyl-1H-imidazolium hexafluorosilicate methanol 0.33-solvate

    Directory of Open Access Journals (Sweden)

    Maxim V. Borzov

    2013-08-01

    Full Text Available The title compound, 6C5H9N2+·3SiF62−·CH3OH, (I, was prepared by recrystallization of the crude salt from methanol along with solvent-free 2C5H9N2+·SiF62− (II. Crystals of these solvatomorphs can be separated manually. The solvate (I crystallizes in a rare hexagonal space group P6/mcc. Its asymmetric unit comprises one half of an imidazolium cation bisected by the crystallographic m-plane, one-sixth and one-twelfth of two crystallographically independent SiF62– dianions (Si atoms are located on the 3.2 and 6/m inversion centres, and one-twelfth of a methanol molecule (C atoms are situated on the 622 inversion centres, other atoms are disordered between general positions. In (I, all F atoms of 3.2-located SiF62– dianions participate in the formation of symmetry-equivalent contacts to the H atoms of imidazolium fragments, thus forming rod-type ensembles positioned on the -6 axes. These `pillar' rods are, in turn, F...H interlinked through SiF62– dianions disordered around the 6/m centres. The twelvefold disordered methanol molecules are appended to this array by O—H...F hydrogen bonds to the 6/m located SiF62– dianions. In terms of graph-set notation, the first and second level networks in (I are N1 = C22(7[3R44(14]D22(4 and N2 = D22(5 (C—H...O hydrogen bonds are not considered. After locating all symmetrically independent atoms in the cation and anions, there remained a strong (> 3 e Å−3 residual electron density peak located at the 622 inversion centre. Treatment of this pre-refined model with the SQUEEZE procedure in PLATON [Spek (2009. Acta Cryst. D65, 148–155] revealed two voids per unit cell, indicative of the presence of the solvent methanol molecule disordered about the 622 inversion centre.

  7. Social identity framing: Leader communication for social change

    Science.gov (United States)

    Seyranian, Viviane

    Social identity framing (SIF) delineates a process of intergroup communication that leaders may engage in to promote a vision of social change. As a step towards social change, social identity may need to be altered to accommodate a new view of the group, its collective goals, and its place alongside other groups. Thus, social identity content may be deconstructed and reconstructed by the leader en route to change. SIF suggests that this may be achieved through a series of 16 communication tactics, which are largely derived from previous research (Seyranian & Bligh, 2008). This research used an experimental design to test the effectiveness of three SIF communication tactics - inclusion, similarity to followers, and positive social identity - on a number of follower outcomes. Students ( N=246) were randomly assigned to read one of eight possible speeches promoting renewable energy on campus that was ostensibly from a student leader. The speeches were varied to include or exclude the three communication tactics. Following the speech, participants completed a dependent measures questionnaire. Results indicated that similarity to followers and positive social identity did not affect follower outcomes. However, students exposed to inclusion were more likely to indicate that renewable energy was ingroup normative; intend to engage in collective action to bring renewable energy to campus; experience positive emotional reactions towards change; feel more confident about the possibility of change; and to view the leader more positively. The combination of inclusion and positive social identity increased perceptions of charismatic leadership. Perceived leader prototypicality and cognitive elaboration of the leader's message resulted in more favorable attitudes towards renewable energy. Perceived leader prototypicality was also directly related to social identification, environmental values, ingroup injunctive norms, and self-stereotypes. Overall, these results support SIF

  8. Multi-species constraint of anthropogenic and biogenic processes over North America during ACT-America summer 2016 and winter 2017 aircraft campaigns

    Science.gov (United States)

    Parazoo, N.; Bowman, K. W.; Kuai, L.; Liu, J.; Lee, M.; Baker, I. T.; Berry, J. A.; Davis, K. J.; Lauvaux, T.; DiGangi, J. P.; Sweeney, C.

    2017-12-01

    Multi-species measurements of CO, OCS, and SIF have the potential to attribute CO2 variability to productivity and anthropogenic emissions. ACT-America aircraft campaigns in summer 2016 and winter 2017 collected vertical profiles of these key species close to their sources, providing important constraints on CO2 sources across 3 unique regions in eastern North America. The CMS-Flux carbon cycle assimilation system uses satellite measurements of CO (MOPITT), CO2 (OCO-2), SIF (OCO-2), and OCS (TES) to determine regional CO2 sources due to fossil fuel emissions, biomass burning, and net biome exchange, providing independent flux constraints, and which can be propagated back to the atmosphere for direct comparison to aircraft data. Here, we evaluate tracer-tracer correlations between CO2, CO, and OCS from ACT-America aircraft data during fall and winter campaigns, and compare to posterior signals from CMS-Flux over the same period. To predict atmospheric OCS signals, we leverage mechanistic representations of OCS plant uptake and GPP in the SiB land surface model to determine OCS-GPP linear relationships, then use SIF optimized estimates of GPP to infer OCS fluxes. Our objectives in this study are 3 fold: (1) Determine consistency of regional source attributions from CMS-Flux with aircraft data from ACT-America; (2) Analyze observed (ACT-America) and predicted (CMS-Flux) tracer-tracer correlations across multiple seasons and regions to identify key biogenic and anthropogenic drivers; (3) Determine to what extent SIF and OCS are valid linear predictors of GPP spatial variability. Summertime evaluation of these tracers shows good correlation between OCS/CO2 and OCS/CO in the midwest but poorer correlation in the northeast possibly reflecting biogenic controls on CO2. Comparisons of observed and predicted CO and CO2 in the PBL with CMF-Flux data indicate positively correlated biases that reflect both transport and flux errors. These results are compared with the winter

  9. Mapping cropland GPP in the north temperate region with space measurements of chlorophyll fluorescence

    Science.gov (United States)

    Guanter, L.; Zhang, Y.; Jung, M.; Joiner, J.; Voigt, M.; Huete, A. R.; Zarco-Tejada, P.; Frankenberg, C.; Lee, J.; Berry, J. A.; Moran, S. M.; Ponce-Campos, G.; Beer, C.; Camps-Valls, G.; Buchmann, N. C.; Gianelle, D.; Klumpp, K.; Cescatti, A.; Baker, J. M.; Griffis, T.

    2013-12-01

    Monitoring agricultural productivity is important for optimizing management practices in a world under a continuous increase of food and biofuel demand. We used new space measurements of sun-induced chlorophyll fluorescence (SIF), a vegetation parameter intrinsically linked to photosynthesis, to capture photosynthetic uptake of the crop belts in the north temperate region. The following data streams and procedures have been used in this analysis: (1) SIF retrievals have been derived from measurements of the MetOp-A / GOME-2 instrument in the 2007-2011 time period; (2) ensembles of process-based and data-driven biogeochemistry models have been analyzed in order to assess the capability of global models to represent crop gross primary production (GPP); (3) flux tower-based GPP estimates covering the 2007-2011 time period have been extracted over 18 cropland and grassland sites in the Midwest US and Western Europe from the Ameriflux and the European Fluxes Database networks; (4) large-scale NPP estimates have been derived by the agricultural inventory data sets developed by USDA-NASS and Monfreda et al. The strong linear correlation between the SIF space retrievals and the flux tower-based GPP, found to be significantly higher than that between reflectance-based vegetation indices (EVI, NDVI and MTCI) and GPP, has enabled the direct upscaling of SIF to cropland GPP maps at the synoptic scale. The new crop GPP estimates we derive from the scaling of SIF space retrievals are consistent with both flux tower GPP estimates and agricultural inventory data. These new GPP estimates show that crop productivity in the US Western Corn Belt, and most likely also in the rice production areas in the Indo-Gangetic plain and China, is up to 50-75% higher than estimates by state-of-the-art data-driven and process-oriented biogeochemistry models. From our analysis we conclude that current carbon models have difficulties in reproducing the special conditions of those highly productive

  10. 3-D thermal weight function method and multiple virtual crack extension technique for thermal shock problems

    International Nuclear Information System (INIS)

    Lu Yanlin; Zhou Xiao; Qu Jiadi; Dou Yikang; He Yinbiao

    2005-01-01

    An efficient scheme, 3-D thermal weight function (TWF) method, and a novel numerical technique, multiple virtual crack extension (MVCE) technique, were developed for determination of histories of transient stress intensity factor (SIF) distributions along 3-D crack fronts of a body subjected to thermal shock. The TWF is a universal function, which is dependent only on the crack configuration and body geometry. TWF is independent of time during thermal shock, so the whole history of transient SIF distributions along crack fronts can be directly calculated through integration of the products of TWF and transient temperatures and temperature gradients. The repeated determinations of the distributions of stresses (or displacements) fields for individual time instants are thus avoided in the TWF method. An expression of the basic equation for the 3-D universal weight function method for Mode I in an isotropic elastic body is derived. This equation can also be derived from Bueckner-Rice's 3-D WF formulations in the framework of transformation strain. It can be understood from this equation that the so-called thermal WF is in fact coincident with the mechanical WF except for some constants of elasticity. The details and formulations of the MVCE technique are given for elliptical cracks. The MVCE technique possesses several advantages. The specially selected linearly independent VCE modes can directly be used as shape functions for the interpolation of unknown SIFs. As a result, the coefficient matrix of the final system of equations in the MVCE method is a triple-diagonal matrix and the values of the coefficients on the main diagonal are large. The system of equations has good numerical properties. The number of linearly independent VCE modes that can be introduced in a problem is unlimited. Complex situations in which the SIFs vary dramatically along crack fronts can be numerically well simulated by the MVCE technique. An integrated system of programs for solving the

  11. Hot atom reactions involving multivalent and univalent species. Progress report, February 1976--January 1977

    International Nuclear Information System (INIS)

    Tang, Y.N.

    1977-01-01

    Multivalent hot atoms formed by the nuclear recoil method were studied: 31 Si, 32 P, and 11 C. For the recoil 31 Si reactions, we have completed the study on the reactivities of conjugated dienes towards monomeric 31 SiF 2 . The relative reactivities of 1,3-butadiene, trans-pentadiene, cis-pentadiene and 2-methyl-1,3-butadiene towards 31 SiF 2 have been measured as: 1.0:0.89:0.91:1.06 for singlet 31 SiF 2 ; and as 1.0:0.80:0.52:0.89 for the triplet. The large steric effect detected here between cis- and trans-pentadienes for their reactivities towards triplet 31 SiF 2 -donor indicates that a direct 1,4-addition process is possible for such 31 SiF 2 donating complexes. 2-methyl-1,1-diflorosilacyclopent-3-ene and its 3-methyl isomer were successfully synthesized by the co-pyrolysis technique. Experiments to evaluate the relative addition efficiencies of 31 SiH 2 towards various conjugated dienes; and to study to H- and F-abstraction mechanism by 31 Si atoms were begun. For recoil 32 P reactions, some progress has been made towards evaluating the mechanism of abstraction reactions by recoil 32 P atoms in PF 3 -PCl 3 system, and the moderator effect for recoil 32 P reactions with PF 3 -CH 4 mixtures. The possible formation of 32 PH, and the formation of 32 P atoms via the 32 S(n,p) 32 P process have also been explored. For recoil 11 C reactions, major progress has been obtained in the moderator studies of its reactions with 1,3-butadiene. With the successive addition of Ne as a moderator, the yield of acetylene- 11 C decreased, the yield of cyclopentene- 11 C increased while those of both 1,2,4-pentatriene- 11 C and cyclopentadiene- 11 C went through a minimum. Some progress for the identification of the last unknown 11 C-labeled product from this system has also been made

  12. Computational Studies of CO 2 Sorption and Separation in an Ultramicroporous Metal–Organic Material

    KAUST Repository

    Forrest, Katherine A.

    2013-08-29

    Grand canonical Monte Carlo (GCMC) simulations of CO2 sorption and separation were performed in [Zn(pyz)2SiF6], a metal-organic material (MOM) consisting of a square grid of Zn2+ ions coordinated to pyrazine (pyz) linkers and pillars of SiF6 2- ions. This MOM was recently shown to have an unprecedented selectivity for CO2 over N2, CH4, and H 2 under industrially relevant conditions. The simulated CO 2 sorption isotherms and calculated isosteric heat of adsorption, Qst, values were in excellent agreement with the experimental data for all the state points considered. CO2 saturation in [Zn(pyz) 2SiF6] was achieved at near-ambient temperatures and pressures lower than 1.0 atm. Moreover, the sorbed CO2 molecules were representative of a liquid/fluid under such conditions as confirmed through calculating the isothermal compressibility, βT, values. The simulated CO2 uptakes within CO2/N2 (10:90), CO2/CH4 (50:50), and CO2/H2 (30:70) mixture compositions, characteristic of flue gas, biogas, and syngas, respectively, were comparable to those that were produced in the single-component CO2 sorption simulations. The modeled structure at saturation revealed a loading of 1 CO2 molecule per unit cell. The favored CO2 sorption site was identified as the attraction of the carbon atoms of CO2 molecules to four equatorial fluorine atoms of SiF6 2- anions simultaneously, resulting in CO2 molecules localized at the center of the channel. Furthermore, experimental studies have shown that [Zn(pyz)2SiF6] sorbed minimal amounts of CO2 and N2 at their respective liquid temperatures. Analysis of the crystal structure at 100 K revealed that the unit cell undergoes a slight contraction in all dimensions and contains pyrazine rings that are mildly slanted with an angle of 13.9. Additionally, molecular dynamics (MD) simulations revealed that the sorbate molecules are anchored to the framework at low temperatures, which inhibits diffusion. Thus, it is hypothesized that the sorbed molecules

  13. Specific Tandem 3'UTR Patterns and Gene Expression Profiles in Mouse Thy1+ Germline Stem Cells.

    Directory of Open Access Journals (Sweden)

    Yan Huang

    Full Text Available A recently developed strategy of sequencing alternative polyadenylation (APA sites (SAPAS with second-generation sequencing technology can be used to explore complete genome-wide patterns of tandem APA sites and global gene expression profiles. spermatogonial stem cells (SSCs maintain long-term reproductive abilities in male mammals. The detailed mechanisms by which SSCs self-renew and generate mature spermatozoa are not clear. To understand the specific alternative polyadenylation pattern and global gene expression profile of male germline stem cells (GSCs, mainly referred to SSCs here, we isolated and purified mouse Thy1+ cells from testis by magnetic-activated cell sorting (MACS and then used the SAPAS method for analysis, using pluripotent embryonic stem cells (ESCs and differentiated mouse embryonic fibroblast cells (MEFs as controls. As a result, we obtained 99,944 poly(A sites, approximately 40% of which were newly detected in our experiments. These poly(A sites originated from three mouse cell types and covered 17,499 genes, including 831 long non-coding RNA (lncRNA genes. We observed that GSCs tend to have shorter 3'UTR lengths while MEFs tend towards longer 3'UTR lengths. We also identified 1337 genes that were highly expressed in GSCs, and these genes were highly consistent with the functional characteristics of GSCs. Our detailed bioinformatics analysis identified APA site-switching events at 3'UTRs and many new specifically expressed genes in GSCs, which we experimentally confirmed. Furthermore, qRT-PCR was performed to validate several events of the 334 genes with distal-to-proximal poly(A switch in GSCs. Consistently APA reporter assay confirmed the total 3'UTR shortening in GSCs compared to MEFs. We also analyzed the cis elements around the proximal poly(A site preferentially used in GSCs and found C-rich elements may contribute to this regulation. Overall, our results identified the expression level and polyadenylation site

  14. Specific Tandem 3'UTR Patterns and Gene Expression Profiles in Mouse Thy1+ Germline Stem Cells

    Science.gov (United States)

    Lin, Zhuoheng; Feng, Xuyang; Jiang, Xue; Songyang, Zhou; Huang, Junjiu

    2015-01-01

    A recently developed strategy of sequencing alternative polyadenylation (APA) sites (SAPAS) with second-generation sequencing technology can be used to explore complete genome-wide patterns of tandem APA sites and global gene expression profiles. spermatogonial stem cells (SSCs) maintain long-term reproductive abilities in male mammals. The detailed mechanisms by which SSCs self-renew and generate mature spermatozoa are not clear. To understand the specific alternative polyadenylation pattern and global gene expression profile of male germline stem cells (GSCs, mainly referred to SSCs here), we isolated and purified mouse Thy1+ cells from testis by magnetic-activated cell sorting (MACS) and then used the SAPAS method for analysis, using pluripotent embryonic stem cells (ESCs) and differentiated mouse embryonic fibroblast cells (MEFs) as controls. As a result, we obtained 99,944 poly(A) sites, approximately 40% of which were newly detected in our experiments. These poly(A) sites originated from three mouse cell types and covered 17,499 genes, including 831 long non-coding RNA (lncRNA) genes. We observed that GSCs tend to have shorter 3'UTR lengths while MEFs tend towards longer 3'UTR lengths. We also identified 1337 genes that were highly expressed in GSCs, and these genes were highly consistent with the functional characteristics of GSCs. Our detailed bioinformatics analysis identified APA site-switching events at 3'UTRs and many new specifically expressed genes in GSCs, which we experimentally confirmed. Furthermore, qRT-PCR was performed to validate several events of the 334 genes with distal-to-proximal poly(A) switch in GSCs. Consistently APA reporter assay confirmed the total 3'UTR shortening in GSCs compared to MEFs. We also analyzed the cis elements around the proximal poly(A) site preferentially used in GSCs and found C-rich elements may contribute to this regulation. Overall, our results identified the expression level and polyadenylation site profiles and

  15. Critical validity assessment of theoretical models: charge-exchange at intermediate and high energies

    Science.gov (United States)

    Belkić, Dževad

    1999-06-01

    é approximant (VPA) as a novel non-perturbative theory which is valid at all energies. This is a variationally unified T-matrix, T(VPA)i,f= T'i,f+ Si,f, comprised of a selected perturbative model T'i,f and a related stationary non-linear remainder Si,f conceived as an L2-basis set expansion of the total Green's function. The key input Si,f is a double series ∑ n1, n2Cn1n2 with bound-free atomic form factors as rational coefficients Cn1n2. Convergence of this sum is significantly accelerated by the two-dimensional Padé approximant (2D-PA) implemented through the bi-variate Wynn's epsilon ( ɛ) algorithm. The table ɛ( λ) for Si,f( λ) is evaluated at a sufficiently dense grid λ∈ Λ≡[ λmin, λmax] of any chosen variate λ, e.g. scattering angle, incident energy, coupling strength, etc. The roots λk of the inverse function E(λ)=1/ɛ(λ) directly lead to the poles of Si,f( λ) in the complex λ-plane. The availability of all λk's permits an easy obtaining of each of the magnitudes d ɛk=1/ E'(λ k) of the poles of Si,f( λ) by the Cauchy residue calculus and a mere knowledge of the first derivative E'(λ k) of E(λ k) at λk∈ Λ. This is a new signal processing method called the parametric epsilon spectral (P ɛS) estimator which opens an affordable way to powerful numerical investigations of analytical properties of transition and scattering matrices for a general process including resonance phenomena as one of the the most interesting parts of scattering.

  16. Estudio del efecto de la adición de distintos mineralizadores en la síntesis cerámica del pigmento rosa coral de hierro-circón

    Directory of Open Access Journals (Sweden)

    Llusar, M.

    1999-06-01

    Full Text Available The addition of several mineralizing agents (alkaline or alkaline-earth halides, KNO3, etc. in the traditional ceramic synthesis of the “coral pink” iron-zircon (Fe-ZrSiO4 ceramic pigment has been analysed, using two different Fe precursors (sulphate and goethite. FeSO4.7H2O employment as Fe precursor allows us to obtain a better reddish colour than with goethite (FeO(OH. Results let us to classify the studied mineralisers in two major groups: i primary or zircon-forming mineralisers, which activate somehow zircon formation with a good occlusion efficiency of hematite into the zircon matrix (NaF, NaCl and BaF2 when using FeSO4 and Na2SiF6 and NaAl3F6 with goethite,. and ii secondary or modifying mineralisers, that have a collateral effect on the pigment synthesis regulating both hematite crystallisation and occlusion (KNO3, Na2SiF6 and NaAl3F6 with FeSO4 and KI and KNO3 with goethite. With regard to the color yield, those compositions mineralised with the binary systems NaF-Na2SiF6, NaF-NaAl3F6 and NaF-KNO3 have been found to develop the best red color.

    Se ha analizado el efecto de la adición de distintos agentes mineralizadores (haluros alcalinos y alcalino-térreos, KNO3, etc. en la síntesis cerámica tradicional del pigmento rosa coral de hierro-circón (Fe-ZrSiO4, usando dos precursores diferentes para el hierro (sulfato y goetita. El empleo de FeSO4.7H2O como fuente de hierro permite obtener mejores coloraciones rojizas que con goetita (FeO(OH. Los resultados obtenidos permiten clasificar a los distintos mineralizadores ensayados en dos grandes grupos: i mineralizadores primarios o “formadores de circón”, los cuales permiten activar el desarrollo del circón con una buena eficiencia en el encapsulamiento de la hematita en los cristales de circón (NaF, NaCl y BaF2 con FeSO4, y Na2SiF6 y NaAl3F6 con goetita, y ii mineralizadores “secundarios o coadyuvantes”, con un efecto colateral sobre la síntesis del pigmento

  17. Venus: Preliminary geologic mapping of northern Atla Regio

    Science.gov (United States)

    Nikishin, A. M.; Burba, G. A.

    1992-01-01

    A preliminary geologic map of C1 sheet 15N197 was compiled according to Magellan data. Northern Atla Regio is dominantly a volcanic plain with numerous volcanic features: radar-bright and -dark flows and spots, shield volcanos, volcanic domes and hills with varied morphology, and coronalike constructions. Tesserae are the oldest terrains semiflooded by plain materials. There are many lineated terrains on this territory. They are interpreted as old, partly buried ridge belts. Lineated terrains have intermediate age between young plains and old tesserae. Ozza Mons and Sapas Mons are the high shield volcanos. The prominent structure of northern Atla Regio is Ganis Chasma rift. The rift dissected the volcanic plain and evolved nearly contemporaneously with Ozza Mons shield volcano. Ganis Chasma rift valley is highly fractured and bounded by fault scarps. There are a few relatively young volcanic features in the rift valley. The rift originated due to 5-10 percent crustal extension and crustal subsidence according to analysis of fracturing and rift valley geometry. Ganis Chasma is characterized by rift shoulder uplifts. Geological structures of Alta Regio and Beta Regio are very similar as assumed earlier.

  18. Screening for personality disorder in incarcerated adolescent boys

    DEFF Research Database (Denmark)

    Simonsen, Erik; Kongerslev, Mickey; Moran, Paul

    2012-01-01

    Background: Personality disorder (PD) is associated with significant functional impairment and an elevated risk of violent and suicidal behaviour. The prevalence of PD in populations of young offenders is likely to be high. However, because the assessment of PD is time-consuming, it is not routin......Background: Personality disorder (PD) is associated with significant functional impairment and an elevated risk of violent and suicidal behaviour. The prevalence of PD in populations of young offenders is likely to be high. However, because the assessment of PD is time...... in adults (Standardised Assessment of Personality – Abbreviated Scale; SAPAS) for use with adolescents and then carried out a study of the reliability and validity of the adapted instrument in a sample of 80 adolescent boys in secure institutions. Participants were administered the screen and shortly after......, and usefulness of the screen in secure institutions for adolescent male offenders. It can be used in juvenile offender institutions with limited resources, as a brief, acceptable, staff-administered routine screen to identify individuals in need of further assessment of PD or by researchers conducting...

  19. E-government strategy of Surabaya city government through e-rt / rw to improve the quality of public service

    Science.gov (United States)

    Oktariyanda, T. A.; Rahaju, T.

    2018-01-01

    The use of information technology by Surabaya City Government has generated various innovations of public services such as “e-Sapa Warga”, e-Commerce, “e-RT/RW”, e-Budgeting, e-Project, e-Procurement, “e-Pendidikan”. Among the many innovations, e-RT/RW (Rukun Tetangga / Rukun Warga) is an innovation that is quite prominent because there are still many areas that have not implemented. This research can be classified as literature review and critical research. The aims of this research are to describe and analyze e-government strategy in Surabaya City through e-RT / RW to improve public service quality. The result of this research is e-government strategy in Surabaya City through e-RT / RW is already relevant and in accordance with Goldsmith’s theory of e-government. The positive impact of the implementation of e-RT / RW is the increasing quality of public services to bring benefits to all citizens Surabaya City.

  20. Effect of flue gas recirculation on heat transfer in a supercritical circulating fluidized bed combustor

    Directory of Open Access Journals (Sweden)

    Błaszczuk Artur

    2015-09-01

    Full Text Available This paper focuses on assessment of the effect of flue gas recirculation (FGR on heat transfer behavior in 1296t/h supercritical coal-fired circulating fluidized bed (CFB combustor. The performance test in supercritical CFB combustor with capacity 966 MWth was performed with the low level of flue gas recirculation rate 6.9% into furnace chamber, for 80% unit load at the bed pressure of 7.7 kPa and the ratio of secondary air to the primary air SA/PA = 0.33. Heat transfer behavior in a supercritical CFB furnace between the active heat transfer surfaces (membrane wall and superheater and bed material has been analyzed for Geldart B particle with Sauter mean diameters of 0.219 and 0.246 mm. Bed material used in the heat transfer experiments had particle density of 2700 kg/m3. A mechanistic heat transfer model based on cluster renewal approach was used in this work. A heat transfer analysis of CFB combustion system with detailed consideration of bed-to-wall heat transfer coefficient distributions along furnace height is investigated. Heat transfer data for FGR test were compared with the data obtained for representative conditions without recycled flue gases back to the furnace through star-up burners.

  1. EKSISTENSI DELIK ADAT DI LINGKUNGAN MASYARAKAT SENTOLO, KABUPATEN KULONPROGO YOGYAKARTA

    Directory of Open Access Journals (Sweden)

    Agus Sudaryanto

    2016-05-01

    Full Text Available This research is empirical law research. The collecting data were analyzed by qualitative and presented descriptively. The research can be concluded as follows: reasons for maintaining delict adat law are religious environment, maintaining norms politeness, adat executed as long as no conflict with the written law and the protection of women. Types of sanction are warning in a visit at night, asked to leave the house for interrogation, community sanctions; the reasons of sanction are near the mosque, maintaining delict adat law, neglection of verbal warning, anticipation pregnant before marriage and aruh-aruh culture must be maintained. Jenis penelitian ini adalah yuridis empiris. Data yang terkumpul dianalisis secara kualitatif dan disajikan deskriptif. Kesimpulan riset adalah: Pertama, alasan mempertahankan hukum delik adat karena lingkungan riligius, menjaga norma kesopanan, adat dijalankan asalkan tidak berbenturan dengan peraturan tertulis dan perlindungan perempuan. Kedua, proses penerapan sanksi masyarakat adalah peringatan dalam bertamu di malam hari, diminta keluar rumah untuk diinterogasi, diberi sanksi yang ditentukan musyawarah masyarakat. Ketiga, alasan penjatuhan sanksi pengusiran adalah lingkungan dekat masjid, mempertahankan hukum delik adat, tidak mengindahkan peringatan, pencegahan hamil di luar nikah, perlunya budaya aruharuh (tegur sapa harus dipertahankan.

  2. Uso y valor del recurso hídrico urbano. Sistema de agua potable en Culiacán, México

    Directory of Open Access Journals (Sweden)

    César Domingo Iñíguez Sepúlveda

    2010-05-01

    Full Text Available El propósito de este estudio es construir un sistema para valorar cualitativamente el uso del recurso hídrico como elemento inevitable para el suministro de los servicios de agua potable, alcantarillado y saneamiento (SAPAS en la ciudad de Culiacán, Sinaloa. Este modelo de evaluación del recurso hídrico está fundamentado en la visión del desarrollo sustentable (DS y en la construcción del sistema de indicadores que integró factores de Presión-Estado-Impacto-Respuesta (PEIR, modelo desarrollado por la organización para la Cooperación y el Desarrollo Económicos (OCDE. Este modelo, se construyó con veinticuatro indicadores organizados en tres categorías para la visión de sustentabilidad y, en cuatro clases que atendieron el modelo PEIR. Finalmente, se estableció un conjunto de conclusiones sobre el discurso teórico y metodológico para construir modelos de valoración del agua urbana.

  3. EKMEKLİK BUĞDAY ÇEŞİTLERİNDE FARKLI AZOT DOZLARININ BAZI VERİM ÖĞELERİ ÜZERİNE ETKİLERİ

    OpenAIRE

    MERT, Berkan; ÇİFTÇİ, Cemalettin; ATAK, Mehmet

    2014-01-01

    Bu araştırma, 2002 yılında Ankara Üniversitesi, Ziraat Fakültesi Araştırma Uygulama Çiftliğinde yürütülmüştür. Araştırma, bazı ekmeklik buğday çeşitlerinde farklı azot dozlarının bazı verim öğeleri üzerine etkilerini incelemek amacıyla kurulmuştur. Denemede, Gün-91, İkizce-96, Mızrak, Uzunyayla ve Yakar-99 ekmeklik buğday çeşitleri materyal olarak kullanılmıştır. Beş değişik azot dozu (2, 4, 6, 8 ve 10 kg/da N) kullanılmış olup, azotun yarısı ekimle birlikte kalan diğer yarısı da sapa kalkma ...

  4. The influence of environmental abiotic factors on the qualitative and quantitative structure of ichthyofauna from predeltaic Danube area

    Directory of Open Access Journals (Sweden)

    Petronela Georgiana Calin Sandu

    2013-05-01

    Full Text Available The aim of the paper  is to analyse the influence of environmental factors on the capture and fish communities structure from Danube, between Siret River and Prut River mouth. Fish were collected from April to December 2012 in four fishing areas. During the year, 4910 kg, respectively 7121 fish of 31 species were collected. Cyprinidae, the dominant family, 54.84% in term of number of species, was represented by 17 species (Cyprinus carpio, Carassius gibelio, Barbus barbus, Abramis brama, Abramis sapa, Blicca bjoerkna, Leuciscus idus, Vimba vimba, Aspius aspius, Pelecus cultratus, Chondrostoma nasus, Ctenopharingodon idella, Hypophthalmichthys molitrix, Hypophthalmichthys nobilis, Scardinius erythrophthalmus, Rutilus rutilus, Alburnus alburnus. Other families had the following structure: Percidae (16.13% with 5 species (Sander lucioperca, Zingel zingel, Zingel streber, Perca fluviatilis, Gymnocephalus schraetzer, Acipenseridae (12.90% with 4 species (Huso huso, Acipenser stellatus, Acipenser ruthenus, Acipenser gueldenstaedtii, Clupeidae (6.45% with two species (Alosa immaculata, Alosa tanaica, Siluridae (3.23% with one species (Silurus glanis, Esocidae (3.23% with one species (Esox lucius  and Salmonidae (3.23% with one species also (Salmo labrax. The highest capture was 2977.93 kg (60.65%, during the spring season (April-May, followed by autumn season (September–November, with 992.39 kg (20.21%. The water level and water flow showed high correlation with both number and total catch, respectively.

  5. Biomechanical in vitro evaluation of three stable internal fixation techniques used in sagittal osteotomy of the mandibular ramus: a study in sheep mandibles

    Directory of Open Access Journals (Sweden)

    Leandro Benetti de Olivera

    2012-08-01

    Full Text Available Among the osteotomies performed in orthognathic surgery, the sagittal osteotomy of the mandibular ramus (SOMR is the most common, allowing a great range of movements and stable internal fixation (SIF, therefore eliminating the need of maxillomandibular block in the postoperative period. OBJECTIVES: The purpose of this study was to evaluate the biomechanical resistance of three national systems used for SIF in SOMR in sheep mandibles. MATERIAL AND METHODS: The study was performed in 30 sheep hemi-mandibles randomly divided into 3 experimental groups, each containing 10 hemi-mandibles. The samples were measured to avoid discrepancies and then subjected to SOMR with 5-mm advancement. In group I, 2.0x12 mm screws were used for fixation, inserted in an inverted "L" pattern (inverted "L" group. In group II, fixation was performed with two 2.0x12 mm screws, positioned in a linear pattern and a 4-hole straight miniplate and four 2.0x6.0 mm monocortical screws (hybrid group. In group III, fixation was performed with two 4-hole straight miniplates and eight 2.0x6.0 mm monocortical screws (mini plate group. All materials used for SIF were supplied by Osteosin - SIN. The hemimandibles were subjected to vertical linear load test by Kratos K2000MP mechanical testing unit for loading registration and displacement. RESULTS: All groups showed similar resistance during mechanical test for loading and displacement, with no statistically significant differences between groups according to analysis of variance. CONCLUSION: These results indicate that the three techniques of fixation are equally effective for clinical fixation of SOMR.

  6. Why are SiX5(-) and GeX5(-) (X = F, Cl) stable but not CF5(-) and CCl5(-)?

    Science.gov (United States)

    Marchaj, Marzena; Freza, Sylwia; Skurski, Piotr

    2012-03-01

    The possible existence of the CF(5)(-), CCl(5)(-), SiF(5)(-), SiCl(5)(-), GeF(5)(-), and GeCl(5)(-) anions has been investigated using ab initio methods. The species containing Si and Ge as central atoms were found to adopt the D(3h)-symmetry trigonal bipyramidal equilibrium structures whose thermodynamic stabilities were confirmed by examining the most probable fragmentation channels. The ab initio re-examination of the electronic stabilities of the SiF(5)(-), SiCl(5)(-), GeF(5)(-), and GeCl(5)(-) anions [using the OVGF(full) method with the 6-311+G(3df) basis set] led to the very large vertical electron detachment (VDE) energies of 9.316 eV (SiF(5)(-)) and 9.742 eV (GeF(5)(-)), whereas smaller VDEs of 6.196 and 6.452 eV were predicted for the SiCl(5)(-) and GeCl(5)(-) species, respectively. By contrast, the high-symmetry and structurally compact anionic CF(5)(-) and CCl(5)(-) systems cannot exist due to the strongly repulsive potential predicted for the X(-) (F(-) or Cl(-)) approaching the CX(4) (CF(4) or CCl(4)). The formation of weakly bound CX(4)···X(-) (CF(4)···F(-) and CCl(4)···Cl(-)) anionic complexes (consisting of pseudotetrahedral neutral CX(4) with the weakly tethered X(-)) might be expected at low temperatures (approaching 0 K), whereas neither CX(5)(-) (CF(5)(-), CCl(5)(-)) systems nor CX(4)···X(-) (CF(4)···F(-) and CCl(4)···Cl(-)) complexes can exist in the elevated temperatures (above 0K) due to their susceptibility to the fragmentation (leading to the X(-) loss). © 2012 American Chemical Society

  7. Evaluating the accuracy of a MODIS direct broadcast algorithm for mapping burned areas over Russia

    Science.gov (United States)

    Petkov, A.; Hao, W. M.; Nordgren, B.; Corley, R.; Urbanski, S. P.; Ponomarev, E. I.

    2012-12-01

    Emission inventories for open area biomass burning rely on burned area estimates as a key component. We have developed an automated algorithm based on MODerate resolution Imaging Spectroradiometer (MODIS) satellite instrument data for estimating burned area from biomass fires. The algorithm is based on active fire detections, burn scars from MODIS calibrated radiances (MOD02HKM), and MODIS land cover classification (MOD12Q1). Our burned area product combines active fires and burn scar detections using spatio-temporal criteria, and has a resolution of 500 x 500 meters. The algorithm has been used for smoke emission estimates over the western United States. We will present the assessed accuracy of our algorithm in different regions of Russia with intense wildfire activity by comparing our results with the burned area product from the Sukachev Institute of Forest (SIF) of the Russian Academy of Sciences in Krasnoyarsk, Russia, as well as burn scars extracted from Landsat imagery. Landsat burned area extraction was based on threshold classification using the Jenks Natural Breaks algorithm to the histogram for each singe scene Normalized Burn Ratio (NBR) image. The final evaluation consisted of a grid-based approach, where the burned area in each 3 km x 3 km grid cell was calculated and compared with the other two sources. A comparison between our burned area estimates and those from SIF showed strong correlation (R2=0.978), although our estimate is approximately 40% lower than the SIF burned areas. The linear fit between the burned area from Landsat scenes and our MODIS algorithm over 18,754 grid cells resulted with a slope of 0.998 and R2=0.7, indicating that our algorithm is suitable for mapping burned areas for fires in boreal forests and other ecosystems. The results of our burned area algorithm will be used for estimating emissions of trace gasses and aerosol particles (including black carbon) from biomass burning in Northern Eurasia for the period of 2002-2011.

  8. Microencapsulation of Bifidobacterium animalis subsp. lactis and Lactobacillus acidophilus in cocoa butter using spray chilling technology

    Science.gov (United States)

    Pedroso, D.L.; Dogenski, M.; Thomazini, M.; Heinemann, R.J.B.; Favaro-Trindade, C.S.

    2013-01-01

    In the present study, the cells of Bifidobacterium animalis subsp. lactis (BI-01) and Lactobacillus acidophilus (LAC-04) were encapsulated in cocoa butter using spray-chilling technology. Survival assays were conducted to evaluate the resistance of the probiotics to the spray-chilling process, their resistance to the simulated gastric and intestinal fluids (SGF and SIF), and their stability during 90 days of storage. The viability of the cells was not affected by microencapsulation. The free and encapsulated cells of B. animalis subsp. lactis were resistant to both SGF and SIF. The micro-encapsulated cells of L. acidophilus were more resistant to SGF and SIF than the free cells; the viability of the encapsulated cells was enhanced by 67%, while the free cells reached the detection limit of the method (103 CFU/g). The encapsulated probiotics were unstable when they were stored at 20 °C. The population of encapsulated L. acidophilus decreased drastically when they were stored at 7 °C; only 20% of cells were viable after 90 days of storage. The percentage of viable cells of the encapsulated B. animalis subsp.lactis, however, was 72% after the same period of storage. Promising results were obtained when the microparticles were stored at −18 °C; the freeze granted 90 days of shelf life to the encapsulated cells. These results suggest that the spray-chilling process using cocoa butter as carrier protects L. acidophilus from gastrointestinal fluids. However, the viability of the cells during storage must be improved. PMID:24516445

  9. Microencapsulation of Bifidobacterium animalis subsp. lactis and Lactobacillus acidophilus in cocoa butter using spray chilling technology

    Directory of Open Access Journals (Sweden)

    D.L. Pedroso

    2013-09-01

    Full Text Available In the present study, the cells of Bifidobacterium animalis subsp. lactis (BI-01 and Lactobacillus acidophilus (LAC-04 were encapsulated in cocoa butter using spray-chilling technology. Survival assays were conducted to evaluate the resistance of the probiotics to the spray-chilling process, their resistance to the simulated gastric and intestinal fluids (SGF and SIF, and their stability during 90 days of storage. The viability of the cells was not affected by microencapsulation. The free and encapsulated cells of B. animalis subsp. lactis were resistant to both SGF and SIF. The micro-encapsulated cells of L. acidophilus were more resistant to SGF and SIF than the free cells; the viability of the encapsulated cells was enhanced by 67%, while the free cells reached the detection limit of the method (10³ CFU/g. The encapsulated probiotics were unstable when they were stored at 20 °C. The population of encapsulated L. acidophilus decreased drastically when they were stored at 7 °C; only 20% of cells were viable after 90 days of storage. The percentage of viable cells of the encapsulated B. animalis subsp.lactis, however, was 72% after the same period of storage. Promising results were obtained when the microparticles were stored at -18 °C; the freeze granted 90 days of shelf life to the encapsulated cells. These results suggest that the spray-chilling process using cocoa butter as carrier protects L. acidophilus from gastrointestinal fluids. However, the viability of the cells during storage must be improved.

  10. A conjunct near-surface spectroscopy system for fix-angle and multi-angle continuous measurements of canopy reflectance and sun-induced chlorophyll fluorescence

    Science.gov (United States)

    Zhang, Qian; Fan, Yifeng; Zhang, Yongguang; Chou, Shuren; Ju, Weimin; Chen, Jing M.

    2016-09-01

    An automated spectroscopy system, which is divided into fix-angle and multi-angle subsystems, for collecting simultaneous, continuous and long-term measurements of canopy hyper-spectra in a crop ecosystem is developed. The fix-angle subsystem equips two spectrometers: one is HR2000+ (OceanOptics) covering the spectral range 200-1100 nm with 1.0 nm spectral resolution, and another one is QE65PRO (OceanOptics) providing 0.1 nm spectral resolution within the 730-780 nm spectral range. Both spectrometers connect a cosine-corrected fiber-optic fixed up-looking to collect the down-welling irradiance and a bare fiber-optic to measure the up-welling radiance from the vegetation. An inline fiber-optic shutter FOS-2x2-TTL (OceanOptics) is used to switch between input fibers to collect the signal from either the canopy or sky at one time. QE65PRO is used to permit estimation of vegetation Sun-Induced Fluorescence (SIF) in the O2-A band. The data collection scheme includes optimization of spectrometer integration time to maximize the signal to noise ratio and measurement of instrument dark currency. The multi-angle subsystem, which can help understanding bidirectional reflectance effects, alternatively use HR4000 (OceanOptics) providing 0.1 nm spectral resolution within the 680-800 nm spectral range to measure multi-angle SIF. This subsystem additionally includes a spectrometer Unispec-DC (PPSystems) featuring both up-welling and down-welling channels with 3 nm spectral resolution covering the 300-1100 nm spectral range. Two down-looking fiber-optics are mounted on a rotating device PTU-D46 (FLIR Systems), which can rotate horizontally and vertically at 10° angular step widths. Observations can be used to calculate canopy reflectance, vegetation indices and SIF for monitoring plant physiological processes.

  11. Fracture analysis of a transversely isotropic high temperature superconductor strip based on real fundamental solutions

    Science.gov (United States)

    Gao, Zhiwen; Zhou, Youhe

    2015-04-01

    Real fundamental solution for fracture problem of transversely isotropic high temperature superconductor (HTS) strip is obtained. The superconductor E-J constitutive law is characterized by the Bean model where the critical current density is independent of the flux density. Fracture analysis is performed by the methods of singular integral equations which are solved numerically by Gauss-Lobatto-Chybeshev (GSL) collocation method. To guarantee a satisfactory accuracy, the convergence behavior of the kernel function is investigated. Numerical results of fracture parameters are obtained and the effects of the geometric characteristics, applied magnetic field and critical current density on the stress intensity factors (SIF) are discussed.

  12. Study on the Effect of the Separating Unit Optimization on the Economy of Stable Isotope Separation

    Directory of Open Access Journals (Sweden)

    YANG Kun

    2015-01-01

    Full Text Available An economic criterion called as yearly net profit of single separating unit (YNPSSU was presented to evaluate the influence of structure optimization on the economy. Using YNPSSU as a criterion, economic analysis was carried out for the structure optimization of separating unit in the case of separating SiF4 to obtain the 28Si and 29Si isotope. YNPSSU was calculated and compared with that before optimization. The results showed that YNPSSU was increased by 12.3% by the structure optimization. Therefore, the structure optimization could increase the economy of the stable isotope separation effectively.

  13. Using Remotely Sensed Fluorescence and Soil Moisture to Better Understand the Seasonal Cycle of Tropical Grasslands

    Science.gov (United States)

    Smith, Dakota Carlysle

    Seasonal grasslands account for a large area of Earth's land cover. Annual and seasonal changes in these grasslands have profound impacts on Earth's carbon, energy, and water cycles. In tropical grasslands, growth is commonly water-limited and the landscape oscillates between highly productive and unproductive. As the monsoon begins, soils moisten providing dry grasses the water necessary to photosynthesize. However, along with the rain come clouds that obscure satellite products that are commonly used to study productivity in these areas. To navigate this issue, we used solar induced fluorescence (SIF) products from OCO-2 along with soil moisture products from the Soil Moisture Active Passive satellite (SMAP) to "see through" the clouds to monitor grassland productivity. To get a broader understanding of the vegetation dynamics, we used the Simple Biosphere Model (SiB4) to simulate the seasonal cycles of vegetation. In conjunction with SiB4, the remotely sensed SIF and soil moisture observations were utilized to paint a clearer picture of seasonal productivity in tropical grasslands. The remotely sensed data is not available for every place at one time or at every time for one place. Thus, the study was focused on a large area from 15° E to 35° W and from 8°S to 20°N in the African Sahel. Instead of studying productivity relative to time, we studied it relative to soil moisture. Through this investigation we found soil moisture thresholds for the emergence of grassland growth, near linear grassland growth, and maturity of grassland growth. We also found that SiB4 overestimates SIF by about a factor of two for nearly every value of soil moisture. On the whole, SiB4 does a surprisingly good job of predicting the response of seasonal growth in tropical grasslands to soil moisture. Future work will continue to integrate remotely sensed SIF & soil moisture with SiB4 to add to our growing knowledge of carbon, water, and energy cycling in tropical grasslands.

  14. Experimental study of multi-component separation by gas centrifuge

    International Nuclear Information System (INIS)

    Zhou, M.S.; Liang, X.W.; Chen, W.N.; Yin, Y.T.

    2006-01-01

    Stable isotopes are applied in many areas and most stable isotopes are multi-component, This paper presents experimental results of several stable isotopes separation conducted in Tsinghua University by using ultra-speed gas centrifuges. Xe, WF 6 , TeF 6 , SiHCl 3 , SiF 4 were chosen as the process gases. By adjusting some of the centrifuge's parameters, the suitable centrifuge parameters for different process gas separations were found and the overall unit separation factors γ 0 were obtained by means of single gas centrifuge separation. The experimental results show that with appropriate process gases, stable isotope separation by gas centrifuge was effective. (authors)

  15. Laser assisted aerodynamic isotope separation

    International Nuclear Information System (INIS)

    Berg, H. van den

    1985-01-01

    It is shown that the efficiency of conventional aerodynamic isotope seperation can be improved by two orders of magnitude with the aid of a relatively weak cw infrared laser which is used to induce isotopically selective condensation. Overall isotope enrichment factors in excess of 2 are obtained as compared to about 1.02 in the conventional seperation. Sulphur isotopes in SF 6 as well as Silicon isotopes in SiF 4 and Bromine isotopes in CF 3 Br are seperated on a laboratory scale. Infrared vibrational predissociation by itself and in combination with isotopically selective condensation are also shown to be effective new ways of isotope separation. (orig.) [de

  16. Numerical Simulation of Fatigue Crack Growth in Hip Implants

    Czech Academy of Sciences Publication Activity Database

    Colic, K.; Sedmak, A.; Grbovic, A.; Burzić, M.; Hloch, Sergej; Sedmak, S.

    2016-01-01

    Roč. 149, č. 149 (2016), s. 229-235 E-ISSN 1877-7058. [International Conference on Manufacturing Engineering and Materials, ICMEM 2016. Nový Smokovec, 06.06.2016-10.06.2016] R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : biomedical application design * extended finite element method (XFEM) * Ti-6Al-4V alloy * stress intensity factor (SIF) * fatigue crack growth Subject RIV: JQ - Machines ; Tools http://www.sciencedirect.com/science/article/pii/S1877705816311699

  17. Method of crude ore defluoridation in hydrometallurgy of beryllium, affording fluorosilicic acid

    International Nuclear Information System (INIS)

    Samojlov, V.I.; Borsuk, A.N.; Zherin, I.I.

    2006-01-01

    Results of laboratory and industrial tests conducted at Ul'ba Metallurgical Plant on leaching bertrandite - phenacite - fluorite flotation concentrate containing ∼4 wt. % beryllium in a rotary furnace using sulfuric acid are presented. The technology is shown to provide a 7.8% reduction in the net cost of beryllium production (1 kg) in the form of technical-grade Be(OH) 2 by obviating the need of smelting beryllium concentrates and alkali fluxes. Besides, the technology permits concomitant production of H 2 SiF 6 , its commercial sales promoting a 17.6% reduction in beryllium production net cost [ru

  18. Fighting addiction's death row: British Columbia Supreme Court Justice Ian Pitfield shows a measure of legal courage

    Directory of Open Access Journals (Sweden)

    Small Dan

    2008-10-01

    Full Text Available Abstract The art in law, like medicine, is in its humanity. Nowhere is the humanity in law more poignant than in BC Supreme Court Justice Ian Pitfield's recent judgment in the legal case aimed at protecting North America's only supervised injection facility (SIF as a healthcare program: PHS Community Services Society versus the Attorney General of Canada. In order to protect the SIF from politicization, the PHS Community Services Society, the community organization that established and operates the program, along with two people living with addiction and three lawyers working for free, pro bono publico, took the federal government of Canada to court. The courtroom struggle that ensued was akin to a battle between David and Goliath. The judge in the case, Justice Pitfield, ruled in favour of the PHS and gave the Government of Canada one year to bring the Controlled Drugs and Substances Act (CDSA into compliance with the country's Charter of Rights and Freedoms. If parliament fails to do so, then the CDSA will evaporate from enforceability and law in June of 2009. Despite the fact that there are roughly twelve million intravenous drug addiction users in the world today, politics andprejudice oards harm reduction are still a barrier to the widespread application of the "best medicine" available for serious addicts. Nowhere is this clearer than in the opposition by conservative Prime Minister Stephen Harper and his faithful servant, federal health minister Tony Clement, towards Vancouver's SIF ("Insite". The continued angry politicization of addiction will only lead to the tragic loss of life, as addicts are condemned to death from infectious diseases (HIV & hepatitis and preventable overdoses. In light of the established facts in science, medicine and now law, political opposition to life-saving population health programs (including SIFs to address the effects of addiction is a kind of implicit capital punishment for the addicted. This commentary

  19. Defining Efficient Stress Transfer in Binary Particle Systems Using Numerical Simulation

    Science.gov (United States)

    2016-11-01

    ESMD; and Nicholas Boone was the Technical Director for Military Engineering. The Deputy Director of ERDC-GSL was Dr. William P. Grogan and the...f tan n , f f tan   (7) where: sif = shear component of the contact force sK = shear stiffness constant Δsi = shear component of...the contact displacement φ = a force friction parameter sin = shear force unit vector Δ φ φ m c ic i n m c n m i i m K w m f tan n , m f tan

  20. Fiberglass Material Specification Test Support

    Science.gov (United States)

    1985-09-27

    samples show a significant penetration at 600 C followed by expansion of the glass-filled matrix. One expected cause for such behavior would be that...but instead showed only an expansion after 60 0 C. This behavior could be interpreted as the presence of glass fiber at or near the surface of the...wan opp4od by Wash (70/m 42 setome wes cosumed in Phue I -sIf duplicate ^- 0,5am 0"• layer). T1 Olcost Was allowed to cu to 8 espoimus. 2 not oyam, aid

  1. Analysis result for OECD benchmark on thermal fatigue problem

    International Nuclear Information System (INIS)

    Kamaya, Masayuki; Nakamura, Akira; Fujii, Yuzou

    2005-01-01

    The main objective of this analysis is to understand the crack growth behavior under three-dimensional (3D) thermal fatigue by conducting 3D crack initiation and propagation analyses. The possibility of crack propagation through the wall thickness of pipe, and the accuracy of the prediction of crack initiation and propagation are of major interest. In this report, in order to estimate the heat transfer coefficients and evaluate the thermal stress, conventional finite element analysis (FEA) is conducted. Then, the crack driving force is evaluated by using the finite element alternating method (FEAM), which can derive the stress intensity factor (SIF) under 3D mechanical loading based on finite element analysis without generating the mesh for a cracked body. Through these two realistic 3D numerical analyses, it has been tried to predict the crack initiation and propagation behavior. The thermal fatigue crack initiation and propagation behavior were numerically analyzed. The conventional FEA was conducted in order to estimate the heat transfer coefficient and evaluate the thermal stress. Then, the FEAM was conducted to evaluate the SIFs of surface single cracks and interacting multiple cracks, and crack growth was evaluated. The results are summarized as follows: 1. The heat transfer coefficients were estimated as H air = 40 W/m 2 K and H water = 5000 W/m 2 K. This allows simulation of the change in temperature with time at the crack initiation points obtained by the experiment. 2. The maximum stress occurred along the line of symmetry and the maximum Mises equivalent stress was 572 MPa. 3. By taking the effect of mean stress into account according to the modified Goodman diagram, the equivalent stress range and the number of cycles to crack initiation were estimated as 1093 MPa and 3.8x10 4 , respectively, although the tensile strength was assumed to be 600 MPa. 4. It was shown from the evaluated SIFs that longitudinal cracks can penetrate the wall of the pipe

  2. On a class of problems on interaction of stress concentrators of different types with an elastic semi-infinite plate

    Science.gov (United States)

    Mkhitaryan, S. M.

    2018-04-01

    A class of mixed boundary-value problems of mathematical theory of elasticity dealing with interaction between stress concentrators of different types (such as cracks, absolutely rigid thin inclusions, punches, and stringers) and an elastic semi-infinite plate is considered. The method of Mellin integral transformation is used to reduce solving these problems to solving singular integral equations (SIE). After the governing SIE are solved, the following characteristics of the problem are determined: tangential contact stresses under stringers, dislocation density on the crack edges, breaking stresses outside the cracks on their line of location, the stress intensity factor (SIF), crack openings, jumps of contact stresses on the edges of inclusions.

  3. Evaluación de si aplicado al suelo en el crecimiento, absorción y severidad de enfermedades en vivero de palma aceitera

    Directory of Open Access Journals (Sweden)

    Gabriel Garbanzo

    2018-01-01

    Full Text Available Se evaluó el efecto de diferentes fuentes de Si en la severidad de enfermedades foliares (CNF en plantas de vivero de palma aceitera (Elaeis guinensis en el Pacífico Sur de Costa Rica. Las fuentes de silicio consistieron en la aplicación de 30 g de SiO2 por bolsa de 20,4 L de 2 fuentes de serpentinas (Simag y SMg, una fuente de diatomitas (SiF, una fuente soluble (SKH y 177 g por bolsa de SiO2 de un feldespato (Llane mezclado en un Inceptisol éutrico. El diseño experimental fue de bloques completos al azar con 6 tratamientos y 4 repeticiones. Se evaluó a los 85, 127, 176, 219, 261, y 304 dds el crecimiento de las plantas y % de severidad de CNF. Además, se realizaron análisis químicos de suelos y foliares en el tiempo, se evaluó el peso seco de plantas y se calculó la absorción de nutrimentos. Se encontró que el tratamiento SiF mostró mayor tolerancia a CNF significativamente (a:0,05 en comparación al testigo, mientras que la fuente Simag mostró un mayor crecimiento. El Si presentó mayor absorción en Simag, test, SMg, SiF y fueron significativas diferentes con respecto al SKH y Llane. El SKH en suelo fue el único tratamiento que aumentó los niveles de Si por arriba de los 200 mg.l-1. A los 300 dds, el análisis de componentes principales correlacionó la severidad con las concentraciones de Ca en el suelo y mostró un comportamiento inverso a los contenidos de Zn, K, P, Mn y en el tiempo. Se concluye que el Si en este suelo no presentó un efecto directo sobre el control de CNF, pero la fuente de diatomitas (SiF mostró mayor tolerancia, debido a que la enmienda facilita la absorción de micronutrimentos (Zn al mejorar la nutrición de la planta. Asimismo, se encontró que la fuente SKH logró aumentar las concentraciones de Si en el suelo.

  4. Relationship of the Williams-Poulios and Manning-Rosen Potential Energy Models for Diatomic Molecules

    Science.gov (United States)

    Jia, Chun-Sheng; Liang, Guang-Chuan; Peng, Xiao-Long; Tang, Hong-Ming; Zhang, Lie-Hui

    2014-06-01

    By employing the dissociation energy and the equilibrium bond length for a diatomic molecule as explicit parameters, we generate an improved form of the Williams-Poulios potential energy model. It is found that the negative Williams-Poulios potential model is equivalent to the Manning-Rosen potential model for diatomic molecules. We observe that the Manning-Rosen potential is superior to the Morse potential in reproducing the interaction potential energy curves for the {{a}3 Σu+} state of the 6Li2 molecule and the {{X}1 sum+} state of the SiF+ molecule.

  5. Análisis y diseño de un sistema en ambiente Web para control de inventarios en negocios de comida gourmet, aplicando bases de datos distribuidas

    OpenAIRE

    Albuja Espinoza, Marcelo Patricio

    2010-01-01

    El programa SIF, creado mediante la implementación de herramientas como : Visual Studio 2005, Ajax e Infragestic, permite el manejo y control de las existencias de productos y materias primas de una empresa orientada al servicio de preparación de alimentos. Gracias a la tecnología web, el usuario puede acceder al aplicativo desde cualquier ubicación, menteniendo la información actualizada, entre las bases de datos que se pueden encontrar en el mismo o en diferentes servidores, permitiendo un ...

  6. Analysis of interfacial crack propagation under asymmetric loading in anisotropic materials

    International Nuclear Information System (INIS)

    Pryce, L; Mishuris, G; Morini, L

    2013-01-01

    This paper considers a steady-state crack propagating along an interface between dissimilar orthotropic materials under an asymmetric load. Although most of the known results so far deal with symmetric loading, it has been shown recently that a significant asymmetry in the applied loading may lead to a pronounced effect in terms of the values of the SIFs. The aim of the paper is to extend these results from the static case to a moving crack. In particular, we show the significance of the asymmetry of the loading for computing the energy release rate

  7. Amazing grace: Vancouver's supervised injection facility granted six-month lease on life

    Directory of Open Access Journals (Sweden)

    Small Dan

    2008-01-01

    Full Text Available Abstract Addiction should be a matter, primarily, for the Chief of Medicine rather than the Chief of Police. While internationally renowned for its social kindness, Canada has not been without its share of disgraceful political mistakes in the not too distant past. Regrettably, there are many shameful events in Canada that have unfolded in the name of public policy including the banishment without medical treatment of Chinese Canadians living with leprosy to die on D'Arcy and Bentinck Islands in British Columbia while European Canadians stricken similarly enjoyed healthcare on the mainland as well as the eternally haunting treatment of people of aboriginal ancestry who were without full voting privileges in some parts of Canada until 1965 and abandoned to encampments, reserves, that paralleled South African apartheid. In due course, these public policies have come to be understood as horrific in retrospect. Many have all met with a remorseful fate where a future Prime Minister is held to public account for the sad excesses of an earlier generation. With respect to North America's only supervised injection facility (SIF, a medical program aimed at reducing fatal overdoses and infections (HIV, HCV in injection drug users, Canada's Prime Minister Stephen Harper holds the ability to forestall a similarly heartrending fate in his political hands. The SIF currently has a temporary exemption from Canada's "Controlled Drugs and Substances Act" in order to operate until June of 2008. As such, the fate of the SIF is politically determined each time behind closed doors by the Prime Minister and his ministers. Sadly, the Prime Minister appears lost at present, content to ignore the scientific and medical evidence on the matter of population health. In light of the vast medical evidence accumulated on Vancouver's SIF, the fate of injection facilities needs to be taken out of the political realm entirely. I am hoping that the Prime Minister will be found, see

  8. The Pursuit of K: Reflections on the Current State-of-the-Art in Stress Intensity Factor Solutions for Practical Aerospace Applications

    Science.gov (United States)

    CraigMcClung, R.; Lee, Yi-Der; Cardinal, Joseph W.; Guo, Yajun

    2012-01-01

    The elastic stress intensity factor (SIF, commonly denoted as K) is the foundation of practical fracture mechanics (FM) analysis for aircraft structures. This single parameter describes the first-order effects of stress magnitude and distribution as well as the geometry of both structure/component and crack. Hence, the calculation of K is often the most significant step in fatigue analysis based on FM. This presentation will provide several reflections on the current state-of-the-art in SIF solution methods used for practical aerospace applications, including a brief historical perspective, descriptions of some recent and ongoing advances, and comments on some remaining challenges. Newman and Raju made significant early contributions to practical structural analysis by developing closed-form SIF equations for surface and corner cracks in simplified geometries, often based on empirical fits of finite element (FE) solutions. Those solutions (and others like them) were sometimes revised as new analyses were conducted or limitations discovered. The foundational solutions have exhibited striking longevity, despite the relatively "coarse" FE models employed many decades ago. However, in recent years, the accumulation of different generations of solutions for the same nominal geometry has led to some confusion (which solution is correct?), and steady increases in computational capabilities have facilitated the discovery of inaccuracies in some (not all!) of the legacy solutions. Some examples of problems and solutions are presented and discussed, including the challenge of maintaining consistency with legacy design applications. As computational power has increased, the prospect of calculating large numbers of SIF solutions for specific complex geometries with advanced numerical methods has grown more attractive. Fawaz and Andersson, for example, have been generating literally millions of new SIF solutions for different combinations of multiple cracks under simplified

  9. Viability of microencapsulated Lactobacillus casei in synbiotic mayonnaise

    Directory of Open Access Journals (Sweden)

    Lieu, M.D.

    2017-07-01

    Full Text Available In this study, whey protein, maltodextrin and GOS (Galacto-oligosaccharides used as microencapsulating agents to protect Lactobacillus casei during spray-drying and mayonnaise storage. The morphology of microcapsules, pH charges, the survival rate during mayonnaise storage as well as survival in simulated gastric fluid (SGF and intestinal fluid (SIF was tested in this study. The results indicated that whey protein showed a protective effect better than maltodextrin during spray-drying. The particles showed spherical shape and typical concavity of all samples and encapsulating agents were not affected by the size and surface structure of particles. The pH charges were not significantly different in all mayonnaise samples in this test. The viability of free cell L. casei after 6 weeks storage was significant decrease about 4 log CFU/g compared to 1.55 to 3.27 log CFU/g in the mayonnaise samples containing microcapsules in which maltodextrin showed the lowest of L. casei survival rate. In SGF and SIF conditions, maltodextrin act as prebiotic sufficiently which do not need adding GOS. The combination of whey protein and maltodextrin in which maltodextrin plays a role as supporting agents for the spray-drying process as well as prebiotic potential, while whey protein with high buffer property which enhancing the survival rate of L. casie in low pH.

  10. N1-(Thiophen-2-ylmethyl-N3,N3-bis[3-(thiophen-2-ylmethylammoniopropyl]propane-1,3-diammonium hexafluoridosilicate methanol trisolvate

    Directory of Open Access Journals (Sweden)

    Md. Alamgir Hossain

    2013-12-01

    Full Text Available In the title compound, C24H40N4S34+·2SiF62−·3CH3OH, the central tertiary amine function is protonated and is connected to three thiophen-2-ylmethylamino-n-propyl groups, forming the arms of a T-shaped cation that has two pockets. Each arm contains one protonated secondary amine function, and each pocket is occupied by one SiF62− anion bonded via two N—H...F interactions with the protonated amine group on the middle arm, while two methanol solvent molecules are N—H...O hydrogen-bonded with the other secondary protonated amine groups on the side arms. Weak O—H...O and O—H...F hydrogen bonds between the solvent molecules and between the solvent molecules and the anions, respectively, are also observed. All three thiophene groups in the arms are disordered over two sets of sites, with occupancy ratios of 0.828 (3:0.172 (3, 0.910 (2:0.090 (2 and 0.890 (3:0.110 (3.

  11. Structural And Energetic Changes of Si (100 Surface With Fluorine in Presence of Water – A Density Functional Study

    Directory of Open Access Journals (Sweden)

    Takeo Ebina

    2001-05-01

    Full Text Available Abstract: We report density functional electronic structure calculations to monitor the change in the surface characteristics of the Si (100-2x1 surface after fluorination followed by interaction with water. Embedded finite silicon clusters are used to model an extended Si (100-2x1 surface. Two high symmetry pathways and subsequent adsorption sites were examined: (i adsorption of an fluorine atom directing onto a silicon dangling bond to form a monocoordinated fluorine atom (ii adsorption of a fluorine atom directing on top of silicon dimer to form a bridging dicoordinated fluorine atom. However, in the later case we find that no barrier exists for the bridging fluorine atom to slide towards silicon dimer dangling bond to form more stable mono coordinated Si-F bond. We calculated activation barriers and equilibrium surface configuration as a function of fluorine coverage upto 2.0 ML. We compared the stability of the fluorinated surface. The results were compared with existing experimental and theoretical results. The reaction of water with HF treated Si surface is monitored. It produces, as a first step, the exchange of Si-F with water to form Si-OH groups reducing the concentration of the fluorine on the surface, followed by a rapture of Si-Si bonds and finally the Si-O-Si bridge formation in the lattice.

  12. Anti-nutritional factors and digestibility of protein in Cayocar brasiliense seeds

    Directory of Open Access Journals (Sweden)

    Virgínia Campos SILVESTRINI

    2017-10-01

    Full Text Available Abstract The Brazilian Cerrado presents a wide variety of natural products, including the Pequi (Caryocar brasiliense. The important factor that determines the dietary and nutritional ideality of protein is degestitibility. This work aims to evaluate the protein digestibility of Pequi seeds and the presence of anti-nutritional factors. The protein Pequi almonds were extracted, toasted and untoasted. Evaluation digestibility was structurally characterized by SDS-PAGE 15%, which can be used to analyze simulated gastric fluid (SFG and digestion in intestinal fluid (SFI in the presence of pepsin and trypsin/chymotrypsin. The extract from Pequi almonds showed inhibitory activity and was not detected hemagglutination. The intensity of the bands according to 2S albumins, after heat treatment, did not decrease in comparison to the condition native, significantly. In the crisp crude extract, which was incubated under SGF and SIF, the intensity of the corresponding bands at 8 and 3 kDa was resistant to SGF and indigestible after 4 hours under SIF. The characterization of Pequi almonds demonstrated that the product of the crude extract has anti-nutritional factors, which were confirmed by evaluating digestibility.

  13. Risk analysis of in-service pressure piping containing defects

    International Nuclear Information System (INIS)

    Lin, Y.C.; Xie, Y.J.; Wang, X.H.; Luo, H.

    2004-01-01

    The reliability of pressure piping containing defects is important in engineering. The failure probability of pressure piping containing defects may be used as a guide to the most economic deployment of resources on maintenance, inspection and repair. This paper presents a probabilistic assessment methodology for in-service pressure piping containing defects, which is especially designed for programming. It is based on three assessment codes, BS 7910, R6 and SAPV-99, considering uncertainties in operating loadings, flaw sizes, material fracture toughness and flow stress. A general sampling computation method of stress intensity factor (SIF), in the form of the relationship between SIF and axial force and bending moment and torsion, is adopted. This relationship has been successfully used in developing software, Safety Assessment System of In-service Pressure Piping Containing Flaws (SAPP-2003), to assess planar and non-planar flaws. A numerical example is presented to illustrate the application of SAPP-2003 for calculating the failure probabilities of separate defects and for the assessed pressure piping

  14. Gas-Solid Reaction Properties of Fluorine Compounds and Solid Adsorbents for Off-Gas Treatment from Semiconductor Facility

    Directory of Open Access Journals (Sweden)

    Shinji Yasui

    2012-01-01

    Full Text Available We have been developing a new dry-type off-gas treatment system for recycling fluorine from perfluoro compounds present in off-gases from the semiconductor industry. The feature of this system is to adsorb the fluorine compounds in the exhaust gases from the decomposition furnace by using two types of solid adsorbents: the calcium carbonate in the upper layer adsorbs HF and converts it to CaF2, and the sodium bicarbonate in the lower layer adsorbs HF and SiF4 and converts them to Na2SiF6. This paper describes the fluorine compound adsorption properties of both the solid adsorbents—calcium carbonate and the sodium compound—for the optimal design of the fixation furnace. An analysis of the gas-solid reaction rate was performed from the experimental results of the breakthrough curve by using a fixed-bed reaction model, and the reaction rate constants and adsorption capacity were obtained for achieving an optimal process design.

  15. Application of the French codes to the pressurized thermal shocks assessment

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Mingya; Wang, Rong Shan; Yu, Weiwei; Lu, Feng; Zhang, Guo Dong; Xue, Fei; Chen, Zhilin [Suzhou Nuclear Power Research Institute, Life Management Center, Suzhou (China); Qian, Guian [Paul Scherrer Institute, Nuclear Energy and Safety Department, Villigen (Switzerland); Shi, Jinhua [Amec Foster Wheeler, Clean Energy Department, Gloucester (United Kingdom)

    2016-12-15

    The integrity of a reactor pressure vessel (RPV) related to pressurized thermal shocks (PTSs) has been extensively studied. This paper introduces an integrity assessment of an RPV subjected to a PTS transient based on the French codes. In the USA, the 'screening criterion' for maximum allowable embrittlement of RPV material is developed based on the probabilistic fracture mechanics. However, in the French RCC-M and RSE-M codes, which are developed based on the deterministic fracture mechanics, there is no 'screening criterion'. In this paper, the methodology in the RCC-M and RSE-M codes, which are used for PTS analysis, are firstly discussed. The bases of the French codes are compared with ASME and FAVOR codes. A case study is also presented. The results show that the method in the RCC-M code that accounts for the influence of cladding on the stress intensity factor (SIF) may be nonconservative. The SIF almost doubles if the weld residual stress is considered. The approaches included in the codes differ in many aspects, which may result in significant differences in the assessment results. Therefore, homogenization of the codes in the long time operation of nuclear power plants is needed.

  16. Assessment of pesticide availability in soil fractions after the incorporation of winery-distillery vermicomposts.

    Science.gov (United States)

    Fernández-Bayo, J D; Romero, E; Schnitzler, F; Burauel, P

    2008-07-01

    The influence of two vermicomposts from winery and distillery wastes on the distribution of diuron in agricultural soil was studied. Physical soil fractionations at 0, 9, 27, 49 and 77 days, allowed the quantification of pesticide residues in different particle-size fractions, coarse waste (WF), sand-sized (SF), silt-sized (SiF), clay-sized (CF) and dissolved organic matter-sized fraction (DOM). The SiF made a greater contribution to the formation of non-extractable residues in unamended soil, but when vermicomposts were added, new sorption sites in WF appeared, being higher for the more humified vermicompost V2. The dissolved organic carbon (DOC) increased with the addition of vermicompost, but the concentration of the desorbed 14C-radiochemical did not increase. Non-significant increment was observed with time for the non-extractable fraction with amendments. Diuron was transformed in all samples, although less than 0.5% was mineralized. The main effect caused by vermicomposts was a reduction in the availability of diuron in soil.

  17. Analysis of anisotropic crack problems using coupled meshless and fractal finite element method

    International Nuclear Information System (INIS)

    Rao, B N; Rajesh, K N

    2010-01-01

    This paper presents a coupling technique for integrating the element-free Galerkin method (EFGM) with fractal the finite element method (FFEM) for analyzing homogeneous, anisotropic, and two dimensional linear-elastic cracked structures subjected to mixed-mode (modes I and II) loading conditions. FFEM is adopted for discretization of domain close to the crack tip and EFGM is adopted in the rest of the domain. In the transition region interface elements are employed. The proposed method combines the best features of EFGM and FFEM, in the sense that no structured mesh or special enriched basis functions are necessary and no post-processing (employing any path independent integrals) is needed to determine fracture parameters such as stress intensity factors (SIFs) and T-stress. The numerical results based on all four orthotropic cases show that SIFs and T-stress obtained using the proposed method are in excellent agreement with the reference solutions for the structural and crack geometries considered in the present study.

  18. Connecting active to passive fluorescence with photosynthesis: a method for evaluating remote sensing measurements of Chl fluorescence.

    Science.gov (United States)

    Magney, Troy S; Frankenberg, Christian; Fisher, Joshua B; Sun, Ying; North, Gretchen B; Davis, Thomas S; Kornfeld, Ari; Siebke, Katharina

    2017-09-01

    Recent advances in the retrieval of Chl fluorescence from space using passive methods (solar-induced Chl fluorescence, SIF) promise improved mapping of plant photosynthesis globally. However, unresolved issues related to the spatial, spectral, and temporal dynamics of vegetation fluorescence complicate our ability to interpret SIF measurements. We developed an instrument to measure leaf-level gas exchange simultaneously with pulse-amplitude modulation (PAM) and spectrally resolved fluorescence over the same field of view - allowing us to investigate the relationships between active and passive fluorescence with photosynthesis. Strongly correlated, slope-dependent relationships were observed between measured spectra across all wavelengths (F λ , 670-850 nm) and PAM fluorescence parameters under a range of actinic light intensities (steady-state fluorescence yields, F t ) and saturation pulses (maximal fluorescence yields, F m ). Our results suggest that this method can accurately reproduce the full Chl emission spectra - capturing the spectral dynamics associated with changes in the yields of fluorescence, photochemical (ΦPSII), and nonphotochemical quenching (NPQ). We discuss how this method may establish a link between photosynthetic capacity and the mechanistic drivers of wavelength-specific fluorescence emission during changes in environmental conditions (light, temperature, humidity). Our emphasis is on future research directions linking spectral fluorescence to photosynthesis, ΦPSII, and NPQ. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  19. Tracking diurnal changes of photosynthesis and evapotranspiration using fluorescence, gas exchange and hyperspectral remote sensing measurements

    Science.gov (United States)

    Wang, S.; Zhang, L.; Guanter, L.; Huang, C.

    2017-12-01

    Photosynthesis and evapotranspiration (ET) are the two most important activities of vegetation and make a great contribution to carbon, water and energy exchanges. Remote sensing provides opportunities for monitoring these processes across time and space. This study focuses on tracking diurnal changes of photosynthesis and evapotranspiration over soybean using multiple measurement techniques. Diurnal changes of both remote sensing-based indicators, including active and passive chlorophyll fluorescence and biophysical-related parameters, including photosynthesis rate (photo) and leaf stomatal conductance (cond), were observed. Results showed that both leaf-level steady-state fluorescence (Fs) and canopy-level solar-induced chlorophyll fluorescence were linearly correlated to photosynthetically active radiation (PAR) during the daytime. A double-peak diurnal change curve was observed for leaf-level photo and cond but not for Fs or SIF. Photo and cond showed a strong nonlinear (second-order) correlation, indicating that photosynthesis, which might be remotely sensed by SIF, has the opportunity to track short-term changes of ET. Results presented in this report will be helpful for better understanding the relationship between remote-sensing-based indices and vegetation's biophysical processes.

  20. Synthesis of an oxo trialkyl tungsten fluoride complex and its dual reactivity with silica dehydroxylated at high temperature

    KAUST Repository

    Merle, Nicolas

    2018-05-22

    The novel complex W (=O)Np3F has been prepared by fluorination of the corresponding chloride counterpart with AgBF4. The reactivity of this complex with silica dehydroxylated at 700 °C afforded a well-defined silica supported monopodal tungsten oxo trialkyl surface species (≡SiO)W (=O)Np3. The reaction proceeds both through silanolysis of the W-F bond and opening of a siloxane bridge, with formation of a Si-F fragment, thanks to the affinity of silicon for fluoride. The resulting surface species was characterized by elemental analysis, DRIFT, solid state NMR and EXAFS spectroscopy. This material presenting fluorine on its surface shows an enhanced catalytic activity in propylene self-metathesis compared to its monopodal counterpart (≡SiO)W (=O)Np3 (prepared from W (=O)Np3Cl) suggesting that the Si-F in a close vicinity to the W decreases the electron density of the W and thus increases its reactivity towards the olefinic substrate.

  1. A Comparison of Aerosolization and Homogenization Techniques for Production of Alginate Microparticles for Delivery of Corticosteroids to the Colon.

    Science.gov (United States)

    Samak, Yassmin O; El Massik, Magda; Coombes, Allan G A

    2017-01-01

    Alginate microparticles incorporating hydrocortisone hemisuccinate were produced by aerosolization and homogenization methods to investigate their potential for colonic drug delivery. Microparticle stabilization was achieved by CaCl 2 crosslinking solution (0.5 M and 1 M), and drug loading was accomplished by diffusion into blank microparticles or by direct encapsulation. Homogenization method produced smaller microparticles (45-50 μm), compared to aerosolization (65-90 μm). High drug loadings (40% wt/wt) were obtained for diffusion-loaded aerosolized microparticles. Aerosolized microparticles suppressed drug release in simulated gastric fluid (SGF) and simulated intestinal fluid (SIF) prior to drug release in simulated colonic fluid (SCF) to a higher extent than homogenized microparticles. Microparticles prepared using aerosolization or homogenization (1 M CaCl 2 , diffusion loaded) released 5% and 17% of drug content after 2 h in SGF and 4 h in SIF, respectively, and 75% after 12 h in SCF. Thus, aerosolization and homogenization techniques show potential for producing alginate microparticles for colonic drug delivery in the treatment of inflammatory bowel disease. Copyright © 2016 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.

  2. Theoretical and numerical studies of crack initiation and propagation in rock masses under freezing pressure and far-field stress

    Directory of Open Access Journals (Sweden)

    Yongshui Kang

    2014-10-01

    Full Text Available Water-bearing rocks exposed to freezing temperature can be subjected to freeze–thaw cycles leading to crack initiation and propagation, which are the main causes of frost damage to rocks. Based on the Griffith theory of brittle fracture mechanics, the crack initiation criterion, propagation direction, and crack length under freezing pressure and far-field stress are analyzed. Furthermore, a calculation method is proposed for the stress intensity factor (SIF of the crack tip under non-uniformly distributed freezing pressure. The formulae for the crack/fracture propagation direction and length of the wing crack under freezing pressure are obtained, and the mechanism for coalescence of adjacent cracks is investigated. In addition, the necessary conditions for different coalescence modes of cracks are studied. Using the topology theory, a new algorithm for frost crack propagation is proposed, which has the capability to define the crack growth path and identify and update the cracked elements. A model that incorporates multiple cracks is built by ANSYS and then imported into FLAC3D. The SIFs are then calculated using a FISH procedure, and the growth path of the freezing cracks after several calculation steps is demonstrated using the new algorithm. The proposed method can be applied to rocks containing fillings such as detritus and slurry.

  3. Hydrogels based on chemically modified poly(vinyl alcohol (PVA-GMA and PVA-GMA/chondroitin sulfate: Preparation and characterization

    Directory of Open Access Journals (Sweden)

    E. C. Muniz

    2012-05-01

    Full Text Available This work reports the preparation of hydrogels based on PVA-GMA, PVA-GMA is poly(vinyl alcohol (PVA functionalized with vinyl groups from glycidyl methacrylate (GMA, and on PVA-GMA with different content of chondroitin sulfate (CS. The degrees of swelling of PVA-GMA and PVA-GMA/CS hydrogels were evaluated in distilled water and the swelling kinetics was performed in simulated gastric and intestinal fluids (SGF and SIF. PVA-GMA and PVAGMA/CS hydrogels demonstrated to be resistant on SGF and SIF fluids. The elastic modulus, E, of swollen-hydrogels were determined through compressive tests and, according to the obtained results, the hydrogels presented good mechanical properties. At last, the presence of CS enhances the hydrogel cell compatibility as gathered by cytotoxicity assays. It was concluded that the hydrogels prepared through this work presented characteristics that allow them to be used as biomaterial, as a carrier in drug delivery system or to act as scaffolds in tissue engineering as well.

  4. Using spectral characteristics to interpret auroral imaging in the 731.9 nm O+ line

    Directory of Open Access Journals (Sweden)

    H. Dahlgren

    2008-07-01

    Full Text Available Simultaneous observations were made of dynamic aurora during substorm activity on 26 January 2006 with three high spatial and temporal resolution instruments: the ASK (Auroral Structure and Kinetics instrument, SIF (Spectrographic Imaging Facility and ESR (EISCAT Svalbard Radar, all located on Svalbard (78° N, 16.2° E. One of the narrow field of view ASK cameras is designed to detect O+ ion emission at 731.9 nm. From the spectrographic data we have been able to determine the amount of contaminating N2 and OH emission detected in the same filter. This is of great importance to further studies using the ASK instrument, when the O+ ion emission will be used to detect flows and afterglows in active aurora. The ratio of O+ to N2 emission is dependent on the energy spectra of electron precipitation, and was found to be related to changes in the morphology of the small-scale aurora. The ESR measured height profiles of electron densities, which allowed estimates to be made of the energy spectrum of the precipitation during the events studied with optical data from ASK and SIF. It was found that the higher energy precipitation corresponded to discrete and dynamic features, including curls, and low energy precipitation corresponded to auroral signatures that were dominated by rays. The evolution of these changes on time scales of seconds is of importance to theories of auroral acceleration mechanisms.

  5. Nonlinear demodulation and channel coding in EBPSK scheme.

    Science.gov (United States)

    Chen, Xianqing; Wu, Lenan

    2012-01-01

    The extended binary phase shift keying (EBPSK) is an efficient modulation technique, and a special impacting filter (SIF) is used in its demodulator to improve the bit error rate (BER) performance. However, the conventional threshold decision cannot achieve the optimum performance, and the SIF brings more difficulty in obtaining the posterior probability for LDPC decoding. In this paper, we concentrate not only on reducing the BER of demodulation, but also on providing accurate posterior probability estimates (PPEs). A new approach for the nonlinear demodulation based on the support vector machine (SVM) classifier is introduced. The SVM method which selects only a few sampling points from the filter output was used for getting PPEs. The simulation results show that the accurate posterior probability can be obtained with this method and the BER performance can be improved significantly by applying LDPC codes. Moreover, we analyzed the effect of getting the posterior probability with different methods and different sampling rates. We show that there are more advantages of the SVM method under bad condition and it is less sensitive to the sampling rate than other methods. Thus, SVM is an effective method for EBPSK demodulation and getting posterior probability for LDPC decoding.

  6. Research insights and insides:"Science-in-Fiction" as a contribution to the Third Culture Concepts.

    Science.gov (United States)

    Erren, Thomas C; Falaturi, Puran

    2009-05-01

    Here we suggest to encourage more "Science-In-Fiction" [SIF], a genre which has been explored by Carl Djerassi since the late 1980s with the intent to convey science in writing beyond traditional publication categories and "to smuggle scientific facts into the consciousness of a scientifically illiterate public". In our view, SIF can serve 3 purposes: (a) inform the public at large about scientific findings, ethics and procedures; (b) infuse lay readers with interest in scientific endeavours; (c) enable the general population to better evaluate and judge scientific conduct, results and implications. While it would be desirable to have more scientists write about their own (like Watson and Maguejo) and others' discoveries (like Voltaire and Perutz), this expectation is not realistic. Indeed, some scientists may not want to share and write about their experiences and others simply should not. As one recipe for informing the lay public and instigating interest in research insights and insides, science-in-fiction such as Dr. Djerassi's novels could be written and read. This may contribute to the The Third Culture Concepts envisaged by Snow in the 1960s and elaborated by Brockman in 1995.

  7. Outcome of long-axis percutaneous sacroplasty for the treatment of sacral insufficiency fractures with a radiofrequency-induced, high-viscosity bone cement

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, Katrin [University of Frankfurt, Department of Diagnostic and Interventional Radiology, Frankfurt (Germany); J. W. Goethe University of Frankfurt, Institute for Diagnostic and Interventional Radiology, Frankfurt (Germany); Zangos, Stephan; Vogl, Thomas J. [University of Frankfurt, Department of Diagnostic and Interventional Radiology, Frankfurt (Germany); Mack, Martin G. [Radiology Munich, Munich (Germany); Marzi, Ingo [University of Frankfurt, Department of Trauma, Hand and Reconstructive Surgery, Frankfurt (Germany)

    2014-04-15

    Our goal was to assess the technical results in patients who underwent long-axis sacroplasty for the treatment of sacral insufficiency fractures (SIF) by radiofrequency-induced high-viscosity bone cement augmentation. Twelve patients with bilateral sacral fractures were treated by augmentation with radiofrequency-activated, high-viscosity polymethylmethacrylate (PMMA) bone cement under local anesthesia. CT-guided sacroplasty was performed by using a long-axis approach through a single entry point. Thirty-six vertebrae were treated in 12 sessions under a combination of CT and fluoroscopic guidance using a bilateral access and a cavity-creating osteotome prior to remote-controlled, hydraulically driven cement injection. The visual analogue scale (VAS) score before sacroplasty and at 1 and 3 months after the treatment was obtained. PMMA leaks were evaluated retrospectively using the post-interventional CT. The mean amount of high-viscosity PMMA injected per patient was 7.8 ml. No major adverse events were observed. In the first 4 days after the procedure, the mean VAS score decreased from 8.1 ± 1.9 to mean 3.1 ± 1.2 and was followed by a gradual but continuous decrease throughout the rest of the follow-up period at 24 weeks (mean 2.2 ± 1.1) and 48 weeks (mean 2.1 ± 1.4). CT fluoroscopy-guided sacral augmentation was safe and effective in all 12 patients with osteoporotic SIF. (orig.)

  8. Plasmonics and single-molecule detection in evaporated silver-island films

    Energy Technology Data Exchange (ETDEWEB)

    Moula, G.; Aroca, R.F. [Materials and Surface Science Group, University of Windsor, Ontario (Canada); Rodriguez-Oliveros, R.; Sanchez-Gil, J.A. [Instituto de Estructura de la Materia, Consejo Superior de Investigaciones Cientificas, Serrano 121, 28006 Madrid (Spain); Albella, P. [Centro de Fisica de Materiales (CSIC-UPV/EHU) and Donostia International Physics Center (DIPC), 20018 Donostia, San Sebastian (Spain)

    2012-11-15

    The plasmonic origin of surface-enhanced Raman scattering (SERS) leads to the concept of hotspots and plasmon coupling that can be realized in the interstitial regions, or on specially engineered, silver and gold nanostructures. It is also possible to achieve spatial locations of high local field or hotspots on silver-island films (SIF) allowing single-molecule detection (SMD). When a single monomolecular layer coating the SIFs contains dye molecules dispersed in it, single-molecule impurities, (with an average of one hundred dye molecules in 1 {mu}m{sup 2}, which is the field of view of the micro-Raman system), SMD is observed as a rare statistical event. Here, the SMD results for silver-island films are presented, with the same nominal mass thickness, but differing in the localized surface plasmon resonance that is a function of the temperature of substrate during deposition. A blue-shifted plasmon can be seen as a decrease in plasmon coupling for deposition at higher temperature. A simple two-particle model for localized plasmon resonance coupling calculations, including the shape and substrate effects seems to explain the trend of observations. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Autonomous Acqisition of Science Grade Spectra From UAS's

    Science.gov (United States)

    Mandl, D.; Campbell, P. K. E.; Sohlberg, R. A.; Ong, L.; Cappelaere, P. G.

    2017-12-01

    We assembled a payload box which contains a QE Pro and a Flame hyperspectral instruments. The payload was mounted on a DJI Matrice 600 drone. The total weight of the drone and the payload was 38 lbs. It was flown over a United States Department of Agricultural (USDA) research field where corn and soybeans were grown. The fields were subdivided into areas that had a variety of treatments such as low nitrogen and high nitrogen. The research is centered on correlating the treatments with the year-end crop yields. Our effort was to monitor spectral data to recognize photosynthetic activity via proxies such as solar induced fluorescence (SIF). To detect SIF requires optimized spectra which is normalized into reflectance. We perform the optimization routine onboard. The intent is to demonstrate a viable measurement campaign that would enable a researcher to measure the fields diurnally over a growing season. What we found out is that there was more complexity to trying to make this happen then we originally thought. For one thing, we had limited battery life, limited payload capacity and sometimes the cloud cover did not cooperate. So the question was how to intelligently apply the resources using some onboard processing and software. Our long term vision is to have multiple drones act as an intelligent cluster and self-manage their own deployment at multiple locations and multiple altitudes, auto-adjustments and intelligent management of errors. This presentation will go over lessons learned, achievements and future directions.

  10. Formation of stress/strain cycles for analytical assessment of fatigue crack initiation and growth

    International Nuclear Information System (INIS)

    Tashkinov, A.V.

    2005-01-01

    This paper discusses standard techniques for setting up cycles of stresses, strains and stress intensity factors (SIF) for use in analysing the fatigue characteristics of crack-free components or the fatigue crack growth if crack-like flaws are present. A number of improved techniques are proposed. An enhanced procedure for analytical description of true metal stress-strain curves, covering plastic effects, is presented. This procedure involves standard physical and mechanical properties of the metal in question, such as ultimate stress, yield stress and elasticity modulus. It is emphasized that the currently practiced rain-flow method of design cycle formation, which is effective for an actual (truly known) cyclic loading history, is not suitable for a projected (anticipated) history, as it leaves out of account possible variations in the sequence of operating conditions. Improved techniques for establishing design stress/strain and SIF cycles are described, which make allowance for the most unfavourable sequence of events in the projected loading history. The paper points to a basic difference in the methods of design cycle formation, employed in assessment of the current condition of a component (with the actual history accounted for) and in estimation of the residual lifetime or life extension (for a projected history). (authors)

  11. Fatigue crack growth behaviour of semi-elliptical surface cracks for an API 5L X65 gas pipeline under tension

    Science.gov (United States)

    Shaari, M. S.; Akramin, M. R. M.; Ariffin, A. K.; Abdullah, S.; Kikuchi, M.

    2018-02-01

    The paper is presenting the fatigue crack growth (FCG) behavior of semi-elliptical surface cracks for API X65 gas pipeline using S-version FEM. A method known as global-local overlay technique was used in this study to predict the fatigue behavior that involve of two separate meshes each specifically for global (geometry) and local (crack). The pre-post program was used to model the global geometry (coarser mesh) known as FAST including the material and boundary conditions. Hence, the local crack (finer mesh) will be defined the exact location and the mesh control accordingly. The local mesh was overlaid along with the global before the numerical computation taken place to solve the engineering problem. The stress intensity factors were computed using the virtual crack closure-integral method (VCCM). The most important results is the behavior of the fatigue crack growth, which contains the crack depth (a), crack length (c) and stress intensity factors (SIF). The correlation between the fatigue crack growth and the SIF shows a good growth for the crack depth (a) and dissimilar for the crack length (c) where stunned behavior was resulted. The S-version FEM will benefiting the user due to the overlay technique where it will shorten the computation process.

  12. Analytical Solution for Stress Field and Intensity Factor in CSTBD under Mixed Mode Conditions

    Directory of Open Access Journals (Sweden)

    Najaf Ali Ghavidel

    2014-06-01

    Full Text Available Considering the fact that rocks fail faster under tensile stress, rock tensile strength is of greatimportance in applications such as blasting, rock fragmentation, slope stability, hydraulic fracturing,caprock integrity, and geothermal energy extraction. There are two direct and indirect methods tomeasure tensile strength. Since direct methods always encompass difficulties in test setup, indirectmethods, specifically the Brazilian test, have often been employed for tensile strength measurement.Tensile failure is technically attributed to crack propagation in rock. Fracture mechanics hassignificant potential for the determination of crack behaviour as well as propagation pattern. To applyBrazilian tests, cracked disc geometry has been suggested by the International Society for RockMechanics ISRM. Accordingly, a comprehensive study is necessary to evaluate stress field and stressintensity factor (SIF around the crack in the centre of the specimen. In this paper, superpositionprinciple is employed to solve the problem of cracked straight-through Brazilian disc (CSTBD, usingtwo methods of dislocation and complex stress function. Stress field and SIF in the vicinity of thecrack tip are then calculated. With the proposed method, the magnitude of critical load for crackinitiation in structures can be predicted. This method is valid for any crack of any arbitrary length andangle. In addition, numerical modelling has been carried out for the Brazilian disc. Finally, theanalytical solution has been compared with numerical modelling results showing the same outcomefor both methods.

  13. Hydroconversion of Waste Cooking Oil into Green Biofuel over Hierarchical USY-Supported NiMo Catalyst: A Comparative Study of Desilication and Dealumination

    Directory of Open Access Journals (Sweden)

    Zongwei Zhang

    2017-09-01

    Full Text Available The hydroconversion of waste cooking oil into hydrocarbon fuel was investigated over the hierarchical USY zeolite-supported NiMo catalysts which were prepared by dealumination ((NH42SiF6/desilication (NaOH. The physical and acidity properties of the hierarchical catalysts were characterized by X-ray diffraction (XRD, the Brunauer-Emmett-Teller (BET infrared spectroscopy of adsorbed pyridine (Py-IR, ammonia temperature-programmed desorption (NH3-TPD, and H2 temperature-programmed reduction (H2-TPR. The Brønsted/Lewis (B/L acid distribution was little affected by dealumination and the acid density decreased significantly. However, the highly-desilicated catalysts decreased the B/L ratio obviously. Therefore, many more Mo species in the NiMoO4− and MoO3 phases were produced in the AHFS-treated catalysts, while more high-valence-state Mo species in the NiMoO4− phase were formed in the NaOH-treated catalysts. The AHFS-treated catalysts showed higher catalytic activity and better DCO2 selectivity and selective cracking for jet fuel. The 42.3% selectivity of jet fuel and 13.5% selectivity of jet-range aromatics was achieved over the 8 wt % (NH42SiF6-treated catalyst with 67% DCO2 selectivity.

  14. Micronutrient Composition of 35 Food Fishes from India and Their Significance in Human Nutrition.

    Science.gov (United States)

    Mohanty, Bimal P; Sankar, T V; Ganguly, Satabdi; Mahanty, Arabinda; Anandan, R; Chakraborty, Kajal; Paul, B N; Sarma, Debajit; Dayal, J Syama; Mathew, Suseela; Asha, K K; Mitra, Tandrima; Karunakaran, D; Chanda, Soumen; Shahi, Neetu; Das, Puspita; Das, Partha; Akhtar, Md Shahbaz; Vijayagopal, P; Sridhar, N

    2016-12-01

    The micronutrients (vitamins and minerals) are required in small amounts but are essential for health, development, and growth. Micronutrient deficiencies, which affect over two billion people around the globe, are the leading cause of many ailments including mental retardation, preventable blindness, and death during childbirth. Fish is an important dietary source of micronutrients and plays important role in human nutrition. In the present investigation, micronutrient composition of 35 food fishes (includes both finfishes and shellfishes) was investigated from varying aquatic habitats. Macrominerals (Na, K, Ca, Mg) and trace elements (Fe, Cu, Zn, Mn, Se) were determined by either atomic absorption spectroscopy (AAS) or inductively coupled plasma mass spectrometry (ICP-MS)/atomic emission spectrometry (ICP-AES). Phosphorus content was determined either spectrophotometrically or by ICP-AES. Fat-soluble vitamins (A, D, E, K) were analyzed by high-performance liquid chromatography (HPLC). The analysis showed that, in general, the marine fishes were rich in sodium and potassium; small indigenous fishes (SIFs) in calcium, iron, and manganese; coldwater fishes in selenium; and the brackishwater fishes in phosphorous. The marine fishes Sardinella longiceps and Epinephelus spp. and the SIFs were rich in all fat-soluble vitamins. All these recommendations were made according to the potential contribution (daily value %) of the species to the recommended daily allowance (RDA). Information on the micronutrients generated would enhance the utility of fish in both community and clinical nutrition.

  15. The coupled effects of thickness and delamination on cracking resistance of X70 pipeline steel

    International Nuclear Information System (INIS)

    Guo, W.; Dong, H.; Lu, M.; Zhao, X.

    2002-01-01

    The effects of thickness and delamination on the fracture toughness and stable crack growth behaviour of high-toughness pipeline steels were investigated experimentally by use of compact tension specimens with thicknesses of 3-15 mm cut from a 17 mm-thick wall pipe. Material resistance curves were generated based on the stress intensity factor (SIF) K and the J-integral. The critical SIF K c and the J-resistance curves are found to be independent of thickness as the delaminations near the crack tip within the material reduce the out-of-plane constraint in thicker specimens. Both fracture mechanism and mechanics analyses shown that the fracture behaviour of the steel is controlled by the strong-coupled effects of thickness and delaminations. With increasing thickness, the out-of-plane stress constraint increases and causes the inclusion separation, growth and coalescence to form delaminations of different sizes before the main crack initiates. The delaminations in turn, reduce the out-of-plane constraint and thus, the thickness effect upon fracture. The advantages and disadvantages of delaminations in a safety assessment of pipelines are also discussed based on three-dimensional fracture theory

  16. Progress in Remote Sensing of Photosynthetic Activity over the Amazon Basin

    Science.gov (United States)

    Resende de Sousa, Celio Helder; Hilker, Thomas; Waring, Richard; Mendes De Moura, Yhasmin; Lyapustin, Alexei

    2017-01-01

    Although quantifying the massive exchange of carbon that takes place over the Amazon Basin remains a challenge, progress is being made as the remote sensing community moves from using traditional, reflectance-based vegetation indices, such as the Normalized Difference Vegetation Index (NDVI), to the more functional Photochemical Reflectance Index (PRI). This new index, together with satellite-derived estimates of canopy light interception and Sun-Induced Fluorescence (SIF), provide improved estimates of Gross Primary Production (GPP). This paper traces the development of these new approaches, compares the results of their analyses from multiple years of data acquired across the Amazon Basin and suggests further improvements in instrument design, data acquisition and processing. We demonstrated that our estimates of PRI are in generally good agreement with eddy-flux tower measurements of photosynthetic light use efficiency (epsilon) at four sites in the Amazon Basin: r(exp 2) values ranged from 0.37 to 0.51 for northern flux sites and to 0.78for southern flux sites. This is a significant advance over previous approaches seeking to establish a link between global-scale photosynthetic activity and remotely-sensed data. When combined with measurements of Sun-Induced Fluorescence (SIF), PRI provides realistic estimates of seasonal variation in photosynthesis over the Amazon that relate well to the wet and dry seasons. We anticipate that our findings will steer the development of improved approaches to estimate photosynthetic activity over the tropics.

  17. Design, Synthesis and Evaluation of N13-Substituted Evodiamine Derivatives against Human Cancer Cell Lines

    Directory of Open Access Journals (Sweden)

    Senchuan Song

    2013-12-01

    Full Text Available Attempting to improve the anticancer activity and solubility of evodiamine in simulated gastric fluid (SGF and simulated intestinal fluid (SIF solutions, thirty-eight N13-substituted evodiamine derivatives were designed, synthesized and tested for antitumor activities against six kinds of human cancer cell lines, namely prostate cancer (DU-145 and PC-3, lung cancer (H460, breast cancer (MCF-7, colon cancer (HCT-5 and glioblastoma (SF-268. The solubility of these compounds in SGF and SIF solutions was evaluated, and apoptosis induced by 2-2, 2-3, 2-16 and 3-2 was determined. The results showed: (1 among all compounds examined, 2-16 showed the highest antitumor activity and a broader spectrum of activity, with IC50 values ranging from 1–2 µM; (2 their solubility was obviously improved; (3 2-3, 2-16 and 3-2 had a significant impact inducing apoptosis in some cancer cell lines. The preliminary structure-activity relationships of these derivatives were discussed.

  18. A Monte Carlo Ray Tracing Model to Improve Simulations of Solar-Induced Chlorophyll Fluorescence Radiative Transfer

    Science.gov (United States)

    Halubok, M.; Gu, L.; Yang, Z. L.

    2017-12-01

    A model of light transport in a three-dimensional vegetation canopy is being designed and evaluated. The model employs Monte Carlo ray tracing technique which offers simple yet rigorous approach of quantifying the photon transport in a plant canopy. This method involves simulation of a chain of scattering and absorption events incurred by a photon on its path from the light source. Implementation of weighting mechanism helps avoid `all-or-nothing' type of interaction between a photon packet and a canopy element, i.e. at each interaction a photon packet is split into three parts, namely, reflected, transmitted and absorbed, instead of assuming complete absorption, reflection or transmission. Canopy scenes in the model are represented by a number of polygons with specified set of reflectances and transmittances. The performance of the model is being evaluated through comparison against established plant canopy reflectance models, such as 3D Radiosity-Graphics combined model which calculates bidirectional reflectance distribution function of a 3D canopy scene. This photon transport model is to be coupled to a leaf level solar-induced chlorophyll fluorescence (SIF) model with the aim of further advancing of accuracy of the modeled SIF, which, in its turn, has a potential of improving our predictive capability of terrestrial carbon uptake.

  19. Properties of sodium borosilicate glasses/Al2O3 sintered composites containing fluorides. Gan Fukkabutsu hokei san natoriumu garasu to alumina fukugo shoketsutai no bussei

    Energy Technology Data Exchange (ETDEWEB)

    Ryu, Bonggi; Yasui, I [The Univ. of Tokyo, Tokyo (Japan). Inst. of Industrial Science

    1993-06-01

    Glass/alumina sintered composites were synthesized from sodium borosilicate glass powder containing fluorides like AlF3 and NaF3, and Al2O3, and change in material properties was examined. Glass compositions of B2O3 and Na2O greatly affected the crystal phase and material properties. Nephelin crystal phase was extracted by the reaction of Na2O, NaF2, SiO2 and Al2O3 when B/Na<1. Coefficient of thermal expansion increased with the increase of Na/Si ratio. The residual amount of fluorides of sintered materials in nitrogen atmosphere was higher than that of air, and differed with the type of fluoride. The F[sup -] of NaF is bonded with Si of glass network and forms quiet stable glass structure, whereas, F[sup -] of AlF3 reacts with Si[sup 4+] forming SiF4 which is vaporized. Sintering temperature and dielectric constant of sintered materials containing fluoride was lower than the sintered materials without fluorides addition, however, at a sintering temperature range of 100 to 150[degree]C, it was inferred that this was because of the increase in voids due to SiF4 formed in the reaction. 16 refs., 17 figs., 3 tabs.

  20. Thermogravimetric studies on the silicothermic reduction of uranium tetrafluoride under nitrogen

    International Nuclear Information System (INIS)

    Venkataramani, R.; Bhatt, Y.J.; Krishnamurthy, N.; Garg, S.P.

    1986-01-01

    This paper presents details of the experimental procedure and results obtained by thermogravimetric studies on the preparation of uranium nitrides by silicothermic reduction of uranium tetrafluoride under a nitrogen atmosphere. The folowing sequential steps are involved during the reaction: 4UF 4 +Si->4UF 3 +SiF 4 (g), 2UF 3 +Si+N 2 ->2UNF+SiF 4 (g), 4UNF+Si+N 2 ->2U 2 N 3 +SiF 4 (g), the uranium sesquintride U 2 N 3 obtained in the above process then decomposed at 1370 K under a dynamic vacuum of less than 10 -2 Tor to yield uranium mononitride of purity better than 99.9%, according to reaction 2U 2 N 3 ->4UN+N 2 (g). The chemical composition of the intermediate products formed during the sequential steps of the process, assessed by thermogravimetric and differential thermogravimetric studies, were further confirmed by chemical and X-ray analysis

  1. Water, Energy, and Carbon with Artificial Neural Networks (WECANN): a statistically based estimate of global surface turbulent fluxes and gross primary productivity using solar-induced fluorescence

    Science.gov (United States)

    Hamed Alemohammad, Seyed; Fang, Bin; Konings, Alexandra G.; Aires, Filipe; Green, Julia K.; Kolassa, Jana; Miralles, Diego; Prigent, Catherine; Gentine, Pierre

    2017-09-01

    A new global estimate of surface turbulent fluxes, latent heat flux (LE) and sensible heat flux (H), and gross primary production (GPP) is developed using a machine learning approach informed by novel remotely sensed solar-induced fluorescence (SIF) and other radiative and meteorological variables. This is the first study to jointly retrieve LE, H, and GPP using SIF observations. The approach uses an artificial neural network (ANN) with a target dataset generated from three independent data sources, weighted based on a triple collocation (TC) algorithm. The new retrieval, named Water, Energy, and Carbon with Artificial Neural Networks (WECANN), provides estimates of LE, H, and GPP from 2007 to 2015 at 1° × 1° spatial resolution and at monthly time resolution. The quality of ANN training is assessed using the target data, and the WECANN retrievals are evaluated using eddy covariance tower estimates from the FLUXNET network across various climates and conditions. When compared to eddy covariance estimates, WECANN typically outperforms other products, particularly for sensible and latent heat fluxes. Analyzing WECANN retrievals across three extreme drought and heat wave events demonstrates the capability of the retrievals to capture the extent of these events. Uncertainty estimates of the retrievals are analyzed and the interannual variability in average global and regional fluxes shows the impact of distinct climatic events - such as the 2015 El Niño - on surface turbulent fluxes and GPP.

  2. Investigation of grid performance using simple image quality tests

    Directory of Open Access Journals (Sweden)

    Dogan Bor

    2016-01-01

    Full Text Available Antiscatter grids improve the X-ray image contrast at a cost of patient radiation doses. The choice of appropriate grid or its removal requires a good knowledge of grid characteristics, especially for pediatric digital imaging. The aim of this work is to understand the relation between grid performance parameters and some numerical image quality metrics for digital radiological examinations. The grid parameters such as bucky factor (BF, selectivity (Σ, Contrast improvement factor (CIF, and signal-to-noise improvement factor (SIF were determined following the measurements of primary, scatter, and total radiations with a digital fluoroscopic system for the thicknesses of 5, 10, 15, 20, and 25 cm polymethyl methacrylate blocks at the tube voltages of 70, 90, and 120 kVp. Image contrast for low- and high-contrast objects and high-contrast spatial resolution were measured with simple phantoms using the same scatter thicknesses and tube voltages. BF and SIF values were also calculated from the images obtained with and without grids. The correlation coefficients between BF values obtained using two approaches (grid parameters and image quality metrics were in good agreement. Proposed approach provides a quick and practical way of estimating grid performance for different digital fluoroscopic examinations.

  3. Synthesis of an oxo trialkyl tungsten fluoride complex and its dual reactivity with silica dehydroxylated at high temperature

    KAUST Repository

    Merle, Nicolas; Mazoyer, Etienne; Szeto, Kai C.; Rouge, Pascal; de Mallmann, Aimery; Berrier, Elise; Delevoye, Laurent; Gauvin, Ré gis M.; Nicholas, Christopher P.; Basset, Jean-Marie; Taoufik, Mostafa

    2018-01-01

    The novel complex W (=O)Np3F has been prepared by fluorination of the corresponding chloride counterpart with AgBF4. The reactivity of this complex with silica dehydroxylated at 700 °C afforded a well-defined silica supported monopodal tungsten oxo trialkyl surface species (≡SiO)W (=O)Np3. The reaction proceeds both through silanolysis of the W-F bond and opening of a siloxane bridge, with formation of a Si-F fragment, thanks to the affinity of silicon for fluoride. The resulting surface species was characterized by elemental analysis, DRIFT, solid state NMR and EXAFS spectroscopy. This material presenting fluorine on its surface shows an enhanced catalytic activity in propylene self-metathesis compared to its monopodal counterpart (≡SiO)W (=O)Np3 (prepared from W (=O)Np3Cl) suggesting that the Si-F in a close vicinity to the W decreases the electron density of the W and thus increases its reactivity towards the olefinic substrate.

  4. Abatement of global warming gas emissions from semiconductor manufacturing processes by non-thermal plasma-catalyst systems

    International Nuclear Information System (INIS)

    Chang, J-S.; Urashima, K.

    2009-01-01

    Emission of various hazardous air pollutants (HAPs) and greenhouse gases including perfluoro-compounds (PFCs) from semiconductor industries may cause significant impact on human health and the global environment, has attracted much public attention. In this paper, an application of nonthermal plasma-adsorbent system for a removal of PFCs emission from semiconductor process flue gases is experimentally investigated. The non-thermal plasma reactor used is the ferro-electric packed-bed type barrier discharge plasma and adsorbent reactor used is Zeolite bed reactor. The results show that for a simulated semiconductor process flue gas with C 2 F 6 (2000ppm)/ CF 4 (1000ppm)/ N 2 O(1000ppm)/ N 2 / Air mixture, 54% of C 2 F 6 and 32% of CF 4 were decomposed by the plasma reactor and 100% of C 2 F 6 and 98% of CF 4 were removed by plasma reactor/Zeolite adsorbent hybrid system. For a simulated semiconductor process flue gas with NF 3 (2000ppm)/ SiF 4 (1000ppm)/ N 2 O(200ppm)/ N 2 / Air mixture, 92% of NF 3 and 32% of SiF 4 were decomposed by the plasma reactor and total (100%) removal of the pollutant gases was achieved by plasma reactor/Zeolite adsorbent hybrid system. (author)

  5. Application of the French Codes to the Pressurized Thermal Shocks Assessment

    Directory of Open Access Journals (Sweden)

    Mingya Chen

    2016-12-01

    Full Text Available The integrity of a reactor pressure vessel (RPV related to pressurized thermal shocks (PTSs has been extensively studied. This paper introduces an integrity assessment of an RPV subjected to a PTS transient based on the French codes. In the USA, the “screening criterion” for maximum allowable embrittlement of RPV material is developed based on the probabilistic fracture mechanics. However, in the French RCC-M and RSE-M codes, which are developed based on the deterministic fracture mechanics, there is no “screening criterion”. In this paper, the methodology in the RCC-M and RSE-M codes, which are used for PTS analysis, are firstly discussed. The bases of the French codes are compared with ASME and FAVOR codes. A case study is also presented. The results show that the method in the RCC-M code that accounts for the influence of cladding on the stress intensity factor (SIF may be nonconservative. The SIF almost doubles if the weld residual stress is considered. The approaches included in the codes differ in many aspects, which may result in significant differences in the assessment results. Therefore, homogenization of the codes in the long time operation of nuclear power plants is needed.

  6. Assessment of pesticide availability in soil fractions after the incorporation of winery-distillery vermicomposts

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez-Bayo, J.D. [Department of Environmental Protection, Estacion Experimental del Zaidin (CSIC), C/Profesor Albareda 1, 18008 Granada (Spain)], E-mail: jesus.bayo@eez.csic.es; Romero, E. [Department of Environmental Protection, Estacion Experimental del Zaidin (CSIC), C/Profesor Albareda 1, 18008 Granada (Spain); Schnitzler, F.; Burauel, P. [Agrosphere Institute, ICG 4, Forschungszentrum Juelich, Juelich (Germany)

    2008-07-15

    The influence of two vermicomposts from winery and distillery wastes on the distribution of diuron in agricultural soil was studied. Physical soil fractionations at 0, 9, 27, 49 and 77 days, allowed the quantification of pesticide residues in different particle-size fractions, coarse waste (WF), sand-sized (SF), silt-sized (SiF), clay-sized (CF) and dissolved organic matter-sized fraction (DOM). The SiF made a greater contribution to the formation of non-extractable residues in unamended soil, but when vermicomposts were added, new sorption sites in WF appeared, being higher for the more humified vermicompost V2. The dissolved organic carbon (DOC) increased with the addition of vermicompost, but the concentration of the desorbed {sup 14}C-radiochemical did not increase. Non-significant increment was observed with time for the non-extractable fraction with amendments. Diuron was transformed in all samples, although less than 0.5% was mineralized. The main effect caused by vermicomposts was a reduction in the availability of diuron in soil. - Winery vermicomposts as organic amendments to reduce pesticide pollution.

  7. Assessment of pesticide availability in soil fractions after the incorporation of winery-distillery vermicomposts

    International Nuclear Information System (INIS)

    Fernandez-Bayo, J.D.; Romero, E.; Schnitzler, F.; Burauel, P.

    2008-01-01

    The influence of two vermicomposts from winery and distillery wastes on the distribution of diuron in agricultural soil was studied. Physical soil fractionations at 0, 9, 27, 49 and 77 days, allowed the quantification of pesticide residues in different particle-size fractions, coarse waste (WF), sand-sized (SF), silt-sized (SiF), clay-sized (CF) and dissolved organic matter-sized fraction (DOM). The SiF made a greater contribution to the formation of non-extractable residues in unamended soil, but when vermicomposts were added, new sorption sites in WF appeared, being higher for the more humified vermicompost V2. The dissolved organic carbon (DOC) increased with the addition of vermicompost, but the concentration of the desorbed 14 C-radiochemical did not increase. Non-significant increment was observed with time for the non-extractable fraction with amendments. Diuron was transformed in all samples, although less than 0.5% was mineralized. The main effect caused by vermicomposts was a reduction in the availability of diuron in soil. - Winery vermicomposts as organic amendments to reduce pesticide pollution

  8. QUALIDADE MICROBIOLÓGICA DE MÉIS PRODUZIDOS POR PEQUENOS APICULTORES E DE MÉIS DE ENTREPOSTOS REGISTRADOS NO SERVIÇO DE INSPEÇÃO FEDERAL NO ESTADO DE MINAS GERAIS

    Directory of Open Access Journals (Sweden)

    Mariana Borges de Lima da SILVA

    2009-06-01

    Full Text Available

    O objetivo do presente trabalho foi avaliar a qualidade microbiológica de méis obtidos diretamente de apicultores e provenientes de entrepostos registrados no Serviço de Inspeção Federal (S.I.F. / Ministério da Agricultura Pecuária e Abastecimento (MAPA no Estado de Minas Gerais. Foram pesquisados coliformes totais, coliformes termotolerantes, fungos filamentosos e leveduras em 39 amostras, sendo três de cada um dos 13 apicultores selecionados e 18 amostras provenientes de entrepostos registradas no S.I.F-MG. Os méis provenientes da região norte da Zona da Mata mineira obtidos diretamente dos apicultores apresentaram maior contaminação por fungos filamentosos e leveduras (2,9x104 do que os méis com registro no S.I.F (3,7x103 . Quanto a coliformes totais e termotolerantes não houve diferença, com ambos os grupos apresentando < 3 NMP/g. Recomenda-se preparação profissional para os apicultores nos aspectos relacionados ao manejo, colheita e extração do mel, visando melhorar a qualidade do produto.

  9. Surface crack growth in cylindrical hollow specimen subject to tension and torsion

    Directory of Open Access Journals (Sweden)

    V. Shlyannikov

    2015-07-01

    Full Text Available The subject for studies is an aluminium cylindrical hollow specimen with external axial and part circumferential semi-elliptical surface crack undergoing fatigue loads. Both the optical microscope measurements and the crack opening displacement (COD method are used to monitor and calculate both crack depth and crack length during the tests. The variation of crack growth behaviour is studied under cyclic axial tension, pure torsion and combined tension+torsion fatigue loading. For the particular surface flaw geometries considered, the elastic and plastic in-plane and out-of-plane constraint parameters, as well as the governing parameter for stress fields in the form of In-integral and plastic stress intensity factor, are obtained as a function of the aspect ratio, dimensionless crack length and crack depth. The combined effect of tension and torsion loading and initial surface flaw orientation on the crack growth for two type of aluminium alloys is made explicit. The experimental and numerical results of the present study provided the opportunity to explore the suggestion that fatigue crack propagation may be governed more strongly by the plastic stress intensity factor rather than the magnitude of the elastic SIFs alone. One advantage of the plastic SIF is its sensitivity to combined loading due to accounting for the plastic properties of the material.

  10. Damage Tolerant Analysis of Cracked Al 2024-T3 Panels repaired with Single Boron/Epoxy Patch

    Science.gov (United States)

    Mahajan, Akshay D.; Murthy, A. Ramachandra; Nanda Kumar, M. R.; Gopinath, Smitha

    2018-06-01

    It is known that damage tolerant analysis has two objectives, namely, remaining life prediction and residual strength evaluation. To achieve the these objectives, determination of accurate and reliable fracture parameter is very important. XFEM methodologies for fatigue and fracture analysis of cracked aluminium panels repaired with different patch shapes made of single boron/epoxy have been developed. Heaviside and asymptotic crack tip enrichment functions are employed to model the crack. XFEM formulations such as displacement field formulation and element stiffness matrix formulation are presented. Domain form of interaction integral is employed to determine Stress Intensity Factor of repaired cracked panels. Computed SIFs are incorporated in Paris crack growth model to predict the remaining fatigue life. The residual strength has been computed by using the remaining life approach, which accounts for both crack growth constants and no. of cycles to failure. From the various studies conducted, it is observed that repaired panels have significant effect on reduction of the SIF at the crack tip and hence residual strength as well as remaining life of the patched cracked panels are improved significantly. The predicted remaining life and residual strength will be useful for design of structures/components under fatigue loading.

  11. Application of the French codes to the pressurized thermal shocks assessment

    International Nuclear Information System (INIS)

    Chen, Mingya; Wang, Rong Shan; Yu, Weiwei; Lu, Feng; Zhang, Guo Dong; Xue, Fei; Chen, Zhilin; Qian, Guian; Shi, Jinhua

    2016-01-01

    The integrity of a reactor pressure vessel (RPV) related to pressurized thermal shocks (PTSs) has been extensively studied. This paper introduces an integrity assessment of an RPV subjected to a PTS transient based on the French codes. In the USA, the 'screening criterion' for maximum allowable embrittlement of RPV material is developed based on the probabilistic fracture mechanics. However, in the French RCC-M and RSE-M codes, which are developed based on the deterministic fracture mechanics, there is no 'screening criterion'. In this paper, the methodology in the RCC-M and RSE-M codes, which are used for PTS analysis, are firstly discussed. The bases of the French codes are compared with ASME and FAVOR codes. A case study is also presented. The results show that the method in the RCC-M code that accounts for the influence of cladding on the stress intensity factor (SIF) may be nonconservative. The SIF almost doubles if the weld residual stress is considered. The approaches included in the codes differ in many aspects, which may result in significant differences in the assessment results. Therefore, homogenization of the codes in the long time operation of nuclear power plants is needed

  12. Los adolescentes y el conflicto interparental destructivo: impacto en la percepción del sistema familiar y diferencias según el tipo de familia, la edad y el sexo de los adolescentes / Adolescents and Destructive Interparental Conflict: Impact on the Perception of the Family System and Differences by Adolescents’ Type of Family, Age and Sex

    Directory of Open Access Journals (Sweden)

    Silvia López Larrosa

    2012-12-01

    Full Text Available En este trabajo se estudiaron las percepciones del conflicto interparental y sus efectos a largo plazo en las emociones, las conductas y las cogniciones en una muestra de 510 adolescentes españoles. Los instrumentos emplea- dos fueron la Children’s Perception of Interparental Conflict Scale [CPIC] (Grych, Seid & Fincham, 1992 y la Security in the Family System Scale [SIFS] (Forman & Davies, 2005. CPIC evalúa la naturaleza del conflicto y los factores contextuales del mismo. SIFS mide la seguridad en el sistema fa- miliar, la preocupación y la implicación de los hijos. Se encontró que cuanto más conflicto destructivo hay entre los padres (más intenso, frecuente y sin resolver más culpados, amenazados, triangulados, preocupados e inseguros se sienten los hijos, más ineficaces piensan que son sus intentos de resolver los problemas de los padres y menos se implican en las discusiones. Se en- contraron diferencias entre familias monoparentales y nucleares que hacen patente el impacto del conflicto posdivorcio de los padres. En estos casos es más estable y los padres son más ineficaces en su resolución, por lo que los hijos se sienten más inseguros. Los datos indican que con la edad aumenta la inseguridad de los hijos y que las jóvenes se implican significativamente menos en los conflictos entre los padres.

  13. El aceite de pescado atenua las crisis convulsivas inducidas por hipertermia en ratas neonatas

    Directory of Open Access Journals (Sweden)

    Leopoldo E. Flores M.

    2008-01-01

    Full Text Available Un alto porcentaje (50-60% del cerebro en los mamíferos son principalmente grasas o lípidos, de éstos, el 35% son ácidos grasos esenciales, en particular los llamados omegas (O, como el Acido Docosahexanoico (DHA y el Eicosapentanoico (EPA llamados omega 3 (O-3. Diversos estudios han mostrado beneficios en la salud con la implementación de los O-3 como agentes terapéuticos en alteraciones cardiovasculares, renales, dérmicas, metabólicas, neurodegenerativas e inmunológicas. Evidencias experimentales sugieren un beneficio potencial del aceite de pescado (APE como neuroprotector debido al alto contenido de DHA y EPA. Sin embargo, es poco lo que se conoce en cuanto a los efectos que pudieran tener sobre alteraciones nerviosas, como las crisis convulsivas. En este contexto, se ha reportado que el tipo más común de trastorno epiléptico observado en los niños son las crisis convulsivas provocadas por fiebre (CF. La incidencia es de 3-5%, con ocurrencia entre los 5 meses y 5 años de edad, y se ha propuesto que esta alteración en la vida temprana pudiera tener efectos a largo plazo, manifestándose como un síndrome de epilepsia en la vida adulta. El objetivo del presente estudio fue evaluar el efecto del APE sobre las convulsiones inducidas por hipertermia experimental en un grupo de ratas Wistar macho de 5 días de edad (grupo SAPE cuyas madres consumieron una dieta base más un suplemento de APE (suministrado desde su infancia hasta la etapa de crianza. Este grupo se comparó con otro grupo de ratas de la misma edad y cepa (grupo SAPA cuyas madres consumieron una dieta base más un suplemento de aceite de palma (suministrado desde su infancia hasta la etapa de crianza, y con un tercer grupo de ratas (grupo CTRL cuyas madres consumieron la dieta base más agua bidestilada como suplemento. Las ratas tratadas con APE presentaron mayor resistencia a la elevación de la temperatura corporal inducida por la hipertermia, una menor frecuencia

  14. Fenomena Haters Sebagai Dampak Negatif Perkembangan Media Sosial Di Indonesia [The Phenomena of Haters and the Negative Impact of Social Media Development in Indonesia

    Directory of Open Access Journals (Sweden)

    Adek Zico Sitorus

    2017-08-01

    Full Text Available The evolution of technology has made communication much easier. The existence of recent sophisticated platforms, operating systems, and apps has changed the way people communicate. This is supported by McLuhan’s statement about the determinism theory of technology which in his 1962 book ‘The Guttenberg Galaxy: The Making of Thypographic Man’ declared that technology affects the way people communicate  (Straubhaar, Larose, & Davenport, 2010. In this modern era, the evolution of technology has brought the communication amongs celebrities, fans, and haters to the next level. Through social media programs such as Instagram, a celebrity just need post a picture or a video to give an update about their activities for the followers. However, their followers are not just their lovers or fans but their haters as well. Instagram as a social media platform offers a cyber space which enables cyber societies to interact freely. However, this cyber space also allows haters to exist on social media. BAHASA INDONESIA ABSTRAK: Kemajuan teknologi mempermudah komunikasi antar manusia. Dapat dikatakan dengan semakin canggihnya platform, sistem operasi dan aplikasi yang merupakan bagian dari teknologi mempengaruhi cara komunikasi masyarakat sebagaimana yang dikatakan McLuhan pada teori determinasi teknologi di tahun 1962 tertulis dalam bukunya yang berjudul The Guttenberg Galaxy: The Making of Thypographic Man (Straubhaar, Larose, & Davenport, 2010 yaitu bahwa teknologi mempengaruhi cara berkomunikasi manusia satu dengan lainnya. Pada era modern ini kemajuan teknologi mempermudah komunikasi antar selebriti dan fans melalui media sosial, khususnya Instagram. Dimana melalui Instagram seorang idola atau selebriti cukup memposting sebuah foto atau video di Instagram untuk bertegur sapa dengan para penggemarnya. Namun pada kenyataanya tidak hanya komentar positif yang didapat oleh seorang idola namun juga kritikan pedas dari para haters. Dengan mudahnya akses

  15. Estimating lithospheric properties at Atla Regio, Venus

    Science.gov (United States)

    Phillips, Roger J.

    1994-01-01

    Magellan spehrical harmonic gravity and topography models are used to estimate lithospheric properties at Alta Regio, Venus, a proposed hotspot with dynamic support from mantle plume(s). Global spherical harmonic and local representations of the gravity field share common properties in the Atla region interms of their spectral behavior over a wavelength band from approximately 2100 to approximately 700 km. The estimated free-air admittance spectrum displays a rather featureless long-wavelength portion followed by a sharp rise at wavelengths shorter than about 1000 km. This sharp rise requires significant flexural support of short-wavelength structures. The Bouguer coherence also displays a sharp drop in this wavelength band, indicating a finite flexural rigidity of the lithosphere. A simple model for lithospheric loading from above and below is introduced (D. W. Forsyth, 1985) with four parameters: f, the ratio of bottom loading to top loading; z(sub m), crustal thickness; z(sub l) depth to bottom loading source; and T(sub e) elastic lithosphere thickness. A dual-mode compensation model is introduced in which the shorter wavelengths (lambda approximately less than 1000 km) might be explained best by a predominance of top loading by the large shield volcanoes Maat Mons, Ozza Mons, and Sapas Mons, and the longer wavelengths (lambda approximately greater than 1500 km) might be explained best by a deep depth of compensation, possibly representing bottom loading by a dynamic source. A Monte Carlo inversion technique is introduced to thoroughly search out the four-space of the model parameters and to examine parameter correlation in the solutions. Venus either is a considerabe deficient in heat sources relative to Earth, or the thermal lithosphere is overthickened in response to an earlier episode of significant heat loss from the planet.

  16. Comparative Genomics of Campylobacter fetus from Reptiles and Mammals Reveals Divergent Evolution in Host-Associated Lineages.

    Science.gov (United States)

    Gilbert, Maarten J; Miller, William G; Yee, Emma; Zomer, Aldert L; van der Graaf-van Bloois, Linda; Fitzgerald, Collette; Forbes, Ken J; Méric, Guillaume; Sheppard, Samuel K; Wagenaar, Jaap A; Duim, Birgitta

    2016-07-02

    Campylobacter fetus currently comprises three recognized subspecies, which display distinct host association. Campylobacter fetus subsp. fetus and C fetus subsp. venerealis are both associated with endothermic mammals, primarily ruminants, whereas C fetus subsp. testudinum is primarily associated with ectothermic reptiles. Both C. fetus subsp. testudinum and C. fetus subsp. fetus have been associated with severe infections, often with a systemic component, in immunocompromised humans. To study the genetic factors associated with the distinct host dichotomy in C. fetus, whole-genome sequencing and comparison of mammal- and reptile-associated C fetus was performed. The genomes of C fetus subsp. testudinum isolated from either reptiles or humans were compared with elucidate the genetic factors associated with pathogenicity in humans. Genomic comparisons showed conservation of gene content and organization among C fetus subspecies, but a clear distinction between mammal- and reptile-associated C fetus was observed. Several genomic regions appeared to be subspecies specific, including a putative tricarballylate catabolism pathway, exclusively present in C fetus subsp. testudinum strains. Within C fetus subsp. testudinum, sapA, sapB, and sapAB type strains were observed. The recombinant locus iamABC (mlaFED) was exclusively associated with invasive C fetus subsp. testudinum strains isolated from humans. A phylogenetic reconstruction was consistent with divergent evolution in host-associated strains and the existence of a barrier to lateral gene transfer between mammal- and reptile-associated C fetus Overall, this study shows that reptile-associated C fetus subsp. testudinum is genetically divergent from mammal-associated C fetus subspecies. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  17. Flooding modifies the genotoxic effects of pollution on a worm, a mussel and two fish species from the Sava River.

    Science.gov (United States)

    Aborgiba, Mustafa; Kostić, Jovana; Kolarević, Stoimir; Kračun-Kolarević, Margareta; Elbahi, Samia; Knežević-Vukčević, Jelena; Lenhardt, Mirjana; Paunović, Momir; Gačić, Zoran; Vuković-Gačić, Branka

    2016-01-01

    Extreme hydrological events, such as water scarcity and flooding, can modify the effect of other stressors present in aquatic environment, which could result in the significant changes in the ecosystem functioning. Presence and interaction of various stressors (genotoxic pollutants) in the environment can influence the integrity of DNA molecules in aquatic organisms which can be negatively reflected on the individual, population and community levels. Therefore, in this study we have investigated the impact of flooding, in terms of genotoxicity, on organisms belonging to different trophic levels. The study was carried out on the site situated in the lower stretch of the Sava River which faced devastating effects of severe flooding in May 2014. The flooding occurred during our field experiment and this event provided a unique opportunity to assess its influence to the environment. The in situ effects of this specific situation were monitored by measuring physical, chemical and microbiological parameters of water, and by comparing the level of DNA damage in coelomocytes and haemocytes of freshwater worms Branchiura sowerbyi, haemocytes of freshwater mussels Unio tumidus and blood cells of freshwater fish Abramis bjoerkna/Abramis sapa, by means of the comet assay. Our study indicated that the flooding had a significant impact on water quality by decreasing the amount and discharge rate of urban wastewaters but simultaneously introducing contaminants from the nearby fly ash disposal field into river by runoff, which had diverse effects on the level of DNA damage in the studied organisms. This indicates that the assessment of genotoxic pollution in situ is strongly affected by the choice of the bioindicator organism. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. The Decrease of Peripheral Blood CD4+ T Cells Indicates Abdominal Compartment Syndrome in Severe Acute Pancreatitis.

    Directory of Open Access Journals (Sweden)

    Yao Liu

    Full Text Available Few data are available on the role of T lymphocytes and inflammatory cytokines in abdominal compartment syndrome (ACS in severe acute pancreatitis (SAP. We conducted a retrospective study to assess the risk factors associated with ACS in SAP.A total of 76 SAP patients who were admitted within 24 hours after symptom onset in our study. There were 36 patients suffering from ACS and 40 from intra-abdominal hypertension (IAH. On the 1st, 3rd and 7th days after hospital admission, the following variables were assessed: serum value of C-reactive protein (CRP, and the proportions of peripheral CD4+ and CD8+ T lymphocytes. Acute Physiology and Chronic Health Evaluation II (APACHE II score, and computed tomography severity index (CTSI score were assessed on days 1 and 7 after hospitalization.Compared with the patients with IAH, ACS patients showed statistically higher CRP value on 7th day after hospital admission, proportions of CD4+ T cells on days 1, 3, 7 and CD4+/CD8+ ratio on day 1 were significantly lower (P < 0.05, respectively. A CD4+ T cell proportion of 30.3% on the 1st day indicated ACS with an area under the curve (AUC of 0.774, a sensitivity with 82.5% and specificity with 72.0%, respectively. Sensitivity/specificity for predicting ACS in SAP patients on day 1 was 70.0%/68.0% for CD4+/CD8+ ratio, 72.2%/65.0% for APACHE II score.The reduction of peripheral blood CD4+ T lymphocytes is associated with ACS in SAP, and may act as a potential predictor of ACS in SAP.

  19. [Validation of a French translation of Krueger's personality inventory for DSM-5 in its brief form (PID-5 BF)].

    Science.gov (United States)

    Combaluzier, S; Gouvernet, B; Menant, F; Rezrazi, A

    2018-02-01

    Since the publication of the DSM-5 (APA, 2013), the dimensional conception of the personality disorders is co-existing with the classical categorical paradigm. Tools have been proposed for the evaluations of five big pathological factors to be explored further according to the APA (negative affectivity, detachment, antagonism, disinhibition, psychoticism). Despite numerous works using these questionnaires (30 works in 3 years according to Al-Adjani et al., 2015), none of them have yet been translated into French. Also, the main objective of the paper is to present a French translation of the Personality Inventory for DSM -5 by Kruegger et al. (2013) in its brief form of 25 items (PID-5 BF). To reach this goal, we have employed the classic translation-retranslation method (Vallerand, 1989) and tested the consistence and the validity of this French version among a non-clinical sample (n=216) of young adults (age=31.4, SD=4.8), in joining some other questionnaires in their short forms to study the external validity of the PID-5 about the psychological distress (SCL-10, Nguyen, 1983), the categorical diagnosis of personality disorders (SAPAS, Moran et al., 2003) and the classical Big Five dimensions of the personality (BDI 10, Ramamstedt and John, 2007). The internal consistency of this translation has been studied through the classical outcomes on factor analysis for the dimensional repartitions of the items in 5 scales and Cronbach's alpha for the consistency of each found dimensions. The external validity has been explored by studying Pearson's correlations between the outcomes on each dimension of the PID-5 BF and both the clinical dimensions of SCL-10, personality dimensions of the BFI-10 or personality disorders (SAPAS). Factor analysis led to the same repartition of the 25 items as the original versions. Each of the dimensions is consistent enough (α>.65) to be taken into account as clinically significant. The items of the French version of the PID-5 BF follow

  20. Vegetation Function and Physiology: Photosynthesis, Fluorescence and Non-photochemical Quenching (NPQ)

    Science.gov (United States)

    Zhang, Q.; Yao, T.

    2017-12-01

    Photosynthesis is a basic physiological function of vegetation that relies on PAR provided through photosynthetic pigments (mainly chlorophyll) for plant growth and biomass accumulation. Vegetation chlorophyll (chl) content and non-chlorophyll (non-chl) components vary with plant functional types (PFTs) and growing stages. The PAR absorbed by canopy chlorophyll (APARchl) is associated with photosynthesis (i.e., gross primary production, GPP) while the PAR absorbed by canopy non-chl components (APARnon-chl) is not associated with photosynthesis. Under non-optimal environmental conditions, vegetation is "stressed" and both photosynthesis (GPP) and light use efficiency are reduced, therefore, excess portions of APARchl are discarded as fluorescence or non-photochemical quenching (NPQ). The photochemical reflectance index (PRI) is a measurement related to NPQ. Both PRI and yield of solar induced chlorophyll fluorescence (SIFyield = SIF/APARchl) have been proposed as possible bio-indicators of LUEchl. We have successfully developed an algorithm to distinguish between chlorophyll and non-chl components of vegetation, and to retrieve fractional absorptions of PAR by chlorophyll (fAPARchl) and by non-chl components (fAPARnon-chl) with surface reflectance of MODIS bands 1 - 7. A method originally pioneered by Hanan et al. (2002) has been used to retrieve fAPAR for vegetation photosynthesis (fAPARPSN) at flux tower sites based on the light response curve of tower net ecosystem exchange (NEE) and incident PAR at low light intensity. We have also retrieved the PRI from MODIS data (bands 11 and 1) and have derived SIFyield with the Global Ozone Monitoring Experiment - 2 (GOME-2) SIF data. We find that fAPARPSN at flux tower sites matches well with site fAPARchl, and ratio fAPARnon-chl/fAPARchl varies largely. APARchl can explain >=78% variation in seasonal GPP . We disentangle the possible impact of fAPARchl on PRI from physiological stress response, disentangle the possible

  1. Production of bacterial cellulose and enzyme from waste fiber sludge

    Science.gov (United States)

    2013-01-01

    Background Bacterial cellulose (BC) is a highly crystalline and mechanically stable nanopolymer, which has excellent potential as a material in many novel applications, especially if it can be produced in large amounts from an inexpensive feedstock. Waste fiber sludge, a residue with little or no value, originates from pulp mills and lignocellulosic biorefineries. A high cellulose and low lignin content contributes to making the fiber sludge suitable for bioconversion, even without a thermochemical pretreatment step. In this study, the possibility to combine production of BC and hydrolytic enzymes from fiber sludge was investigated. The BC was characterized using field-emission scanning electron microscopy and X-ray diffraction analysis, and its mechanical properties were investigated. Results Bacterial cellulose and enzymes were produced through sequential fermentations with the bacterium Gluconacetobacter xylinus and the filamentous fungus Trichoderma reesei. Fiber sludges from sulfate (SAFS) and sulfite (SIFS) processes were hydrolyzed enzymatically without prior thermochemical pretreatment and the resulting hydrolysates were used for BC production. The highest volumetric yields of BC from SAFS and SIFS were 11 and 10 g/L (DW), respectively. The BC yield on initial sugar in hydrolysate-based medium reached 0.3 g/g after seven days of cultivation. The tensile strength of wet BC from hydrolysate medium was about 0.04 MPa compared to about 0.03 MPa for BC from a glucose-based reference medium, while the crystallinity was slightly lower for BC from hydrolysate cultures. The spent hydrolysates were used for production of cellulase with T. reesei. The cellulase activity (CMCase activity) in spent SAFS and SIFS hydrolysates reached 5.2 U/mL (87 nkat/mL), which was similar to the activity level obtained in a reference medium containing equal amounts of reducing sugar. Conclusions It was shown that waste fiber sludge is a suitable raw material for production of

  2. Sistemas forrageiros no semiárido do Estado do Ceará: tipologia estrutural - doi: 10.4025/actascianimsci.v32i4.9549 Forage systems in the semiarid of Ceará State: structural typology - doi: 10.4025/actascianimsci.v32i4.9549

    Directory of Open Access Journals (Sweden)

    Déa de Lima Vidal

    2010-10-01

    Full Text Available Objetivou-se estabelecer a tipologia estrutural dos sistemas forrageiros (SIFs em 57 unidades de produção rural cearenses localizadas no semiárido. Dezoito variáveis sobre utilização de superfícies, unidades e cargas animais, instalações e mão-de-obra foram submetidas à Análise de Componentes Principais e Cluster, o que permitiu identificar os fatores e estabelecer a tipologia. Dez grupos de estrutura de SIF se diferenciaram por sua base em recursos forrageiros de caatinga e pelo pastoreio de pequenos ruminantes. Somente os tipos estruturais dos Grupos 2, 5 e 10 (52,30% das unidades de produção, por desfrutarem dos cultivos forrageiros específicos hídricos e de sequeiro, além de caatinga e restolho, podem estabilizar menor intensidade de pastoreio de suas áreas e, portanto causarão menor impacto potencial no deterioro da estrutura de seus SIFs. As condições de melhoria forrageira para os Sistemas de Baixa presença de Caatinga ou Ausência da mesma (G4 e G3 devem basear-se no melhor aproveitamento de suas superfícies em restolhos de cultivos e em cultivos forrageiros específicos hídricos.The objective of this study was to establish a structural typology of forage systems for 57 rural households in the semiarid region of Ceará state, Brazil. Eighteen variables regarding surface distribution, animal units and stocking rates, buildings and labor availability were submitted to PCA and Cluster analysis. Ten structural forage groups were differentiated based on Caatinga autochthonous forage resources and by goat and sheep pasturing. Only the structural types of Groups 2, 5 and 10 (52.30% of the rural households could stabilize a lesser pasturing intensity of their areas – as they enjoy specific hydric and dry land forage cultivations, in addition to Caatinga and stubbles – and would therefore cause minor potential impact in the structure of their forage systems. The improving conditions for low Caatinga Importance and no

  3. Assessing the relationship between microwave vegetation optical depth and gross primary production

    Science.gov (United States)

    Teubner, Irene E.; Forkel, Matthias; Jung, Martin; Liu, Yi Y.; Miralles, Diego G.; Parinussa, Robert; van der Schalie, Robin; Vreugdenhil, Mariette; Schwalm, Christopher R.; Tramontana, Gianluca; Camps-Valls, Gustau; Dorigo, Wouter A.

    2018-03-01

    At the global scale, the uptake of atmospheric carbon dioxide by terrestrial ecosystems through photosynthesis is commonly estimated through vegetation indices or biophysical properties derived from optical remote sensing data. Microwave observations of vegetated areas are sensitive to different components of the vegetation layer than observations in the optical domain and may therefore provide complementary information on the vegetation state, which may be used in the estimation of Gross Primary Production (GPP). However, the relation between GPP and Vegetation Optical Depth (VOD), a biophysical quantity derived from microwave observations, is not yet known. This study aims to explore the relationship between VOD and GPP. VOD data were taken from different frequencies (L-, C-, and X-band) and from both active and passive microwave sensors, including the Advanced Scatterometer (ASCAT), the Soil Moisture Ocean Salinity (SMOS) mission, the Advanced Microwave Scanning Radiometer for Earth Observation System (AMSR-E) and a merged VOD data set from various passive microwave sensors. VOD data were compared against FLUXCOM GPP and Solar-Induced chlorophyll Fluorescence (SIF) from the Global Ozone Monitoring Experiment-2 (GOME-2). FLUXCOM GPP estimates are based on the upscaling of flux tower GPP observations using optical satellite data, while SIF observations present a measure of photosynthetic activity and are often used as a proxy for GPP. For relating VOD to GPP, three variables were analyzed: original VOD time series, temporal changes in VOD (ΔVOD), and positive changes in VOD (ΔVOD≥0). Results show widespread positive correlations between VOD and GPP with some negative correlations mainly occurring in dry and wet regions for active and passive VOD, respectively. Correlations between VOD and GPP were similar or higher than between VOD and SIF. When comparing the three variables for relating VOD to GPP, correlations with GPP were higher for the original VOD time

  4. Ion chemistry in germane/fluorocompounds gaseous mixtures: a mass spectrometric and theoretical study.

    Science.gov (United States)

    Antoniotti, Paola; Rabezzana, Roberto; Turco, Francesca; Borocci, Stefano; Giordani, Maria; Grandinetti, Felice

    2008-10-01

    The ion-molecule reactions occurring in GeH(4)/NF(3), GeH(4)/SF(6), and GeH(4)/SiF(4) gaseous mixtures have been investigated by ion trap mass spectrometry and ab initio calculations. While the NF(x)(+) (x=1-3) react with GeH(4) mainly by the exothermic charge transfer, the open-shell Ge(+) and GeH(2)(+) undergo the efficient F-atom abstraction from NF(3) and form GeF(+) and F-GeH(2)(+) as the only ionic products. The mechanisms of these two processes are quite similar and involve the formation of the fluorine-coordinated complexes Ge-F-NF(2)(+) and H(2)Ge-F-NF(2)(+), their subsequent crossing to the significantly more stable isomers FGe-NF(2)(+) and F-GeH(2)-NF(2)(+), and the eventual dissociation of these ions into GeF(+) (or F-GeH(2)(+)) and NF(2). The closed-shell GeH(+) and GeH(3)(+) are instead much less reactive towards NF(3), and the only observed process is the less efficient formation of GeF(+) from GeH(+). The theoretical investigation of this unusual H/F exchange reaction suggests the involvement of vibrationally-hot GeH(+). Passing from NF(3) to SF(6) and SiF(4), the average strength of the M-F bond increases from 70 to 79 and 142 kcal mol(-1), and in fact the only process observed by reacting GeH(n)(+) (n=0-3) with SF(6) and SiF(4) is the little efficient F-atom abstraction from SF(6) by Ge(+). Irrespective of the experimental conditions, we did not observe any ionic product of Ge-N, Ge-S, or Ge-Si connectivity. This is in line with the previously observed exclusive formation of GeF(+) from the reaction between Ge(+) and C-F compounds such as CH(3)F. Additionally observed processes include in particular the conceivable formation of the elusive thiohypofluorous acid FSH from the reaction between SF(+) and GeH(4).

  5. A finite element model on effects of impact load and cavitation on fatigue crack propagation in mechanical bileaflet aortic heart valve.

    Science.gov (United States)

    Mohammadi, H; Klassen, R J; Wan, W-K

    2008-10-01

    Pyrolytic carbon mechanical heart valves (MHVs) are widely used to replace dysfunctional and failed heart valves. As the human heart beats around 40 million times per year, fatigue is the prime mechanism of mechanical failure. In this study, a finite element approach is implemented to develop a model for fatigue analysis of MHVs due to the impact force between the leaflet and the stent and cavitation in the aortic position. A two-step method to predict crack propagation in the leaflets of MHVs has been developed. Stress intensity factors (SIFs) are computed at a small initiated crack located on the leaflet edge (the worst case) using the boundary element method (BEM). Static analysis of the crack is performed to analyse the stress distribution around the front crack zone when the crack is opened; this is followed by a dynamic crack analysis to consider crack propagation using the finite element approach. Two factors are taken into account in the calculation of the SIFs: first, the effect of microjet formation due to cavitation in the vicinity of leaflets, resulting in water hammer pressure; second, the effect of the impact force between the leaflet and the stent of the MHVs, both in the closing phase. The critical initial crack length, the SIFs, the water hammer pressure, and the maximum jet velocity due to cavitation have been calculated. With an initial crack length of 35 microm, the fatigue life of the heart valve is greater than 60 years (i.e. about 2.2 x 10(9) cycles) and, with an initial crack length of 170 microm, the fatigue life of the heart valve would be around 2.5 years (i.e. about 9.1 x 10(7) cycles). For an initial crack length greater than 170 microm, there is catastrophic failure and fatigue cracking no longer occurs. A finite element model of fatigue analysis using Patran command language (PCL custom code) in MSC software can be used to evaluate the useful lifespan of MHVs. Similar methodologies can be extended to other medical devices under cyclic

  6. Persistent current of relativistic electrons on a Dirac ring in presence of impurities

    KAUST Repository

    Ghosh, Sumit; Saha, Arijit

    2014-01-01

    We study the behaviour of persistent current of relativistic electrons on a one dimensional ring in presence of attractive/repulsive scattering potentials. In particular, we investigate the persistent current in accordance with the strength as well as the number of the scattering potential. We find that in presence of single scatterer the persistent current becomes smaller in magnitude than the scattering free scenario. This behaviour is similar to the non-relativistic case. Even for a very strong scattering potential, finite amount of persistent current remains for a relativistic ring. In presence of multiple scatterer we observe that the persistent current is maximum when the scatterers are placed uniformly compared to the current averaged over random configurations. However if we increase the number of scatterers, we find that the random averaged current increases with the number of scatterers. The latter behaviour is in contrast to the non-relativistic case. © 2014 EDP Sciences, SIF, Springer-Verlag Berlin Heidelberg.

  7. Protein prenylation: a new mode of host-pathogen interaction.

    Science.gov (United States)

    Amaya, Moushimi; Baranova, Ancha; van Hoek, Monique L

    2011-12-09

    Post translational modifications are required for proteins to be fully functional. The three step process, prenylation, leads to farnesylation or geranylgeranylation, which increase the hydrophobicity of the prenylated protein for efficient anchoring into plasma membranes and/or organellar membranes. Prenylated proteins function in a number of signaling and regulatory pathways that are responsible for basic cell operations. Well characterized prenylated proteins include Ras, Rac and Rho. Recently, pathogenic prokaryotic proteins, such as SifA and AnkB, have been shown to be prenylated by eukaryotic host cell machinery, but their functions remain elusive. The identification of other bacterial proteins undergoing this type of host-directed post-translational modification shows promise in elucidating host-pathogen interactions to develop new therapeutics. This review incorporates new advances in the study of protein prenylation into a broader aspect of biology with a focus on host-pathogen interaction. Copyright © 2011 Elsevier Inc. All rights reserved.

  8. On the interactions of nitriles and fluoro-substituted pyridines with silicon tetrafluoride: Computations and thin film IR spectroscopy

    Science.gov (United States)

    Hora, Nicholas J.; Wahl, Benjamin M.; Soares, Camilla; Lara, Skylee A.; Lanska, John R.; Phillips, James A.

    2018-04-01

    The nature of the interactions between silicon tetrafluoride and series of nitrogen bases, including nitriles (RCN, with R > CH3), pyridine, and various fluoro-substituted pyridines, has been investigated via quantum-chemical computations, low-temperature IR spectroscopy, and bulk reactivity experiments. Using (primarily) M06 with the 6-311+G(2df,2pd) basis set, we obtained equilibrium structures, binding energies, harmonic frequencies, and N-Si potentials in the gas-phase and in bulk dielectric media for an extensive series of 1:1 molecular complexes, including: C6H5CH2CN-SiF4, CH3CH2CN-SiF4, (CH3)3CCN-SiF4, C5H5N-SiF4, 4-FC5H4N-SiF4, 3,5-C5F2H3N-SiF4, 2,6-C5F2H3N-SiF4 and 3,4,5-C5F3H2N-SiF4. In addition, for the analogous 2:1 complexes of pyridine and 3,5-difluororpyridine, we obtained equilibrium structures, binding energies, and harmonic frequencies. The N-Si distances in the 1:1 nitrile complexes are fairly long, ranging from 2.84 Å to 2.88 Å, and the binding energies range from 4.0 to 4.2 kcal/mol (16.7-17.6 kJ/mol). Also, computations predict extremely anharmonic N-Si potentials, for which the inner portions of the curve are preferentially stabilized in dielectric media, which predict an enhancement of these interactions in condensed-phases. However, we see no evidence of bulk reactivity between C6H5CH2CN, CH3CH2CN, or (CH3)3CCN and SiF4, nor any significant interaction between (CH3)3CCN and SiF4 in low temperature IR spectra of solid, (CH3)3CCN/SiF4 thin films. Conversely, the interactions in four of the five 1:1, pyridine-SiF4 complexes are generally stronger; binding energies range from 5.7 to 9.6 kcal/mol (23.8-40.2 kJ/mol), and correspondingly the N-Si distances are relatively short (2.12-2.25 Å). The exception is 2,6-C5F2H3N-SiF4, for which the binding energy is only 3.6 kcal/mol (15.1 kJ/mol), and the N-Si distance is quite long (3.12 Å). In addition, both pyridine and 3,5-difluororpyridine were found to form stable reaction products with SiF4

  9. Fracture analyses and test of regions with nozzle and hole and curvature influence in nuclear vessel

    International Nuclear Information System (INIS)

    Wang Baisong; Xu Dinggen; Ye Weijuan; Hu Yinbiao; Liang Xingyun; Gu Shaode; Zhou Peiying

    1993-08-01

    For the calculations of stress intensity factor K 1 of surface crack in the regions with nozzle and hole and the curvature influence on nuclear vessel, a improved 3-D collapsed isoparametric singular element with quarter-points was presented. The square root singularity in the vertical planes of crack was derived. The methods of transitional element and calculating K 1 from displacements were extensively used in 3- D case. The SIF K 1 of the corner crack in inner wall of the nozzle of RPV (reactor pressure vessel) for a typical 300 MW nuclear plant was calculated, and it was verified by 3-D photo-elastic test and diffusion of light test. The engineering fracture analysis and evaluation of the outside surface crack in the circular are transitional region of the head flange of RPV are also completed

  10. Using remote-sensing and the Simple Biosphere model (SiB4) to analyze the seasonality and productivity of the terrestrial biosphere.

    Science.gov (United States)

    Cheeseman, M.; Denning, S.; Baker, I. T.

    2017-12-01

    Understanding the variability and seasonality of carbon fluxes from the terrestrial biosphere is integral to understanding the mechanisms and drivers of the global carbon cycle. However, there are many regions across the globe where in situ observations are sparse, such as the Amazon rainforest and the African Sahel. The latest version of the Simple-Biosphere model (SiB4) predicts a suite of biophysical variables such as terrestrial carbon flux (GPP), solar induced fluorescence (SIF), fraction of photosynthetically active radiation (FPAR), and leaf area index (LAI). By comparing modeled values to a suite of satellite and in situ observations we produce a robust analysis of the seasonality and productivity of the terrestrial biosphere in a variety of biome types across the globe.

  11. Captación por el sistema Ranney, para aumentar el abastecimiento de agua de Málaga

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-10-01

    Full Text Available Para aliviar el problema de falta de agua, cada vez más agudizado, el Excmo. Ayuntamiento de Málaga, apoyado por las altas Autoridades y en estrecha colaboración con la Dirección de Obras Hidráulicas y la Confederación del Río Guadalhorce, previo informe del competente Ingeniero de Caminos D. Alejandro Miró Nadal, decidió la ejecución de una captación subálvea en una de las márgenes del río Guadalhorce, en las proximidades del sifón de la conducción de Torremolinos a Málaga.

  12. Numerical study of propagation properties of surface plasmon polaritons in nonlinear media

    KAUST Repository

    Sagor, Rakibul Hasan

    2016-03-29

    We present a time-domain algorithm for simulating nonlinear propagation of surface plasmon polaritons (SPPs) in chalcogenide glass. Due to the high non-linearity property and strong dispersion and confinement chalcogenide glasses are widely known as ultrafast nonlinear materials. We have used the finite difference time domain (FDTD) method to develop the simulation algorithm for the current analysis. We have modeled the frequency dependent dispersion properties and third order nonlinearity property of chalcogenide glass utilizing the general polarization algorithm merged in the auxiliary differential equation (ADE) method. The propagation dynamics of the whole structure with and without third order nonlinearity property of chalcogenide glass have been simulated and the effect of nonlinearity on the propagation properties of SPP has been investigated. © 2016 EDP Sciences, SIF, Springer-Verlag Berlin Heidelberg.

  13. Operator Actions Within a Safety Instrumented Function

    International Nuclear Information System (INIS)

    Suttinger, L.T.

    2002-01-01

    This paper presents an overview of the factors that should be considered when crediting operator action for performing a safety function or being a part of the process of enabling a safety function. Criteria for evaluating operator action, such as required time response and operator training among others, are discussed. The paper will address these and other factors that should be considered when determining the reliability of the operator to respond and perform his/her part of the safety function. The entire safety function includes the operator and the reliability of the instrumented system that provides the alarm or indication, the final control element, and support systems. The integration of the operator performance with the hardware safety availability, including the effects of the supporting systems is discussed. The analysis of these factors will provide the justification for the amount of risk reduction or safety integrity level that can be credited for the Safety Instrumented Function (SIF), including operator action

  14. Une nouvelle modélisation du comportement d'un joint collé élastique prenant en compte les oscillations et concentrations de gradient

    OpenAIRE

    Pagano , Stéphane; Licht , Christian; Michaille , Gérard

    2009-01-01

    International audience; Nous considérons l'assemblage de deux corps hyperélastiques (non-linéaire) liés par un adhésif hyperélastique de faible rigidité (non linéaire) occupant une petite couche d'épaisseur ε. Une stratégie numérique du problème n'est pas vraiment envisageable en raison du grand nombre de degrés de liberté lié au maillage de la fine couche de colle et du très mauvais conditionnement du système dû à la très faible rigidité de la colle. Il est donc pertinent de proposer un modè...

  15. Construction of genetic markers for the study of Salmonella typhimurium infection of murine macrophages

    DEFF Research Database (Denmark)

    Jelsbak, Lotte; Olsen, John Elmerdahl

    in combination with available host markers it will be possible to estimate the time-point at which a specific gene is required for progression of SCV maturation. These developmentally regulated reporter fusions constitute a set of novel developmental markers for the study of Salmonella Typhimurium infection...... with the host cell, (2) Formation of early SCV, (3) Maturation into late SCV, (4) Initiation of bacterial replication, (5) Formation of Sifs. In this project, we have constructed a set of reporter fusions which are temporally and spatially regulated during the progression of SCV maturation. The reporter fusions...... were constructed using Red-mediated recombination (1) and the promoters were selected from the recently published expressional data of Salmonella infection of murine macrophages (2). As reporter proteins we both use a stable GFPmut3 variant as well as an unstable GFP variant (3). Using these fusions...

  16. Morphology and dynamics of aurora at fine scale: first results from the ASK instrument

    Directory of Open Access Journals (Sweden)

    H. Dahlgren

    2008-05-01

    Full Text Available The ASK instrument (Auroral Structure and Kinetics is a narrow field auroral imager, providing simultaneous images of aurora in three different spectral bands at multiple frames per second resolution. The three emission species studied are O2+ (5620 Å, O+ (7319 Å and O (7774 Å. ASK was installed and operated for the first time in an observational campaign on Svalbard, from December 2005 to March 2006. The measurements were supported by data from the Spectrographic Imaging Facility (SIF. The relation between the morphology and dynamics of the visible aurora and its spectral characteristics is studied for selected events from this period. In these events it is found that dynamic aurora is coupled to high energy electron precipitation. By studying the O2+/O intensity ratio we find that some auroral filaments are caused by higher energy precipitation within regions of lower energy precipitation, whereas other filaments are the result of a higher particle flux compared to the surroundings.

  17. Prediction of Accurate Mixed Mode Fatigue Crack Growth Curves using the Paris' Law

    Science.gov (United States)

    Sajith, S.; Krishna Murthy, K. S. R.; Robi, P. S.

    2017-12-01

    Accurate information regarding crack growth times and structural strength as a function of the crack size is mandatory in damage tolerance analysis. Various equivalent stress intensity factor (SIF) models are available for prediction of mixed mode fatigue life using the Paris' law. In the present investigation these models have been compared to assess their efficacy in prediction of the life close to the experimental findings as there are no guidelines/suggestions available on selection of these models for accurate and/or conservative predictions of fatigue life. Within the limitations of availability of experimental data and currently available numerical simulation techniques, the results of present study attempts to outline models that would provide accurate and conservative life predictions.

  18. Transport properties of Josephson contacts with ferromagnetic tunnel barriers; Transporteigenschaften von Josephson-Kontakten mit ferromagnetischer Tunnelbarriere

    Energy Technology Data Exchange (ETDEWEB)

    Sprungmann, Dirk

    2010-01-28

    The combination of the Josephson and the proximity effect is possible by the introduction of a ferromagnetic barrier into a Josephson contact resulting in a so called π coupling. The supra current through these contacts is flowing in the reverse direction. Specific new electronic circuits such as phase shifting devices are possible, for instance for high-speed analog-digital transducers. In the frame of this thesis SIFS Josephson contacts were studied, with a barrier consisting of a thin insulating Al2Ox barrier layer and a ferromagnetic thin film. For the ferromagnetic material weak ferromagnetic Ni(0.6)Cu(0.4), the strong ferromagnetic Fe(0.25)Co(0.75) and the ternary Heusler alloys Co2MnSn and Cu2MnAl were used. Josephson contacts with π coupling were realized with the NiCu alloy, triplet superconductivity seems to appear with the Heusler systems.

  19. e-EPS News: Highlights from the European Physical Society

    CERN Multimedia

    e-EPS News

    2011-01-01

    e-EPS News is a monthly addition to the CERN Bulletin line-up, showcasing articles from e-EPS – the European Physical Society newsletter – as part of a collaboration between the two publications.   DESY and INFN physicists win 2011 Enrico Fermi prize The 2011 Enrico Fermi prize of the Italian Physical Society (Società Italiana di Fisica, SIF) has been awarded, for work in the field of experimental particle physics, to Dieter Haidt of the DESY Laboratory at Hamburg and to Antonino Pullia of the University of Milano Bicocca and Istituto Nazionale di Fisica Nucleare, “for their fundamental contribution to the discovery of weak neutral currents with the Gargamelle bubble chamber at CERN”. The Enrico Fermi Prize is awarded yearly to members of the society who especially honour physics by their discoveries. For more information on the prize, please visit the Italian Physical Society website.   Consultation on the future of European Uni...

  20. Contributions to the preparation of 241americium metal and a few 241americium silicides

    International Nuclear Information System (INIS)

    Wittmann, F.D.

    1980-01-01

    In order to take a closer look at the americium-silicon system, three further silicides of americium: Am 5 Si 3 , Am 2 Si 3 and AmSi 2 were prepared in addition to the already known americium monosilicide and starting from the knowledge gained from the latters preparation. Radiographic investigations were carried out into the temperature region of 900 0 C. They showed no change of structure in the three compounds. It was possible to prepare residue-free americium metal by reducing AmF 3 with Si, whereby the SiF 4 formed can be easily separated off as volatile compound, and the Am metal is brought into a very pure form by sublimation suitable for spectrochemical investigations. Attempts to prepare binary germanides and gallides of 241 americium were unsuccessful. (RB) [de

  1. Mid-infrared supercontinuum generation to 12.5μm in large NA chalcogenide step-index fibres pumped at 4.5μm

    DEFF Research Database (Denmark)

    Kubat, Irnis; Agger, Christian; Møller, Uffe Visbech

    2014-01-01

    We present numerical modeling of mid-infrared (MIR) supercontinuum generation (SCG) in dispersion-optimized chalcogenide (CHALC) step-index fibres (SIFs) with exceptionally high numerical aperture (NA) around one, pumped with mode-locked praseodymium-doped (Pr3+) chalcogenide fibre lasers. The 4...... for the highest NA considered but required pumping at 4.7kW as well as up to 3m of fibre to compensate for the lower nonlinearities. The amount of power converted into the 8-10 μm band was 7.5 and 8.8mW for the 8 and 10μm fibres, respectively. For the 20μm core fibres up to 46mW was converted....

  2. Thermal Properties of the Silicon Microstrip Endcap Detector

    CERN Document Server

    Feld, Lutz; Hammarström, R

    1998-01-01

    Irradiated silicon detectors must be cooled in order to guarantee stable short and long term operation. Using the SiF1 milestone prototype we have performed a detailed analysis of the thermal properties of the silicon microstrip endcap detector. The strongest constraint on the cooling system is shown to be set by the need to avoid thermal runaway of the silicon detectors. We show that, taking into account the radiation damage to the silicon after 10 years of LHC operation and including some safety margin, the detector will need a cooling fluid temperature of around -20 C. The highest temperature on the silicon will then be in the range -15 C to -10 C. This sets an upper limit on the ambient temperature in the tracker volume.

  3. Reliability and risk treatment centered maintenance

    International Nuclear Information System (INIS)

    Pexa, Martin; Hladik, Tomas; Ales, Zdenek; Legat, Vaclav; Muller, Miroslav; Valasek, Petr; Havlu, Vit

    2014-01-01

    We propose a new methodology for application of well-known tools - RCM, RBI and SIF pro - with the aim to treat risks by means of suitable maintenance. The basis of the new methodology is the complex application of all three methods at the same time and not separately as is typical today. The proposed methodology suggests having just one managing team for reliability and risk treatment centred maintenance (RRTCM), employing existing RCM, RBI, and SIFpro tools concurrently. This approach allows for significant reduction of engineering activities' duration. In the proposed methodology these activities are staged into five phases and structured to eliminate all duplication resulting from separate application of the three tools. The newly proposed methodology saves 45% to 50% of the engineering workload and dequate significant financial savings.

  4. Persistent current of relativistic electrons on a Dirac ring in presence of impurities

    KAUST Repository

    Ghosh, Sumit

    2014-08-01

    We study the behaviour of persistent current of relativistic electrons on a one dimensional ring in presence of attractive/repulsive scattering potentials. In particular, we investigate the persistent current in accordance with the strength as well as the number of the scattering potential. We find that in presence of single scatterer the persistent current becomes smaller in magnitude than the scattering free scenario. This behaviour is similar to the non-relativistic case. Even for a very strong scattering potential, finite amount of persistent current remains for a relativistic ring. In presence of multiple scatterer we observe that the persistent current is maximum when the scatterers are placed uniformly compared to the current averaged over random configurations. However if we increase the number of scatterers, we find that the random averaged current increases with the number of scatterers. The latter behaviour is in contrast to the non-relativistic case. © 2014 EDP Sciences, SIF, Springer-Verlag Berlin Heidelberg.

  5. Development of a portable mass spectrometric system for determination of isotopic composition of solid uranium samples using fluorine volatilization. Final report

    International Nuclear Information System (INIS)

    Loge, G.

    1994-01-01

    Using hardware and materials supplied by LANL, a prototype quadrupole mass spectrometer system designed for portable field analysis of isotopic composition of solid uranium samples was assembled and tested. The system contained the capability for fluorine volatilization of solid uranium samples with gas introduction, which was successfully tested and demonstrated using 100 mg samples of U 3 O 8 . Determination of precision and accuracy for measuring isotopic composition was performed using isotopic standards. Use with soil samples containing uranium were also attempted. Silicates in the soil forming SiF 4 were found to be a kinetic bottleneck to the formation of UF 6 . This could be avoided by performing some sort of chemical separation as a pre-treatment step, which was demonstrated using nitric acid

  6. Reliability and risk treatment centered maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Pexa, Martin; Hladik, Tomas; Ales, Zdenek; Legat, Vaclav; Muller, Miroslav; Valasek, Petr [Czech University of Life Sciences Prague, Kamycka (Czech Republic); Havlu, Vit [Unipetrol A. S, Prague (Czech Republic)

    2014-10-15

    We propose a new methodology for application of well-known tools - RCM, RBI and SIF pro - with the aim to treat risks by means of suitable maintenance. The basis of the new methodology is the complex application of all three methods at the same time and not separately as is typical today. The proposed methodology suggests having just one managing team for reliability and risk treatment centred maintenance (RRTCM), employing existing RCM, RBI, and SIFpro tools concurrently. This approach allows for significant reduction of engineering activities' duration. In the proposed methodology these activities are staged into five phases and structured to eliminate all duplication resulting from separate application of the three tools. The newly proposed methodology saves 45% to 50% of the engineering workload and dequate significant financial savings.

  7. The role played by the Coulombic traction for an interface crack in dissimilar piezoelectric materials

    International Nuclear Information System (INIS)

    Li Qun; Chen Yiheng

    2008-01-01

    The role played by the Coulombic traction for an interface crack in dissimilar piezoelectric materials is clarified. Based on the extended Stroh theory, the Coulombic traction, usually neglected in piezoelectric fracture, is imposed on the interface crack surfaces. It is found that the low-capacitance medium (air or vacuum) inside the crack gap yields some large Coulombic traction as compared to the applied mechanical loading whether the remanent polarization of piezoelectric material is considered or not. Thus, previous investigations based on the traction-free condition underestimate the role of the Coulombic traction and in turn may yield unexpected errors for the effective stress intensity factor (SIF) and energy release rate (ERR) at the crack tip. (technical note)

  8. Update on Recovering Lead From Scrap Batteries

    Science.gov (United States)

    Cole, E. R.; Lee, A. Y.; Paulson, D. L.

    1985-02-01

    Previous work at the Bureau of Mines Rolla Research Center, U.S. Department of the Interior, resulted in successful development of a bench-scale, combination electrorefining-electrowinning method for recycling lead from scrap batteries by using waste fluosilicic acid (H2SiF6) as electrolyte.1,2 This paper describes larger scale experiments. Prior attempts to electrowin lead failed because large quantities of insoluble lead dioxide were deposited on the anodes at the expense of lead deposition on the cathodes. A major breakthrough was achieved with the discovery that lead dioxide formation at the anodes is prevented by adding a small amount of phosphorus to the electrolyte. The amount of PbO2 formed on the anodes during lead electrowinning was less than 1% of the total lead deposited on the cathodes. This work recently won the prestigious IR·100 award as one of the 100 most significant technological advances of 1984.

  9. Metal-enhanced fluorescence exciplex emission.

    Science.gov (United States)

    Zhang, Yongxia; Mali, Buddha L; Geddes, Chris D

    2012-01-01

    In this letter, we report the first observation of metal-enhanced exciplex fluorescence, observed from anthracene in the presence of diethylaniline. Anthracene in the presence of diethylaniline in close proximity to Silver Island Films (SIFs) shows enhanced monomer and exciplex emission as compared to a non-silvered control sample containing no silver nanoparticles. Our findings suggest two complementary methods for the enhancement: (i) surface plasmons can radiate coupled monomer and exciplex fluorescence efficiently, and (ii) enhanced absorption (enhanced electric near-field) further facilitates enhanced emission. Our exciplex studies help us to further understand the complex photophysics of the metal-enhanced fluorescence technology. Copyright © 2011 Elsevier B.V. All rights reserved.

  10. Interrogating Europe’s Voids of Memory: Trauma Theory and Holocaust Remembrance between the National and the Transnational

    Directory of Open Access Journals (Sweden)

    Larissa Allwork

    2016-12-01

    Full Text Available Reflecting on the research process for Holocaust Remembrance between the National and the Transnational (HRNT, which explores and analyzes the significance of the European and global politics of the commemoration of the Holocaust and Nazi-era crimes in the late 1990s and 2000s, this article will consider the influence of the intellectual context of trauma theory for this book. It will offer a response to the increasing critique of Eurocentric trauma theory which developed during the period spent researching the Stockholm International Forum (SIF 2000 and the first decade of the Task Force for International Co-operation on Holocaust Education, Remembrance and Research (ITF, now the International Holocaust Remembrance Alliance, IHRA. This article will discuss how a revised trauma theory, along the lines suggested by scholars such as Joshua Pederson, continues to offer important possibilities for European studies of the histories and memories of the Holocaust in singular and comparative terms

  11. TECHNICAL ASPECTS COMPARING THE IFRS AND THE US GAAP CONCERNING FINANCIAL INVESTMENT COMPANIES

    Directory of Open Access Journals (Sweden)

    Luminita Paiusan

    2014-11-01

    Full Text Available In the context of current interconnected capital markets, all the investors, regardless their country of origin would be provided with the improvement of the quality and comparability of financial information due to the high quality of some common standards of financial reporting. In order to achieve this, the two bodies, the FASB and the IASB, are working together to reduce the differences between the IFRS and the US GAAP. However, there are some problems observed by the US SIF managers, which fall under their area of work. They are divided in three groups: The lack of essential information expected by the American investors. For example, the IFRS does not impose the presentation of the investments made by an investment company; Different assessment bases for the financial actives and debts in the IFRS, which influences the main indicators for the investors; Presenting relevant information regarding the risks taken by investment funds and the analysis of proneness to these risks.

  12. Thermal shock resistance behavior of a functionally graded ceramic: Effects of finite cooling rate

    Directory of Open Access Journals (Sweden)

    Zhihe Jin

    2014-01-01

    Full Text Available This work presents a semi-analytical model to explore the effects of cooling rate on the thermal shock resistance behavior of a functionally graded ceramic (FGC plate with a periodic array of edge cracks. The FGC is assumed to be a thermally heterogeneous material with constant elastic modulus and Poisson's ratio. The cooling rate applied at the FGC surface is modeled using a linear ramp function. An integral equation method and a closed form asymptotic temperature solution are employed to compute the thermal stress intensity factor (TSIF. The thermal shock residual strength and critical thermal shock of the FGC plate are obtained using the SIF criterion. Thermal shock simulations for an Al2O3/Si3N4 FGC indicate that a finite cooling rate leads to a significantly higher critical thermal shock than that under the sudden cooling condition. The residual strength, however, is relatively insensitive to the cooling rate.

  13. Development of a portable mass spectrometric system for determination of isotopic composition of solid uranium samples using fluorine volatilization

    Science.gov (United States)

    Loge, G.

    1994-09-01

    Using hardware and materials supplied by LANL, a prototype quadrupole mass spectrometer system designed for portable field analysis of isotopic composition of solid uranium samples was assembled and tested. The system contained the capability for fluorine volatilization of solid uranium samples with gas introduction, which was successfully tested and demonstrated using 100 mg samples of U3O8. Determination of precision and accuracy for measuring isotopic composition was performed using isotopic standards. Use with soil samples containing uranium were also attempted. Silicates in the soil forming SiF4 were found to be a kinetic bottleneck to the formation of UF6. This could be avoided by performing some sort of chemical separation as a pre-treatment step, which was demonstrated using nitric acid.

  14. Recovery Process of Li, Al and Si from Lepidolite by Leaching with HF

    Directory of Open Access Journals (Sweden)

    Gustavo D. Rosales

    2017-03-01

    Full Text Available This work describes the development of a new process for the recovery of Li, Al and Si along with the proposal of a flow sheet for the precipitation of those metals. The developed process is comprised of lepidolite acid digestion with hydrofluoric acid, and the subsequent precipitation of the metals present in the leach liquor. The leaching operational parameters studied were: reaction time, temperature and HF concentration. The experimental results indicate that the optimal conditions to achieve a Li extraction higher than 90% were: solid-liquid ratio, 1.82% (w/v; temperature, 123 °C; HF concentration, 7% (v/v; stirring speed, 330 rpm; and reaction time, 120 min. Al and Si can be recovered as Na3AlF6 and K2SiF6. LiF was separated from the leach liquor during water evaporation, with recovery values of 92%.

  15. Determination of oxygen impurity in high purity materials by charged particle activation analysis using alpha projectiles

    International Nuclear Information System (INIS)

    Chowdhury, D.P.; Pal, S.; Arunachalam, J.; Verma R.; Gangadharan, S.

    1992-01-01

    40 MeV α-particles have been used to determine oxygen impurity at ppm levels in silicon, copper, and stainless steel, through the radiochemical separation of 18 F from the matrix. The separation of 18 F has been carried out by two techniques, viz. distillation of H 2 SiF 6 and precipitation of KBF 4 and some modification has been applied in the separation, depending on the nature of interferences from the matrix. Instrumental approach was also carried out to determine the oxygen impurity at ≥ 100 ppm in Si matrix because this approach is not possible in Cu and stainless steel samples due to matrix activity. (author) 10 refs.; 1 fig.; 5 tabs

  16. Analysis of Thermo-Elastic Fracture Problem during Aluminium Alloy MIG Welding Using the Extended Finite Element Method

    Directory of Open Access Journals (Sweden)

    Kuanfang He

    2017-01-01

    Full Text Available The thermo-elastic fracture problem and equations are established for aluminium alloy Metal Inert Gas (MIG welding, which include a moving heat source and a thermoelasticity equation with the initial and boundary conditions for a plate structure with a crack. The extended finite element method (XFEM is implemented to solve the thermo-elastic fracture problem of a plate structure with a crack under the effect of a moving heat source. The combination of the experimental measurement and simulation of the welding temperature field is done to verify the model and solution method. The numerical cases of the thermomechanical parameters and stress intensity factors (SIFs of the plate structure in the welding heating and cooling processes are investigated. The research results provide reference data and an approach for the analysis of the thermomechanical characteristics of the welding process.

  17. POTENCIAL DAS PRINCIPAIS REGIÕES BRASILEIRAS PARA ABASTECIMENTO DE SANGUE DE BOVINOS E SUÍNOS – MELHORIA DA RENTABILIDADE E OPORTUNIDADE DE INVESTIMENTO

    OpenAIRE

    Carvalho, Thiago Bernardino de; Menezes, Shirley Martins; Zen, Sergio de; Lot, Luiz Rodrigo Teixeira

    2006-01-01

    O Brasil é reconhecidamente um dos maiores fornecedores mundiais de carnes, responsável por parte do abastecimento de diversos países. Nesse início de 2006 o MAPA relaciona 270 matadouros de bovinos e 123 de suínos distribuídos em todo o território nacional como SIF. De acordo com os dados do IBGE, os abates de bovinos totalizam cerca de 20,7 milhões de cabeças em 2005 e os de suínos, 21,8 cabeças, volumes que vêm aumentando ano após ano. O aproveitamento do sangue, assim como de outros subpr...

  18. The OCO-3 Mission: Science Objectives and Instrument Performance

    Science.gov (United States)

    Eldering, A.; Basilio, R. R.; Bennett, M. W.

    2017-12-01

    The Orbiting Carbon Observatory 3 (OCO-3) will continue global CO2 and solar-induced chlorophyll fluorescence (SIF) using the flight spare instrument from OCO-2. The instrument is currently being tested, and will be packaged for installation on the International Space Station (ISS) (launch readiness in early 2018.) This talk will focus on the science objectives, updated simulations of the science data products, and the outcome of recent instrument performance tests. The low-inclination ISS orbit lets OCO-3 sample the tropics and sub-tropics across the full range of daylight hours with dense observations at northern and southern mid-latitudes (+/- 52º). The combination of these dense CO2 and SIF measurements provides continuity of data for global flux estimates as well as a unique opportunity to address key deficiencies in our understanding of the global carbon cycle. The instrument utilizes an agile, 2-axis pointing mechanism (PMA), providing the capability to look towards the bright reflection from the ocean and validation targets. The PMA also allows for a snapshot mapping mode to collect dense datasets over 100km by 100km areas. Measurements over urban centers could aid in making estimates of fossil fuel CO2 emissions. Similarly, the snapshot mapping mode can be used to sample regions of interest for the terrestrial carbon cycle. In addition, there is potential to utilize data from ISS instruments ECOSTRESS (ECOsystem Spaceborne Thermal Radiometer Experiment on Space Station) and GEDI (Global Ecosystem Dynamics Investigation), which measure other key variables of the control of carbon uptake by plants, to complement OCO-3 data in science analysis. In 2017, the OCO-2 instrument was transformed into the ISS-ready OCO-3 payload. The transformed instrument was thoroughly tested and characterized. Key characteristics, such as instrument ILS, spectral resolution, and radiometric performance will be described. Analysis of direct sun measurements taken during testing

  19. Josephson junctions with ferromagnetic interlayer

    International Nuclear Information System (INIS)

    Wild, Georg Hermann

    2012-01-01

    We report on the fabrication of superconductor/insulator/ferromagnetic metal/superconductor (Nb/AlO x /Pd 0.82 Ni 0.18 /Nb) Josephson junctions (SIFS JJs) with high critical current densities, large normal resistance times area products, and high quality factors. For these junctions, a transition from 0- to π-coupling is observed for a thickness d F =6 nm of the ferromagnetic Pd 0.82 Ni 0.18 interlayer. The magnetic field dependence of the critical current of the junctions demonstrates good spatial homogeneity of the tunneling barrier and ferromagnetic interlayer. Magnetic characterization shows that the Pd 0.82 Ni 0.18 has an out-of-plane anisotropy and large saturation magnetization indicating negligible dead layers at the interfaces. A careful analysis of Fiske modes up to about 400 GHz provides valuable information on the junction quality factor and the relevant damping mechanisms. Whereas losses due to quasiparticle tunneling dominate at low frequencies, at high frequencies the damping is explained by the finite surface resistance of the junction electrodes. High quality factors of up to 30 around 200 GHz have been achieved. They allow to study the junction dynamics, in particular the switching probability from the zero-voltage into the voltage state with and without microwave irradiation. The experiments with microwave irradiation are well explained within semi-classical models and numerical simulations. In contrast, at mK temperature the switching dynamics without applied microwaves clearly shows secondary quantum effects. Here, we could observe for the first time macroscopic quantum tunneling in Josephson junctions with a ferromagnetic interlayer. This observation excludes fluctuations of the critical current as a consequence of an unstable magnetic domain structure of the ferromagnetic interlayer and affirms the suitability of SIFS Josephson junctions for quantum information processing.

  20. Considerações clínicas e cirúrgicas sobre aneurismas intracranianos

    Directory of Open Access Journals (Sweden)

    Mário S. Cademartori

    1969-09-01

    Full Text Available São revistos os principais sintomas apresentados por 83 pacientes com aneurismas intracranianos nas seguintes localizações: 41 no sistema carotídeo, 19 no da artéria silviana, 19 no da artéria cerebral anterior e 4 no da artéria basilar. Como método de tratamento, a cirurgia intracraniana foi realizada em 49 pacientes, dos quais 27 apresentavam aneurisma no sifão carotídeo, 14 na cerebral média e 8 na cerebral anterior. A mortalidade operatoria foi de 37% entre os pacientes com aneurisma do sifão carotídeo, de 28,5% nos do grupo da artéria silviana e de 50% nos do grupo da artéria cerebral anterior. Não houve óbito nos 7 pacientes nos quais foi feita oclusão da carótida. A morbilidade foi de 12% nos casos de aneurismas carotídeos, de 20% nos de aneurismas da cerebral média, de 50% nos de cerebral anterior e de 29% naqueles em que a carótida primitiva foi ligada. Como métodos auxiliares, foi utilizada a hipotermia com circulação extra-corpórea em dois pacientes com aneurismas da artéria comunicante anterior e drenagem espinhal contínua em 19 casos. Controles arteriográficos pós-operatórios, feitos em 16 casos, permitiram verificar a eficácia dos procedimentos utilizados bem como algumas falhas de técnica cirúrgica.

  1. Percutaneous sacroplasty with the use of C-arm flat-panel detector CT: technical feasibility and clinical outcome

    International Nuclear Information System (INIS)

    Kang, Sung Eun; Lee, Joon Woo; Kim, Joo Hyung; Kang, Heung Sik; Park, Kun Woo; Yeom, Jin S.

    2011-01-01

    Sacroplasty for sacral insufficiency fractures (SIFs) has been performed mostly under computed tomography (CT) or fluoroscopy guidance. The purposes of this study are to describe technical tips and clinical outcomes of sacroplasty under C-arm flat panel detector CT (C-arm CT) guidance, and to compare the cement distributions shown on C-arm CT with those on multi-detector CT (MDCT). This study consisted of patients who underwent sacroplasty for SIF using C-arm CT from May 2006 to May 2009. Technical success was assessed in terms of cement filling and leakage. Clinical outcome was assessed at short-term (less than 1 month) and long-term (more than 1 month) follow-up using a four-grade patient satisfaction scale: poor, fair, good, and excellent. After sacroplasty, all patients underwent MDCT and three radiologists compared MDCT images with C-arm CT images in consensus, focusing on the cement distribution and cement leakage. Sacroplasties were performed on both sacral alae in all 8 patients (male:female = 2:6, mean age = 76.9, range = 63-82). The technical success rate was 100%. At short-term follow up, 6 patients (87.5%) reported significant improvement. Five patients (62.5%) were available for long-term follow-up and all 5 patients reported a reduced pain and an improved ability to ambulate. Using MDCT as the standard of reference, the cement distribution was visualized equally well by C-arm CT. Sacroplasty under C-arm CT showed excellent technical success and good clinical outcome. There was an excellent correlation between C-arm CT and MDCT in evaluating cement distribution and cement leakage. (orig.)

  2. Evaluation Metrics for Simulations of Tropical South America

    Science.gov (United States)

    Gallup, S.; Baker, I. T.; Denning, A. S.; Cheeseman, M.; Haynes, K. D.; Phillips, M.

    2017-12-01

    The evergreen broadleaf forest of the Amazon Basin is the largest rainforest on earth, and has teleconnections to global climate and carbon cycle characteristics. This region defies simple characterization, spanning large gradients in total rainfall and seasonal variability. Broadly, the region can be thought of as trending from light-limited in its wettest areas to water-limited near the ecotone, with individual landscapes possibly exhibiting the characteristics of either (or both) limitations during an annual cycle. A basin-scale classification of mean behavior has been elusive, and ecosystem response to seasonal cycles and anomalous drought events has resulted in some disagreement in the literature, to say the least. However, new observational platforms and instruments make characterization of the heterogeneity and variability more feasible.To evaluate simulations of ecophysiological function, we develop metrics that correlate various observational products with meteorological variables such as precipitation and radiation. Observations include eddy covariance fluxes, Solar Induced Fluorescence (SIF, from GOME2 and OCO2), biomass and vegetation indices. We find that the modest correlation between SIF and precipitation decreases with increasing annual precipitation, although the relationship is not consistent between products. Biomass increases with increasing precipitation. Although vegetation indices are generally correlated with biomass and precipitation, they can saturate or experience retrieval issues during cloudy periods.Using these observational products and relationships, we develop a set of model evaluation metrics. These metrics are designed to call attention to models that get "the right answer only if it's for the right reason," and provide an opportunity for more critical evaluation of model physics. These metrics represent a testbed that can be applied to multiple models as a means to evaluate their performance in tropical South America.

  3. Percutaneous sacroplasty with the use of C-arm flat-panel detector CT: technical feasibility and clinical outcome

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Sung Eun; Lee, Joon Woo; Kim, Joo Hyung; Kang, Heung Sik [Seoul National University Bundang Hospital, Department of Radiology, Gyeonggi-do (Korea, Republic of); Park, Kun Woo; Yeom, Jin S. [Seoul National University Bundang Hospital, Department of Orthopaedic Surgery, Gyeonggi-do (Korea, Republic of)

    2011-04-15

    Sacroplasty for sacral insufficiency fractures (SIFs) has been performed mostly under computed tomography (CT) or fluoroscopy guidance. The purposes of this study are to describe technical tips and clinical outcomes of sacroplasty under C-arm flat panel detector CT (C-arm CT) guidance, and to compare the cement distributions shown on C-arm CT with those on multi-detector CT (MDCT). This study consisted of patients who underwent sacroplasty for SIF using C-arm CT from May 2006 to May 2009. Technical success was assessed in terms of cement filling and leakage. Clinical outcome was assessed at short-term (less than 1 month) and long-term (more than 1 month) follow-up using a four-grade patient satisfaction scale: poor, fair, good, and excellent. After sacroplasty, all patients underwent MDCT and three radiologists compared MDCT images with C-arm CT images in consensus, focusing on the cement distribution and cement leakage. Sacroplasties were performed on both sacral alae in all 8 patients (male:female = 2:6, mean age = 76.9, range = 63-82). The technical success rate was 100%. At short-term follow up, 6 patients (87.5%) reported significant improvement. Five patients (62.5%) were available for long-term follow-up and all 5 patients reported a reduced pain and an improved ability to ambulate. Using MDCT as the standard of reference, the cement distribution was visualized equally well by C-arm CT. Sacroplasty under C-arm CT showed excellent technical success and good clinical outcome. There was an excellent correlation between C-arm CT and MDCT in evaluating cement distribution and cement leakage. (orig.)

  4. Investigation of Enhanced Leaching of Lithium from α-Spodumene Using Hydrofluoric and Sulfuric Acid

    Directory of Open Access Journals (Sweden)

    Hui Guo

    2017-10-01

    Full Text Available An effective method using hydrofluoric and sulfuric acid was proposed to enhance the leaching of lithium from α-spodumene, without calcination that is subjected to 1000 °C for phase transformation. The thermodynamic feasibility of the reactions was firstly verified. Dissolution conditions were tested to maximize the leaching efficiency of lithium and with efficient utilization of hydrofluoric acid (HF served as evaluation criteria. The results showed that 96% of lithium could be transferred into lixivium with an ore/HF/H2SO4 ratio of 1:3:2 (g/mL/mL, at 100 °C for 3 h. Due to the fact that HF molecules were the main reaction form, the dissolution behaviors were theoretically represented and investigated by dissolution in HF/H2SO4. When combined with chemical elements analyses and characterizations, the results of the dissolution behaviors revealed that α-spodumene and albite were preferentially dissolved over quartz. Insoluble fluoroaluminates, such as AlF3, cryolite (Na3AlF6 and cryolithionite (Na3Li3Al2F12, were generated and might be further partially dissolved by H2SO4. Fluorosilicates, such as K2SiF6, Na2SiF6, or KNaSiF6, were also generated as a part of the insoluble residues. This work provides fundamental insight into the role of HF/H2SO4 played in the dissolution of α-spodumene, and sheds light on a novel and promising process to efficiently extract lithium.

  5. A Novel simultaneous-Saccharification-Fermentation Strategy for Efficient Co-fermentation of C5 and C6 Sugars Using Native, Non-GMO Yeasts

    Energy Technology Data Exchange (ETDEWEB)

    Varanasi, Sasidhar [Univ. of Toledo, OH (United States); Relue, Patricia [Univ. of Toledo, OH (United States)

    2013-09-30

    Economic bioethanol production is critically dependent upon the ability to convert both the hexose (C6) and pentose (C5) sugars resulting from cellulose and hemicellulose. C5 sugars are not readily fermentable by native Saccharomyces cerevisiae. Genetically Modified Organisms (GMOs) are designed to ferment xylose, but their stability, ethanol yield, environmental impact, and survival under conditions of industrial fermentation are unproven. In this project, we developed a novel approach for efficient fermentation of both C5 and C6 sugars using native S. Cerevisiae by exploiting its ability to produce ethanol from xylulose - the keto-isomer of xylose. While the isomerization of xylose to xylulose can be accomplished via commercially (and cheaply) available Xylose Isomerase (XI) (Sweetzyme™), this conversion has an extremely unfavorable equilibrium (xylose:xylose is about 5:1). To address this, we developed two alternate strategies. In the first, the two enzymes XI and urease are coimmobilized on solid support particles to enable complete isomerization of xylose to xylulose under pH conditions suitable for fermentation, in a simultaneous-isomerization-fermentation (SIF) mode. The ability of our technology to conduct isomerization of xylose under pH conditions suitable for both saccharification and fermentation opens the possibility of SSF with native yeasts for the first time. Herein, we performed specific research tasks for implementation of our technology in several modes of operation, including simultaneous-isomerization-and-fermentation (SIF), simultaneous-saccharification-and-isomerization (SSI) followed by fermentation, and SSF mode with the biomass feedstock poplar. The projected economics of our process are very favorable in comparison to the costs associated with engineering, licensing and propagating GMOs. This novel fermentation technology is readily accessible to rural farming economies for implementation in cellulosic ethanol production facilities.

  6. Identification of major rice allergen and their clinical significance in children

    Directory of Open Access Journals (Sweden)

    You Hoon Jeon

    2011-10-01

    Full Text Available Purpose : Recently, an increase in the number of patients sensitized to rice allergen with or without clinical symptoms has been reported. This study was designed to determine the major allergens in rice and their clinical significance. Methods : Twenty-four children (15 boys and 9 girls; mean age, 16.3 months with allergic disease, who were sensitized to rice antigen (by UniCAP in the Pediatric Allergy Respiratory Center at Soonchunhyang University Hospital, were enrolled in this study. The allergenicity of various types of rice (raw, cooked, and heat-treated, simulated gastric fluid [SGF], and simulated intestinal fluid [SIF] was investigated using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE and immunoglobulin E (IgE immunoblots. The patients’ medical records, including laboratory data and allergy symptoms after ingestion of rice were reviewed. Results : Patients were sensitized to an average of 13.5 food antigens and their mean total IgE was 6,888.7 kU/L. In SDS-PAGE, more than 16 protein bands were observed in the raw rice, whereas only 14-16 kDa and 31-35 kDa protein bands were observed in cooked rice. The common SDS-PAGE protein bands observed in SGF-, SIF-, and heattreated rice were 9, 14, and 31 kDa. In a heated-rice IgE immunoblot, protein bands of 9, 14, and 31-33 kDa were found in 27.8%, 38.9%, and 38.9% of all sera, respectively, and in 50%, 50%, and 75%, of ser a from the 4 symptomatic patients, respectively. Conclusion : The 9-, 14-, and 31-kDa protein bands appeared to be the major allergens responsible for rice allergy symptoms.

  7. Hot atom reactions involving multivalent and univalent species. Progress report, February 1979-January 1980

    International Nuclear Information System (INIS)

    Tang, Y.N.

    1980-01-01

    The major progress during this period was in the study of recoil 31 Si and recoil 11 C reactions and in the initiation of the studies on the interaction of molecular tritium on solid surfaces. For the recoil 31 Si systems, heterogeneous hydrogenation experiments have been designed to positively confirm that a major unknown product, derived from the interaction of 31 Si atoms with 1,3-butadiene, is 1-silacyclopenta-2,4-diene. This compound has been shown to be very sensitive to γ-ray irradiation and to be thermally unstable at a temperature higher than 100 0 C. Another recoil 31 Si experiment was designed to review the mechanism of the 31 Si abstraction reactions. From the fact that high yields of [ 31 Si]-1-fluorosilacyclopent-3-ene were obtained as a product from a mixture of PH 3 and PF 3 together with 1,3-butadiene, the stepwise abstraction mechanism is definitely much more predominant than the possible simultaneous abstraction. Other recoil 31 Si works involved a detailed systematic composition study of 31 SiF 2 reactions with 1,3-butadiene, some neon moderator studies, and the continuation of the studies on the reactions of 31 SiF 2 and 31 SiH 2 with conjugated hexadienes. By using 2- 14 C-propanone and 1,3- 14 C-propanone, the mechanism of solvent-free oxidative cleavage of propanone by KMnO 4 was elucidated. Information thus derived was used to degradate the 11 C-labelled propadiene derived from the reactions of recoil 11 C atoms with ethylene. Results indicate that 73% of the 11 C-labelled propadiene was center-labelled. This value was observed to change with additives. Various mechanistic studies on the heterogeneous interactions of molecular T 2 on solid surfaces such as Pd supported on active carbon have been initiated

  8. Visualization of the current density in Josephson junctions with 0- and {pi}-facets; Visualisierung der Stromverteilung in Josephsonkontakten mit 0- und {pi}-Facetten

    Energy Technology Data Exchange (ETDEWEB)

    Guerlich, Christian

    2010-05-11

    With Low-Temperature-Electron-Microscopy (LTSEM) it is possible to analyse the transport properties of solids at low temperatures. In particular it is possible to image the supercurrent density j{sub s} in Josephson junctions. This was demonstrated by comparing TTREM-images with calculated values for j{sub s}. In this thesis ramp-type Nd{sub 2-x}Ce{sub x}CuO{sub 4-y}/Nb-Josephson-junctions (NCCO/Nb) and Josephson junctions with a ferromagnetic interlayer Nb/Al-Al{sub 2}O{sub 3}/NiCu/Nb, so-called SIFS (superconductor-insulator-ferromagnet-superconductor) Josephson junctions were studied.It was demonstrated that LTSEM provides direct imaging of the sign change of the order parameter in superconductors with d{sub x{sup 2}-y{sup 2}}-symmetry. This was a controversial issue over the last decade. A step like variation in the thickness of the F-layer allows the fabrication of linear and annular Josephson junctions with different numbers of 0 and {pi} facets. With the LTSEM 0-, {pi}-, 0-{pi}-, 0-{pi}-0-, 0/2-{pi}-0/2-, 20 x (0-{pi})- as well as square-shaped-, circular- and annular-Josephson-junctions were studied. It was demonstrated, that these junctions are of good quality and have critical current densities up to 42 A/cm{sup 2} at T=4.2 K, which is a record value for SIFS junctions with a NiCu F-layer so far. By comparing the measurements with simulations a first indication of a semifluxon at the 0-{pi}-boundary was found. (orig.)

  9. Surface modified natural zeolite as a carrier for sustained diclofenac release: A preliminary feasibility study.

    Science.gov (United States)

    de Gennaro, Bruno; Catalanotti, Lilia; Cappelletti, Piergiulio; Langella, Alessio; Mercurio, Mariano; Serri, Carla; Biondi, Marco; Mayol, Laura

    2015-06-01

    In view of zeolite potentiality as a carrier for sustained drug release, a clinoptilolite-rich rock from California (CLI_CA) was superficially modified with cetylpyridinium chloride and loaded with diclofenac sodium (DS). The obtained surface modified natural zeolites (SMNZ) were characterized by confocal scanning laser microscopy (CLSM), powder X-ray diffraction (XRPD) and laser light scattering (LS). Their flowability properties, drug adsorption and in vitro release kinetics in simulated intestinal fluid (SIF) were also investigated. CLI_CA is a Na- and K-rich clinoptilolite with a cationic exchange ability that fits well with its zeolite content (clinoptilolite=80 wt%); the external cationic exchange capacity is independent of the cationic surfactant used. LS and CLSM analyses have shown a wide distribution of volume diameters of SMNZ particles that, along with their irregular shape, make them cohesive with scarce flow properties. CLSM observation has revealed the localization of different molecules in/on SMNZ by virtue of their chemical nature. In particular, cationic and polar probes prevalently localize in SMNZ bulk, whereas anionic probes preferentially arrange themselves on SMNZ surface and the loading of a nonpolar molecule in/on SMNZ is discouraged. The adsorption rate of DS onto SMNZ was shown by different kinetic models highlighting the fact that DS adsorption is a pseudo-second order reaction and that the diffusion through the boundary layer is the rate-controlling step of the process. DS release in an ionic medium, such as SIF, can be sustained for about 5h through a mechanism prevalently governed by anionic exchange with a rapid final phase. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Prospects for Chlorophyll Fluorescence Remote Sensing from the Orbiting Carbon Observatory-2

    Science.gov (United States)

    Frankenberg, Christian; Odell, Chris; Berry, Joseph; Guanter, Luis; Joiner, Joanna; Kohler, Philipp; Pollock, Randy; Taylor, Thomas E.

    2014-01-01

    The Orbiting Carbon Observatory-2 (OCO-2), scheduled to launch in July 2014, is a NASA mission designed to measure atmospheric CO2. Its main purpose is to allow inversions of net flux estimates of CO2 on regional to continental scales using the total column CO2 retrieved using high-resolution spectra in the 0.76, 1.6, and 2.0 nm ranges. Recently, it was shown that solar-induced chlorophyll fluorescence (SIF), a proxy for gross primary production (GPP, carbon uptake through photosynthesis), can be accurately retrieved from space using high spectral resolution radiances in the 750 nm range from the Japanese GOSAT and European GOME-2 instruments. Here, we use real OCO-2 thermal vacuum test data as well as a full repeat cycle (16 days) of simulated OCO-2 spectra under realistic conditions to evaluate the potential of OCO-2 for retrievals of chlorophyll fluorescence and also its dependence on clouds and aerosols. We find that the single-measurement precision is 0.3-0.5 Wm(exp -2)sr(exp -1) nm(exp -1) (15-25% of typical peak values), better than current measurements from space but still difficult to interpret on a single-sounding basis. The most significant advancement will come from smaller ground-pixel sizes and increased measurement frequency, with a 100-fold increase compared to GOSAT (and about 8 times higher than GOME-2). This will largely decrease the need for coarse spatial and temporal averaging in data analysis and pave the way to accurate local studies.We also find that the lack of full global mapping from the OCO-2 only incurs small representativeness errors on regional averages. Eventually, the combination of net ecosystem exchange (NEE) derived from CO2 source/sink inversions and SIF as proxy for GPP from the same satellite will provide a more process-based understanding of the global carbon cycle.

  11. Effect of UV irradiations on the structural and optical features of porous silicon: application in silicon solar cells

    International Nuclear Information System (INIS)

    Aouida, S.; Saadoun, M.; Boujmil, M.F.; Ben Rabha, M.; Bessaies, B.

    2004-01-01

    The aim of this paper is to investigate the structural and optical stability of porous silicon layers (PSLs) planned to be used in silicon solar cells technology. The PSLs were prepared by a HNO 3 /HF vapor etching (VE) based method. Fourier transform infrared (FT-IR) spectroscopy shows that fresh VE-based PSLs contain N-H and Si-F bonds related to a ammonium hexafluorosilicate (NH 4 ) 2 SiF 6 minor phase, and conventional Si-H x and Si-O x bonds. Free air exposures of PSLs without and with UV irradiation lead to oxidation or photo-oxidation of the porous layer, respectively. FT-IR characterisation of the PSLs shows that UV irradiations modify the transformation kinetics replacing instable Si-H x by Si-O x or Si-O-H bonds. When fresh PSLs undergo free air oxidation within 7 days, the surface reflectivity decreases from 10 to about 8%, while it drops to about 4% when a 10 min free air UV irradiation is applied. Long periods of free air oxidation do not ensure the reflectivity to be stable, whereas it becomes stable after only 10 min of UV irradiation. This behaviour was explained taking into account the kinetic differences between oxidation with and without UV irradiation. Fresh VE-based PSLs were found to improve efficiently the photovoltaic (PV) characteristics of crystalline silicon solar cells. The passivating action of VE-based PSLs was discussed. An improvement of the PV performances was observed solely for stable oxidized porous silicon (PS) structures obtained from UV irradiations

  12. Photoluminescence properties of Tb3Al5O12:Ce3+ garnet synthesized by the metal organic decomposition method

    Science.gov (United States)

    Onishi, Yuya; Nakamura, Toshihiro; Adachi, Sadao

    2017-02-01

    Tb3Al5O12:Ce3+ garnet (TAG:Ce3+) phosphor was synthesized by the metal organic decomposition (MOD) method and subsequent calcination at Tc = 800-1200°C for 1 h in air. The effects of Ce3+ concentration on the phosphor properties were investigated in detail using X-ray diffraction (XRD) analysis, photoluminescence (PL) analysis, PL excitation (PLE) spectroscopy, and PL decay measurements. The maximum intensity in the Ce3+ yellow emission was observed at the Ce3+ concentration of ∼0.20%. PLE and PL decay measurements suggested an evidence of the energy transfer from Tb3+ to Ce3+. Calcination temperature dependence of the XRD and PL intensities yielded an energy of ∼1.5 eV both for the TAG formation in the MOD process and for the optical activation of Ce3+ in its lattice sites. Temperature dependences of the PL intensity for the TAG:Ce3+ yellow-emitting and K2SiF6:Mn4+ red-emitting phosphors were also examined for the future solid-state lighting applications at T = 20-500 K in 10-K steps. The data of TAG:Ce3+ were analyzed using a theoretical model with considering a reservoir level of Et ∼9 meV, yielding a quenching energy of Eq ∼0.35 eV, whereas the K2SiF6:Mn4+ red-emitting phosphor data yielded a value of Eq ∼1.0 eV. The schematic energy-level diagrams for Tb3+ and Ce3+ were proposed for the sake of a better understanding of these ions in the TAG host.

  13. Visualization of the current density in Josephson junctions with 0- and π-facets

    International Nuclear Information System (INIS)

    Guerlich, Christian

    2010-01-01

    With Low-Temperature-Electron-Microscopy (LTSEM) it is possible to analyse the transport properties of solids at low temperatures. In particular it is possible to image the supercurrent density j s in Josephson junctions. This was demonstrated by comparing TTREM-images with calculated values for j s . In this thesis ramp-type Nd 2-x Ce x CuO 4-y /Nb-Josephson-junctions (NCCO/Nb) and Josephson junctions with a ferromagnetic interlayer Nb/Al-Al 2 O 3 /NiCu/Nb, so-called SIFS (superconductor-insulator-ferromagnet-superconductor) Josephson junctions were studied.It was demonstrated that LTSEM provides direct imaging of the sign change of the order parameter in superconductors with d x 2 -y 2 -symmetry. This was a controversial issue over the last decade. A step like variation in the thickness of the F-layer allows the fabrication of linear and annular Josephson junctions with different numbers of 0 and π facets. With the LTSEM 0-, π-, 0-π-, 0-π-0-, 0/2-π-0/2-, 20 x (0-π)- as well as square-shaped-, circular- and annular-Josephson-junctions were studied. It was demonstrated, that these junctions are of good quality and have critical current densities up to 42 A/cm 2 at T=4.2 K, which is a record value for SIFS junctions with a NiCu F-layer so far. By comparing the measurements with simulations a first indication of a semifluxon at the 0-π-boundary was found. (orig.)

  14. Josephson junctions with ferromagnetic interlayer

    Energy Technology Data Exchange (ETDEWEB)

    Wild, Georg Hermann

    2012-03-04

    We report on the fabrication of superconductor/insulator/ferromagnetic metal/superconductor (Nb/AlO{sub x}/Pd{sub 0.82}Ni{sub 0.18}/Nb) Josephson junctions (SIFS JJs) with high critical current densities, large normal resistance times area products, and high quality factors. For these junctions, a transition from 0- to {pi}-coupling is observed for a thickness d{sub F}=6 nm of the ferromagnetic Pd{sub 0.82}Ni{sub 0.18} interlayer. The magnetic field dependence of the critical current of the junctions demonstrates good spatial homogeneity of the tunneling barrier and ferromagnetic interlayer. Magnetic characterization shows that the Pd{sub 0.82}Ni{sub 0.18} has an out-of-plane anisotropy and large saturation magnetization indicating negligible dead layers at the interfaces. A careful analysis of Fiske modes up to about 400 GHz provides valuable information on the junction quality factor and the relevant damping mechanisms. Whereas losses due to quasiparticle tunneling dominate at low frequencies, at high frequencies the damping is explained by the finite surface resistance of the junction electrodes. High quality factors of up to 30 around 200 GHz have been achieved. They allow to study the junction dynamics, in particular the switching probability from the zero-voltage into the voltage state with and without microwave irradiation. The experiments with microwave irradiation are well explained within semi-classical models and numerical simulations. In contrast, at mK temperature the switching dynamics without applied microwaves clearly shows secondary quantum effects. Here, we could observe for the first time macroscopic quantum tunneling in Josephson junctions with a ferromagnetic interlayer. This observation excludes fluctuations of the critical current as a consequence of an unstable magnetic domain structure of the ferromagnetic interlayer and affirms the suitability of SIFS Josephson junctions for quantum information processing.

  15. Design of cellulose ether-based macromolecular prodrugs of ciprofloxacin for extended release and enhanced bioavailability.

    Science.gov (United States)

    Amin, Muhammad; Abbas, Nazia Shahana; Hussain, Muhammad Ajaz; Sher, Muhammad; Edgar, Kevin J

    2018-07-01

    The present study reveals the syntheses of hydroxypropylcellulose‑(HPC) and hydroxyethylcellulose‑(HEC) based macromolecular prodrugs (MPDs) of ciprofloxacin (CIP) using homogeneous reaction methodology. Covalently loaded drug content (DC) of each prodrug was quantified using UV-Vis spectrophotometry to determine degree of substitution (DS). HPC-ciprofloxacin (HPC-CIP) conjugates showed DS of CIP in the range 0.87-1.15 whereas HEC-ciprofloxacin (HEC-CIP) conjugates showed DS range 0.51-0.75. Transmission electron microscopy revealed that HPC-CIP conjugate 2 and HEC-CIP conjugate 6 self-assembled into nanoparticles of 150-300 and 180-250nm, respectively. Size exclusion chromatography revealed HPC-CIP conjugate 2 and HEC-CIP conjugate 6 as monodisperse systems. In vitro drug release studies indicated 15 and 43% CIP release from HPC-CIP conjugate 2 after 6h in simulated gastric and simulated intestinal fluids (SGF and SIF), respectively. HEC-CIP conjugate 6 showed 16% and 46% release after 6h in SGF and SIF, respectively. HPC-CIP conjugate 2 and HEC-CIP conjugate 6 exhibited half-lives of 10.87 and 11.71h, respectively with area under the curve values of 164 and 175hμgmL -1 , respectively, indicating enhanced bioavailability and improved pharmacokinetic profiles in animal model. Equal antibacterial activities to that of unmodified CIP confirmed their competitive efficacies. Cytotoxicity studies supported their non-toxic nature and biocompatibility. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Effect of notch dimension on the fatigue life of V-notched structure

    International Nuclear Information System (INIS)

    Cheng Changzheng; Naman, Recho; Niu Zhongrong; Zhou Huanlin

    2011-01-01

    Highlights: → A novel method is proposed to calculate the SIFs of crack at notch tip. → Effect of notch opening angle on the crack extension and propagation is studied. → Influence of notch depth on the crack extension and propagation is analyzed. → The fatigue life of a welded joint is analyzed by the present method. - Abstract: The stress singularity degree associated to a V-notch has a great influence on the fatigue life of V-notched structure. The growth rate of the crack initiated at the tip of a V-notch depends on the stress singularity of the V-notch. The fatigue life accompanying with this small crack will represent a large amount of the total fatigue life. In this work, boundary element method (BEM) is used to study the propagation of the crack emanating from a V-notch tip under fatigue loading. A comparison of the fatigue life between the crack initiated from V-notch tip and a lateral crack is done by a crack propagation law until these two cracks have the same stress intensity factors (SIFs). The effect of initial crack length, notch opening angle and notch depth on the crack extension and propagation is analyzed. As an example of engineering application, the fatigue life of a welded joint is investigated by the present method. The influence of weld toe angle and initial crack length on the fatigue life of the welded structure is studied. Some suggestions are given as an attempt to improve the fatigue life of welded structures at the end.

  17. Assessment of SMAP soil moisture for global simulation of gross primary production

    Science.gov (United States)

    He, Liming; Chen, Jing M.; Liu, Jane; Bélair, Stéphane; Luo, Xiangzhong

    2017-07-01

    In this study, high-quality soil moisture data derived from the Soil Moisture Active Passive (SMAP) satellite measurements are evaluated from a perspective of improving the estimation of the global gross primary production (GPP) using a process-based ecosystem model, namely, the Boreal Ecosystem Productivity Simulator (BEPS). The SMAP soil moisture data are assimilated into BEPS using an ensemble Kalman filter. The correlation coefficient (r) between simulated GPP from the sunlit leaves and Sun-induced chlorophyll fluorescence (SIF) measured by Global Ozone Monitoring Experiment-2 is used as an indicator to evaluate the performance of the GPP simulation. Areas with SMAP data in low quality (i.e., forests), or with SIF in low magnitude (e.g., deserts), or both are excluded from the analysis. With the assimilated SMAP data, the r value is enhanced for Africa, Asia, and North America by 0.016, 0.013, and 0.013, respectively (p r appears in single-cropping agricultural land where the irrigation is not considered in the model but well captured by SMAP (e.g., 0.09 in North America, p < 0.05). With the assimilation of SMAP, areas with weak model performances are identified in double or triple cropping cropland (e.g., part of North China Plain) and/or mountainous area (e.g., Spain and Turkey). The correlation coefficient is enhanced by 0.01 in global average for shrub, grass, and cropland. This enhancement is small and insignificant because nonwater-stressed areas are included.

  18. Diagnóstico da fauna silvestre em empresas florestais brasileiras Diagnosis of wild fauna in brazilian forest companies

    Directory of Open Access Journals (Sweden)

    Giovanna Debortoli Medeiros

    2009-02-01

    Full Text Available Com o objetivo de conhecer a situação atual da fauna silvestre em empresas florestais brasileiras, foram pesquisadas 42 razões sociais, entre Associadas e Co-Participantes da Sociedade de Investigações Florestais (SIF, as quais possuem plantios florestais próprios. As informações foram obtidas com base em questionário enviado às referidas empresas, via correio eletrônico, sendo as respostas obtidas também por esse mecanismo. Entre os vários resultados, destaca-se o fato de que 90,9% das empresas associadas já realizaram levantamentos qualitativos da fauna silvestre. No entanto, de modo geral há notória carência de infra-estrutura nas empresas pesquisadas para atender a trabalhos específicos de manejo e conservação da fauna silvestre.Forty-two companies, associates and co-participants of the Forest Investigation Society (SIF and owners of private forest plantations, were assessed to determine the current situation of wild fauna in Brazilian forest companies. Information was obtained through a questionnaire sent to and received from the companies by e-mail. One of the several results obtained was that 90.9% of the associate companies had already carried out qualitative surveys on wild fauna stands.. On the other hand, in general, there is a total lack of infrastructure in the surveyed companies, to specifically assist in the management and conservation of wild fauna.

  19. Native Geosciences: Strengthening the Future Through Tribal Traditions

    Science.gov (United States)

    Bolman, J. R.; Quigley, I.; Douville, V.; Hollow Horn Bear, D.

    2008-12-01

    communities and a return to traditional ways of supporting the development of our "story" or purpose for being. The opportunities include residential summer field experiences, interdisciplinary curriculums and development of Tribally-driven Native research experiences. The National Science Foundation, University of North Dakota's Northern Great Plains Center for People and the Environment, Upper Midwest Aerospace Consortium (UMAC), and Tribes have provided funding to support the development of Native geosciences. The presentation will focus on current projects: NSF OEDG "He Sapa Bloketu Woecun; Geosciences at the Heart of Everything That Is", NSF S-STEM "Scientific Leadership Scholars" and the NSF BPC "Coalition of American Indians in Computing". The expressed goal of future initiatives is to connect Tribal communities across the Midwest and West in developing a Native Geosciences Pathway. This pathway supports the identification and support of Tribal students with an interest or "story" connected to geosciences ensuring a future Native geosciences workforce.

  20. Geologic mapping of Northern Atla Regio on Venus: Preliminary data

    Science.gov (United States)

    Nikishin, A. M.; Burba, G. A.

    1993-01-01

    The Northern part of Atla Regio within the frame of C1-formate Magellan photo map 15N197 was mapped geologically at scale 1:8,000,000. This is a part of Russia's contribution into C1 geologic mapping efforts. The map is reproduced here being reduced about twice. The map shows that the Northern Atla area is predominantly a volcanic plain with numerous volcanic features: shield volcanoes, domes and hills with various morphology, corona-like constructions, radar bright and dark spots often with flow-like outlines. Relatively small areas of tessera occurred in the area are mainly semi-flooded with the plain material. Tesserae are considered to be the oldest terrains within the map sheet. There are many lineated terrains in the region. They are interpreted as the old, almost-buried tesserae (those with crossed lineaments) or partly buried ridge belts (those with parallel lineaments). These lineated terrains have an intermediate age between the young volcanic plains and the old tessera areas. Two prominent high volcanic shields are located within the region - Ozza Mons and Sapas Mona. The most prominent structure in Northern Atla is Ganis Chasma rift. The rift cuts volcanic plain and is considered to be under formation during approximately the same time with Ozza Mons shield. Ganis Chasma rift valley is highly fractured and bounded with fault scarps. Rift shoulder uplifts are typical for Ganis Chasma. There are few relatively young volcanic features inside the rift valley. The analysis of fracturing and rift valley geometry shows the rift originated due to 5-10 percent crustal extention followed by the crustal subsidence. The age sequence summary for the main terrain types in the region is (from older to younger ones): tesserae; lineated terrains with crossed lineaments; lineated terrains with parallel lineaments; volcanic plains; and prominent volcanic shields and Ganis Chasma rift valley. The geologic structure of Atla Regio as it appeared now with the Magellan high

  1. South Dakota NASA Space Grant Consortium Creating Bridges in Indian Country

    Science.gov (United States)

    Bolman, J. R.

    2004-12-01

    The South Dakota Space Grant Consortium (SDSGC) was established March 1, 1991 by a NASA Capability Enhancement Grant. Since that time SDSGC has worked to provide earth and space science educational outreach to all students across South Dakota. South Dakota has nine tribes and five tribal colleges. This has presented a tremendous opportunity to develop sustainable equitable partnerships and collaborations. SDSGC believes strongly in developing programs and activities that highlight the balance of indigenous science and ways of knowing with current findings in contemporary science. This blending of science and culture creates a learning community where individuals, especially students, can gain confidence and pride in their unique skills and abilities. Universities are also witnessing the accomplishments and achievements of students who are able to experience a tribal college environment and then carry that experience to a college/university/workplace and significantly increase the learning achievement of all. The presentation will highlight current Tribal College partnerships with Sinte Gleska University and Oglala Lakota College amongst others. Programs and activities to be explained during the presentation include: Native Connections, Scientific Knowledge for Indian Learning and Leadership (SKILL), Bridges to Success Summer Research Program, Fire Ecology Summer Experience, and dual enrolled/college bridge programs. The presentation will also cover the current initiatives underway through NASA Workforce Development. These include: partnering program with the Annual He Sapa Wacipi, American Indian Space Days 2005, NASA research/internship programs and NASA Fellow Summit. An overview of recent American Indian student success will conclude the presentation. The South Dakota School of Mines and Technology has struggled over many years to develop and implement sustainable successful initiatives with Tribal Colleges and Communities. The motivating philosophy is the

  2. Mental health morbidity among people subject to immigration detention in the UK: a feasibility study.

    Science.gov (United States)

    Sen, P; Arugnanaseelan, J; Connell, E; Katona, C; Khan, A A; Moran, P; Robjant, K; Slade, K; Tan, J; Widyaratna, K; Youd, J; Forrester, A

    2017-06-22

    The UK has one of the largest systems of immigration detention in Europe.. Those detained include asylum-seekers and foreign national prisoners, groups with a higher prevalence of mental health vulnerabilities compared with the general population. In light of little published research on the mental health status of detainees in immigration removal centres (IRCs), the primary aim of this study was to explore whether it was feasible to conduct psychiatric research in such a setting. A secondary aim was to compare the mental health of those seeking asylum with the rest of the detainees. Cross-sectional study with simple random sampling followed by opportunistic sampling. Exclusion criteria included inadequate knowledge of English and European Union nationality. Six validated tools were used to screen for mental health disorders including developmental disorders like Personality Disorder, Attention Deficit Hyperactivity Disorder (ADHD), Autistic Spectrum Disorder (ASD) and Intellectual Disability, as well as for needs assessment. These were the MINI v6, SAPAS, AQ-10, ASRS, LDSQ and CANFOR. Demographic data were obtained using a participant demographic sheet. Researchers were trained in the use of the screening battery and inter-rater reliability assessed by joint ratings. A total of 101 subjects were interviewed. Overall response rate was 39%. The most prevalent screened mental disorder was depression (52.5%), followed by personality disorder (34.7%) and post-traumatic stress disorder (20.8%). 21.8% were at moderate to high suicidal risk. 14.9 and 13.9% screened positive for ASD and ADHD, respectively. The greatest unmet needs were in the areas of intimate relationships (76.2%), psychological distress (72.3%) and sexual expression (71.3%). Overall presence of mental disorder was comparable with levels found in prisons. The numbers in each group were too small to carry out any further analysis. It is feasible to undertake a psychiatric morbidity survey in an IRC

  3. Validation of the dual-table autoradiographic method to quantify two sequential rCBFs in a single SPET session with N-isopropyl-[123I]p-iodoamphetamine

    International Nuclear Information System (INIS)

    Nishizawa, Sadahiko; Iida, Hidehiro; Tsuchida, Tatsuro; Ito, Harumi; Konishi, Junji; Yonekura, Yoshiharu

    2003-01-01

    We evaluated an autoradiographic (ARG) method to calculate regional cerebral blood flow (rCBF) sequentially before and after an acetazolamide (ACZ) challenge in a single session of single-photon emission tomography (SPET) with two injections of N-isopropyl-[ 123 I]p-iodoamphetamine (IMP). The method uses a table look-up method with a fixed distribution volume (Vd) and a standard input function of IMP. To calculate rCBF after an ACZ challenge, two look-up tables (a dual-table) are used to reflect the effect of radioactivity in the brain from the first dose of IMP. We performed simulation studies to evaluate errors attributable to (a) a change in rCBF induced by an ACZ challenge during the scan and (b) a fixed Vd value that might be different from an individual one, along with the effect of (c) scan length. Thirty-three patients were studied by dynamic SPET with two injections of IMP and frequent arterial blood sampling, and the data were analysed using the dual-table ARG method. Twenty-four of the 33 patients received an injection of ACZ 10 min before the second dose of IMP. We generated a standard input function by averaging individual input functions. The optimal method to calibrate a standard input function was determined so that the SD of differences between rCBF calculated by using a calibrated standard input function (F SIF ) and that calculated by using an individual input function (F IIF ) was minimised. Reliability of the method was evaluated by comparing F SIF with gold standard rCBF (F REF ) obtained by two-compartment model analysis of dynamic SPET data and an individual input function with a non-linear least squares fitting method. Errors caused by (a) were less than 4% for a first rCBF ranging between 20 and 60 ml 100 g -1 min -1 and an rCBF change of between -25% and 50%. Errors caused by (b) were relatively large compared with those caused by (a), and were affected by (c) with an increasing error in a longer scan. In the patient study with a proposed

  4. Green Tea Leaves Extract: Microencapsulation, Physicochemical and Storage Stability Study

    Directory of Open Access Journals (Sweden)

    James A. Zokti

    2016-07-01

    Full Text Available Green tea polyphenols have been reported to possess many biological properties. Despite the many potential benefits of green tea extracts, their sensitivity to high temperature, pH and oxygen is a major disadvantage hindering their effective utilization in the food industry. Green tea leaves from the Cameron Highlands Malaysia were extracted using supercritical fluid extraction (SFE. To improve the stability, green tea extracts were encapsulated by spray-drying using different carrier materials including maltodextrin (MD, gum arabic (GA and chitosan (CTS and their combinations at different ratios. Encapsulation efficiency, total phenolic content and antioxidant capacity were determined and were found to be in the range of 71.41%–88.04%, 19.32–24.90 (g GAE/100 g, and 29.52%–38.05% respectively. Further analysis of moisture content, water activity, hygroscopicity, bulk density and mean particles size distribution of the microparticles were carried out and the results ranged from; 2.31%–5.11%, 0.28–0.36, 3.22%–4.71%, 0.22–0.28 g/cm3 and 40.43–225.64 µm respectively. The ability of the microparticles to swell in simulated gastric fluid (SGF and simulated intestinal fluid (SIF was determined as 142.00%–188.63% and 207.55%–231.77%, respectively. Release of catechin polyphenol from microparticles in SIF was higher comparable to that of SGF. Storage stability of encapsulated catechin extracts under different temperature conditions was remarkably improved compared to non-encapsulated extract powder. This study showed that total catechin, total phenolic content (TPC and antioxidant activity did not decrease significantly (p ≥ 0.05 under 4 °C storage conditions. The half-life study results were in the range of 35–60, 34–65 and 231–288 weeks at storage temperatures of 40 °C, 25 °C and 4 °C respectively, therefore, for improved shelf-life stability we recommend that microparticles should be stored at temperatures below 25 °C.

  5. Short-term regulation and alternative pathways of photosynthetic electron transport in Hibiscus rosa-sinensis leaves.

    Science.gov (United States)

    Trubitsin, Boris V; Vershubskii, Alexey V; Priklonskii, Vladimir I; Tikhonov, Alexander N

    2015-11-01

    In this work, using the EPR and PAM-fluorometry methods, we have studied induction events of photosynthetic electron transport in Hibiscus rosa-sinensis leaves. The methods used are complementary, providing efficient tools for in situ monitoring of P700 redox transients and photochemical activity of photosystem II (PSII). The induction of P700(+) in dark-adapted leaves is characterized by the multiphase kinetics with a lag-phase, which duration elongates with the dark-adaptation time. Analyzing effects of the uncoupler monensin and artificial electron carrier methylviologen (MV) on photooxidation of P700 and slow induction of chlorophyll a fluorescence (SIF), we could ascribe different phases of transient kinetics of electron transport processes in dark-adapted leaves to the following regulatory mechanisms: (i) acceleration of electron transfer on the acceptor side of PSI, (ii) pH-dependent modulation of the intersystem electron flow, and (iii) re-distribution of electron fluxes between alternative (linear, cyclic, and pseudocyclic) pathways. Monensin significantly decreases a level of P700(+) and inhibits SIF. MV, which mediates electron flow from PSI to O2 with consequent formation of H2O2, promotes a rapid photooxidation of P700 without any lag-phase peculiar to untreated leaves. MV-mediated water-water cycle (H2O→PSII→PSI→MV→O2→H2O2→H2O) is accompanied by generation of ascorbate free radicals. This suggests that the ascorbate peroxidase system of defense against reactive oxygen species is active in chloroplasts of H. rosa-sinensis leaves. In DCMU-treated chloroplasts with inhibited PSII, the contribution of cyclic electron flow is insignificant as compared to linear electron flow. For analysis of induction events, we have simulated electron transport processes within the framework of our generalized mathematical model of oxygenic photosynthesis, which takes into account pH-dependent mechanisms of electron transport control and re-distribution of

  6. Reconstruction of cica-contracture on the face and neck with skin flap and expanded skin flap pedicled by anterior branch of transverse cervical artery.

    Science.gov (United States)

    Chen, Baoguo; Song, Huifeng; Xu, Minghuo; Gao, Quanwen

    2016-09-01

    A high-quality flap is necessary for repairing faciocervical scar contractures. The supraclavicular region and chest wall are the preferred choices for reconstruction. The supraclavicular island flap (SIF) pedicled by the transverse cervical artery (TCA) has been reported. Compared to the traditional SIF flap, another type of flap pedicled by the anterior perforator of transverse cervical artery (ap-TCA) is more convenient for transfer to the faciocervical area. In this article, we use this type of perforator flap and expanded perforator flap to repair the faciocervical contracture. In this study, 10 cases (deformity caused by burn or trauma to the face and neck sites) with an average age of 32 years-old, were treated by ap-TCA flap and this type of expanded flap. In between, the flap was pre-expanded for approximately 3 months prior to transfer in 6 patients. Another 4 cases did not want the expander because of the long duration required for saline filling and potential complications of the expander. Bilateral prefabricated flaps were designed in two female cases. All 12 flaps in 10 patients were transferred tension-free to the defects and no flap was lost. The size of the flap ranged from 12 cm × 8 cm to 15 cm × 20 cm. All 12 flaps survived completely. The donor sites were closed directly in the above 6 patients where an expander had been used and reconstructed by split skin graft in 4 patients where no expander had been employed. Through a mean time of 6 months' follow-up, only one female patient was disappointed with the cicatrix that presented on the upper polar skin of both breasts, the other 9 patients were satisfied with both recipient function and appearance. The color and the texture matched well with the recipient area. The ap-TCA flap and expanded ap-TCA flap can be considered reliable options for faciocervical deformities as it can be easily elevated and it matches well with faciocervical area in color. With regards to the expanded flap, we

  7. Coupled FEM-DBEM method to assess crack growth in magnet system of Wendelstein 7-X

    Directory of Open Access Journals (Sweden)

    R. Citarella

    2013-10-01

    Full Text Available The fivefold symmetric modular stellarator Wendelstein 7-X (W7-X is currently under construction in Greifswald, Germany. The superconducting coils of the magnet system are bolted onto a central support ring and interconnected with five so-called lateral support elements (LSEs per half module. After welding of the LSE hollow boxes to the coil cases, cracks were found in the vicinity of the welds that could potentially limit the allowed number N of electromagnetic (EM load cycles of the machine. In response to the appearance of first cracks during assembly, the Stress Intensity Factors (SIFs were calculated and corresponding crack growth rates of theoretical semi-circular cracks of measured sizes in potentially critical position and orientation were predicted using Paris’ law, whose parameters were calibrated in fatigue tests at cryogenic temperature. In this paper the Dual Boundary Element Method (DBEM is applied in a coupled FEM-DBEM approach to analyze the propagation of multiple cracks with different shapes. For this purpose, the crack path is assessed with the Minimum Strain Energy density criterion and SIFs are calculated by the J-integral approach. The Finite Element Method (FEM is adopted to model, using the commercial codes Ansys or Abaqus;, the overall component whereas the submodel analysis, in the volume surrounding the cracked area, is performed by FEM (“FEM-FEM approach” or alternatively by DBEM (“FEM-DBEM approach”. The “FEM-FEM approach” considers a FEM submodel, that is extracted from the FEM global model; the latter provide the boundary conditions for the submodel. Such approach is affected by some restrictions in the crack propagation phase, whereas, with the “FEM-DBEM approach”, the crack propagation simulation is straightforward. In this case the submodel is created in a DBEM environment with boundary conditions provided by the global FEM analysis; then the crack is introduced and a crack propagation analysis

  8. Scanning electron microscopy of damage caused by Mesocyclops thermocyclopoides (Copepoda: Cyclopoidea on larvae of the Dengue fever vector Aedes aegypti (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Stefan Schaper

    2006-09-01

    Full Text Available Dengue fever is a mosquito-borne viral disease, whose main biological vector is Aedes aegypti. This mosquito colonizes tropical areas where the disease is endemic. The most obvious action against dengue is attacking its vector. Biological control appears to be an alternative approach, using natural enemies of the mosquitoes, such as predatory copepods. Thus, the morphological study of the damage caused by copepods is important to understand its predatory capacity. Twenty-five A. aegypti larvae were exposed to the copepod Mesocyclops thermocyclopoides and the damage caused by the copepods was evaluated using scanning electron microscopy. The larvae showed damage mainly at the anal segment, the siphon and the abdomen; only three attacks to the head were observed. The size of the siphon might be of importance in determining whether or not a copepod will attack a mosquito larva. Rev. Biol. Trop. 54 (3: 843-846. Epub 2006 Sept. 29.El dengue es una enfermedad viral transmitida por mosquitos, cuyo principal vector es Aedes aegypti. Este mosquito coloniza muchas áreas tropicales donde la enfermedad es endémica. La acción más obvia contra el dengue es el ataque a su vector. El control biológico parece una buena alternativa, empleando enemigos naturales de los mosquitos, como los copépodos. Por lo tanto, es importante el estudio morfológico del daño causado por los copépodos para comprender su capacidad depredadora. Veinticinco larvas de A. aegypti fueron expuestas a la actividad depredadora del copépodo Mesocyclops thermocyclopoides. Mediante microscopia electrónica de rastreo se evaluó el daño causado por los copépodos. Éstos atacaron principalmente el segmento anal, el sifón y el abdomen de las larvas; sólo vimos tres ataques a la cabeza. El tamaño del sifón podría ser de importancia para predecir si los copépodos pudiesen atacar larvas de determinado mosquito.

  9. Detection methods for atoms and radicals in the gas phase

    Science.gov (United States)

    Hack, W.

    This report lists atoms and free radicals in the gas phase which are of interest for environmental and flame chemistry and have been detected directly. The detection methods which have been used are discussed with respect to their range of application, specificity and sensitivity. In table 1, detection methods for the five atoms of group IV (C, Si, Ge, Sn, Pb) and about 60 radicals containing at least one atom of group IV are summarized (CH, Cd, Cf, CC1, CBr, Cn, Cs, CSe, CH2, CD2, Chf, Cdf, CHC1, CHBr, CF2, CC12, CBr2, CFC1, CFBr, CH3, CD3, CF3, CH2F, CH2C1, CH2Br, CHF2, CHC12, CHBr2, Hco, Fco, CH30, CD30, CH2OH, CH3S, Nco, CH4N, CH302, CF302; C2, C2N, C2H, C20, C2HO, C2H3, C2F3, C2H5, C2HsO, C2H4OH, CH3CO, CD3CO, C2H3O, C2H502, CH3COO2, C2H4N, C2H6N, C3; Si, SiF, SiF2, SiO, SiC, Si2; Ge, GeC, GeO, GeF, GeF2, GeCl2, Sn, SnF, SnO, SnF2, Pb, PbF, PbF2, PbO, PbS). In table 2 detection methods for about 25 other atoms and 60 radicals are listed: (H, D, O, O2, Oh, Od, HO2, DO2, F, Ci, Br, I, Fo, Cio, BrO, Io, FO2, C1O2, Li, Na, K, Rb, Cs, N, N3, Nh, Nd, Nf, Nci, NBr, NH2, ND2, Nhd, Nhf, NF2, NC12, N2H3, No, NO2, NO3, Hno, Dno, P, Ph, Pd, Pf, Pci, PH2, PD2, PF2, Po, As, AsO, AsS, Sb, Bi, S, S2, Sh, Sd, Sf, SF2, So, Hso, Dso, Sn, Se, Te, Se2, SeH, SeD, SeF, SeO, SeS, SeN, TeH, TeO, Bh, BH2, Bo, Bn, B02, Cd, Hg, UF5). The tables also cite some recent kinetic applications of the various methods.

  10. A QuaternaryPoly(ethylene carbonate)-Lithium Bis(trifluoromethanesulfonyl)imide-Ionic Liquid-Silica Fiber Composite Polymer Electrolyte for Lithium Batteries

    International Nuclear Information System (INIS)

    Kimura, Kento; Matsumoto, Hidetoshi; Hassoun, Jusef; Panero, Stefania; Scrosati, Bruno; Tominaga, Yoichi

    2015-01-01

    Highlights: • A quaternary PEC-LiTFSI-Pyr 14 TFSI-Silica fiber electrolyte was prepared by a solvent casting method. • Both electrochemical and mechanical properties were improved by the presence of the Silica fiber. • The electrolyte showed a t Li+ value of 0.36 with an anodic stability extended up to 4.5 V vs. Li/Li + . • A prototype Li/LiFePO 4 polymer cell delivered a discharge capacity of about 100 mAh g −1 (75 °C, C/15). - Abstract: Poly(ethylene carbonate) (PEC) is known as an alternating copolymer derived from carbon dioxide (CO 2 ) and an epoxide as monomers. Here, we describe a new quaternary PEC-based composite electrolyte containing lithium bis(trifluoromethanesulfonyl) imide (LiTFSI) salt, N-n-butyl-N-methylpyrrolidinium bis(trifluoromethanesulfonyl) imide (Pyr 14 TFSI) ionic liquid, and an electrospun silica (SiO 2 ) fiber (SiF) with a submicron diameter in view of its possible applications in solid-state Li polymer batteries. A free-standing electrolyte membrane is prepared by a solvent casting method. The Pyr 14 TFSI ionic liquid enhances the ionic conductivity of the electrolyte as a result of its plasticizing effect. The electrochemical properties, such as ionic conductivity and Li transference number (t Li+ ), as well as mechanical strength of the electrolyte, are further improved by the SiF. We show that the quaternary electrolyte has a conductivity of the order of 10 −7 S cm −1 at ambient temperature and a high t Li+ value of 0.36 with an excellent flexibility. A prototype Li polymer cell using LiFePO 4 as a cathode material is assembled and tested. We demonstrate that this battery delivers a reversible charge-discharge capacity close to 100 mAh g −1 at 75 °C and C/15 rate. We believe that this work may pave the road to utilize CO 2 as a carbon source for highly-demanded, functional battery materials in future

  11. The provision of non-needle/syringe drug injecting paraphernalia in the primary prevention of HCV among IDU: a systematic review

    Directory of Open Access Journals (Sweden)

    Ahmed Syed

    2010-11-01

    Full Text Available Abstract Background Sharing drug injecting paraphernalia other than needles and syringes (N/S has been implicated in the transmission of Hepatitis C virus (HCV among injecting drug users (IDU. We aimed to determine whether the provision of sterile non-N/S injecting paraphernalia reduces injecting risk behaviours or HCV transmission among IDU. Methods A systematic search of seven databases and the grey literature for articles published January 1989-February 2010 was undertaken. Thirteen studies (twelve observational and one non-randomized uncontrolled pilot intervention were identified and appraised for study design and quality by two investigators. Results No studies examined the association between the provision of non-N/S injecting paraphernalia and incident HCV infection. One cross-sectional study found that individuals who frequently, compared to those who infrequently, used sterile cookers and water, were less likely to report prevalent HCV infection. Another found no association between the uptake of sterile non-N/S injecting paraphernalia and self-reported sharing of this paraphernalia. The remaining observational studies used attendance at needle and syringe exchange programmes (NSP or safer injection facilities (SIF that provided non-N/S injecting paraphernalia as a proxy measure. Eight studies presented adjusted odds ratios, ranging from 0.3 to 0.9, suggesting a reduced likelihood of self-reported sharing of non-N/S injecting paraphernalia associated with use of NSP or SIF. There was substantial uncertainty associated with these estimates however. Three unadjusted studies reported a reduction in the prevalence of sharing of non-N/S injecting paraphernalia over time among NSP users. Only one study reported an adjusted temporal trend in the prevalence of sharing non-N/S injecting paraphernalia, finding higher rates among non-NSP users than NSP users at each time point, and a greater reduction in sharing among non-NSP than NSP users over

  12. Distribution Integrity Management Plant (DIMP)

    Energy Technology Data Exchange (ETDEWEB)

    Gonzales, Jerome F. [Los Alamos National Laboratory

    2012-05-07

    This document is the distribution integrity management plan (Plan) for the Los Alamos National Laboratory (LANL) Natural Gas Distribution System. This Plan meets the requirements of 49 CFR Part 192, Subpart P Distribution Integrity Management Programs (DIMP) for the LANL Natural Gas Distribution System. This Plan was developed by reviewing records and interviewing LANL personnel. The records consist of the design, construction, operation and maintenance for the LANL Natural Gas Distribution System. The records system for the LANL Natural Gas Distribution System is limited, so the majority of information is based on the judgment of LANL employees; the maintenance crew, the Corrosion Specialist and the Utilities and Infrastructure (UI) Civil Team Leader. The records used in this report are: Pipeline and Hazardous Materials Safety Administration (PHMSA) 7100.1-1, Report of Main and Service Line Inspection, Natural Gas Leak Survey, Gas Leak Response Report, Gas Leak and Repair Report, and Pipe-to-Soil Recordings. The specific elements of knowledge of the infrastructure used to evaluate each threat and prioritize risks are listed in Sections 6 and 7, Threat Evaluation and Risk Prioritization respectively. This Plan addresses additional information needed and a method for gaining that data over time through normal activities. The processes used for the initial assessment of Threat Evaluation and Risk Prioritization are the methods found in the Simple, Handy Risk-based Integrity Management Plan (SHRIMP{trademark}) software package developed by the American Pipeline and Gas Agency (APGA) Security and Integrity Foundation (SIF). SHRIMP{trademark} uses an index model developed by the consultants and advisors of the SIF. Threat assessment is performed using questions developed by the Gas Piping Technology Company (GPTC) as modified and added to by the SHRIMP{trademark} advisors. This Plan is required to be reviewed every 5 years to be continually refined and improved. Records

  13. An innovative biocatalyst for production of ethanol from xylose in a continuous bioreactor.

    Science.gov (United States)

    Silva, C R; Zangirolami, T C; Rodrigues, J P; Matugi, K; Giordano, R C; Giordano, R L C

    2012-01-05

    The use of the hemicellulose fraction of biomass may be important for the feasibility of the production of second generation bioethanol. Wild strains of Saccharomyces cerevisiae are widely used in industry for production of 1st generation ethanol, and the robustness of this yeast is an important advantage in large scale applications. Isomerization of xylose to xylulose is an essential step in this process. This reaction is catalyzed by glucose isomerase (GI). A new biocatalyst is presented here for the simultaneous isomerization and fermentation (SIF) of xylose. GI from Streptomyces rubiginosus was immobilized in chitosan, through crosslinking with glutaraldehyde, and the support containing the immobilized GI (IGI-Ch) was co-immobilized with S. cerevisiae, in calcium alginate gel. The immobilization experiments led to high immobilized protein loads (30-68 mg × g(support)(-1)), high yields (circa of 100%) and high recovered enzyme activity (>90%). The IGI-Ch derivative with maximum activity presented 1700 IU × g(catalyst)(-1), almost twice the activity of a commercial immobilized GI, GENSWEET(®) IGI-HF. At typical operational conditions for xylose SIF operation (pH 5, 30-35 °C, presence of nutrients and ethanol concentrations in the medium up to 70 L(-1)), both derivatives, IGI-Ch and GENSWEET(®) IGI-HF retained app. 90% of the initial activity after 120 h, while soluble GI was almost completely inactive at pH 5, 30 °C. The isomerization xylose/xylulose, catalyzed by IGI-Ch, reached the equilibrium in batch experiments after 4h, with 12,000 IU × L(-1) (7 g(der) × L(-1)), at pH 5 and 30 °C, in the presence of fermentation nutrients. After co-immobilization of IGI-Ch with yeast in alginate gel, this biocatalyst succeeded in producing 12 g × L(-1) of ethanol, 9.5 g × L(-1) of xylitol, 2.5 g × L(-1) of glycerol and 1.9 g × L(-1) of acetate after consumption of 50 g × L(-1) of xylose, in 48 h, using 32.5 × 10(3) IU × L(-1) and 20 g(yeast) × L(-1), at 35

  14. Synthesis of nanocrystalline LaF3 doped silica glasses by hydrofluoric acid catalyzed sol–gel process

    International Nuclear Information System (INIS)

    Nagayama, Shuhei; Kajihara, Koichi; Kanamura, Kiyoshi

    2012-01-01

    Highlights: ► Silica glasses doped by LaF 3 nanocrystals are obtained by HF-catalyzed sol–gel method. ► The processing time (∼1 week) is much shorter than that of previous studies. ► The uptake of SiF groups in the glass matrix greatly reduces the SiOH concentration. ► Effects of sintering conditions and properties of Er 3+ -doped samples are presented. - Abstract: Silica glasses doped with LaF 3 nanocrystals were prepared by HF-catalyzed sol–gel method. HF was used both as fluorine source and as catalyst of the sol–gel reaction, making it possible to shorten the processing time with reducing the concentration of SiOH groups to ∼10 18 cm −3 . The resultant glasses are transparent at visible spectral range, and the optical loss at the ultraviolet absorption edge is dominated by the Rayleigh scattering from LaF 3 crystallites. The size of LaF 3 crystallites increases with an increase in the sintering temperature and time, and is smaller than ∼40 nm in samples showing good visible transparency. Green upconversion photoluminescence is observed in an Er 3+ -doped sample under excitation at 980 nm.

  15. Core/shell cellulose-based microspheres for oral administration of Ketoprofen Lysinate.

    Science.gov (United States)

    Guarino, Vincenzo; Caputo, Tania; Calcagnile, Paola; Altobelli, Rosaria; Demitri, Christian; Ambrosio, Luigi

    2018-01-26

    Herein, we propose the fabrication of a new carrier with core/shell structure-inner core of cellulose acetate (CA) coated by a micrometric layer of chitosan (CS)-fabricated through an integrated process, which combines Electro Dynamic Atomization (EDA) and layer-by-layer (LbL) technique. We demonstrate that CA based microspheres possess a unique capability to relevantly retain the drugs-that is, Ketoprofen Lysinate (KL)-along the gastric tract, while providing a massive release along the intestine. CS shell slightly influences the morphology and water retention under different pH conditions, improving drug encapsulation without compromising drug release kinetics. In vitro studies in simulated gastric and intestine fluids (SGF, SIF) with physiological enzymes, show a moderate release of LSK during the first 2 h (ca. 20% at pH 2), followed by a sustained release during the next 6 h (ca. 80% at pH 7). The obtained results demonstrate that CA-based microspheres hold strong potential to be used as carriers for a delayed oral administration of anti-inflammatory drugs. © 2018 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 2018. © 2018 Wiley Periodicals, Inc.

  16. Uptake of wheel-filtration among clients of a supervised injecting facility: Can structured education work?

    Science.gov (United States)

    Steele, Maureen; Silins, Edmund; Flaherty, Ian; Hiley, Sarah; van Breda, Nick; Jauncey, Marianne

    2018-01-01

    Wheel-filtration of pharmaceutical opioid tablets is a recognised harm reduction strategy, but uptake of the practice among people who inject drugs is low. The study aimed to: (i) examine perceptions of filtration practices; (ii) provide structured education on wheel-filtration; and (iii) assess uptake of the practice. Frequent opioid tablet injectors (n = 30) attending a supervised injecting facility in Sydney, Australia, received hands-on instruction on wheel-filtration based on recommended practice. Pre-education, post-education and follow-up questionnaires were administered. Wheel-filtration was generally regarded as better than cotton-filtration (the typical method) in terms of perceived effects on health, ease of use and overall drug effect. Sixty-eight percent of those who said they would try wheel-filtration after the education had actually done so. Of those who usually used cotton-filtration, over half (60%) had used wheel-filtration two weeks later. Uptake of safer preparation methods for pharmaceutical opioid tablets increases after structured education in wheel-filtration. Findings suggest that SIFs are an effective site for this kind of education. Supervised injecting facility workers are uniquely positioned to provide harm reduction education at the time of injection. [Steele M, Silins E, Flaherty I, Hiley S, van Breda N, Jauncey M. Uptake of wheel-filtration among clients of a supervised injecting facility: Can structured education work? Drug Alcohol Rev 2018;37:116-120]. © 2017 Australasian Professional Society on Alcohol and other Drugs.

  17. Evaluation of synthetic zeolites as oral delivery vehicle for anti-inflammatory drugs

    Directory of Open Access Journals (Sweden)

    Elham Khodaverdi

    2014-05-01

    Full Text Available Objective(s: In this research, zeolite X and zeolite Y were used as vehicle to prepare intestine targeted oral delivery systems of indomethacin and ibuprofen. Materials and Methods: A soaking procedure was implemented to encapsulate indomethacin or ibuprofen within synthetic zeolites. Gravimetric methods and IR spectra of prepared formulations were used to assess drug loading efficiencies into zeolite structures. Scanning Electron Microscopy (SEM was also utilized to determine morphologies changes in synthetic zeolites after drug loading. At the next stage, dissolution studies were used to predict the in vivo performance of prepared formulations at HCl 0.1 N and PBS pH 6.5 as simulated gastric fluid (SGF and simulated intestine fluid (SIF, respectively. Results: Drug loadings of prepared formulations was determined between 24-26 % w/w. Dissolution tests at SGF were shown that zeolites could retain acidic model drugs in their porous structures and can be able to limit their release into the stomach. On the other hand, all prepared formulations completely released model drugs during 3 hr in simulated intestine fluid. Conclusion: Obtained results indicated zeolites could potentially be able to release indomethacin and ibuprofen in a sustained and controlled manner and reduced adverse effects commonly accompanying oral administrations of NSAIDs.

  18. Integrity and stability of oral liposomes containing bile salts studied in simulated and ex vivo gastrointestinal media.

    Science.gov (United States)

    Hu, Shunwen; Niu, Mengmeng; Hu, Fuqiang; Lu, Yi; Qi, Jianping; Yin, Zongning; Wu, Wei

    2013-01-30

    The objective of this study was to investigate the integrtity and stability of oral liposomes containing glycocholate (SGC-Lip) in simulated gastrointestinal (GI) media and ex vivo GI media from rats in comparison with conventional liposomes (CH-Lip) composed of soybean phosphatidylcholine and cholesterol. Membrane integrity of liposomes was evaluated by monitoring calcein release, particle size and distribution in different simulated GI media. The stability of liposomes encapsulating insulin was investigated in simulated GI fluids containing pepsin or pancreatin and ex vivo GI enzyme fluids. Simulated GI media with low pH or physiological bile salts resulted in significant increase in calcein release, but dynamic laser scattering data showed that the size and distribution were generally stable. SGC-Lip retained the major amount of the initially encapsulated insulin as compared with CH-Lip in simulated GI fluids (SGF, FaSSGF, SIF and FeSSIF-V2). SGC-Lip retained respectively 17.1% and 20.5% of the initially encapsulated insulin in ex vivo GI fluid, which were also significantly more than CH-Lip. These results suggested that SGC-Lip could protect insulin from degradation to some degree during their transit through the gastrointestinal tract and contributed to enhanced oral absorption. Copyright © 2012 Elsevier B.V. All rights reserved.

  19. Small Crack Growth and Fatigue Life Predictions for High-Strength Aluminium Alloys. Part 1; Experimental and Fracture Mechanics Analysis

    Science.gov (United States)

    Wu, X. R.; Newman, J. C.; Zhao, W.; Swain, M. H.; Ding, C. F.; Phillips, E. P.

    1998-01-01

    The small crack effect was investigated in two high-strength aluminium alloys: 7075-T6 bare and LC9cs clad alloy. Both experimental and analytical investigations were conducted to study crack initiation and growth of small cracks. In the experimental program, fatigue tests, small crack and large crack tests A,ere conducted under constant amplitude and Mini-TWIST spectrum loading conditions. A pronounced small crack effect was observed in both materials, especially for the negative stress ratios. For all loading conditions, most of the fatigue life of the SENT specimens was shown to be crack propagation from initial material defects or from the cladding layer. In the analysis program, three-dimensional finite element and A weight function methods were used to determine stress intensity factors and to develop SIF equations for surface and corner cracks at the notch in the SENT specimens. A plastisity-induced crack-closure model was used to correlate small and large crack data, and to make fatigue life predictions, Predicted crack-growth rates and fatigue lives agreed well with experiments. A total fatigue life prediction method for the aluminum alloys was developed and demonstrated using the crack-closure model.

  20. Green's functions for stress-intensity-factors for through cracks emanating from holes

    International Nuclear Information System (INIS)

    Bhandari, S.; Dubeaux, P.

    1981-01-01

    We conducted a parametric study of cracks at various elliptical openings in plates. We used five values of ellipticity and ten values of crack lengths at the edge of these holes. The computer program used is based on the Boundary Integral Equation method which requires only the contour of the structure to be segmented. The results concerning the stress distribution in the uncracked structure were verified for the cases where analytical results were available. Moreover the values of the S.I.F. for certain cases were checked through the use of some of the methods available in the literature. The final aim of this parametric study is to come up with simple Green's functions for cracks at holes. This has been possible through: (a) The use of the stress distribution in the uncracked structure (b) The Green's function for a crack in an infinite medium and (c) The principles underlying the Schwarz alternating technique used in the potential theory to resolve problems of finite regions. Finally the procedure is applied to treat a practical case of cracks as fastner holes. (orig.)

  1. On Ensemble Nonlinear Kalman Filtering with Symmetric Analysis Ensembles

    KAUST Repository

    Luo, Xiaodong; Hoteit, Ibrahim; Moroz, Irene M.

    2010-01-01

    However, by adopting the Monte Carlo method, the EnSRF also incurs certain sampling errors. One way to alleviate this problem is to introduce certain symmetry to the ensembles, which can reduce the sampling errors and spurious modes in evaluation of the means and covariances of the ensembles [7]. In this contribution, we present two methods to produce symmetric ensembles. One is based on the unscented transform [8, 9], which leads to the unscented Kalman filter (UKF) [8, 9] and its variant, the ensemble unscented Kalman filter (EnUKF) [7]. The other is based on Stirling’s interpolation formula (SIF), which results in the divided difference filter (DDF) [10]. Here we propose a simplified divided difference filter (sDDF) in the context of ensemble filtering. The similarity and difference between the sDDF and the EnUKF will be discussed. Numerical experiments will also be conducted to investigate the performance of the sDDF and the EnUKF, and compare them to a well‐established EnSRF, the ensemble transform Kalman filter (ETKF) [2].

  2. Synthesis and characterization of Al2O3 and SiO2 films with fluoropolymer content using rf-plasma magnetron sputtering technique

    International Nuclear Information System (INIS)

    Islam, Mohammad; Inal, Osman T.

    2008-01-01

    Pure and molecularly mixed inorganic films for protection against atomic oxygen in lower earth orbit were prepared using radio-frequency (rf) plasma magnetron sputtering technique. Alumina (Al 2 O 3 ) and silica (SiO 2 ) films with average grain size in the range of 30-80 nm and fully dense or dense columnar structure were synthesized under different conditions of pressure and power. Simultaneous oxide sputtering and plasma polymerization (PP) of hexafluoropropylene (HFP) led to the formation of molecularly mixed films with fluoropolymer content. The degree of plasma polymerization was strongly influenced by total chamber pressure and the argon to HFP molar ratio (n Ar /n M ). An order of magnitude increase in pressure due to argon during codeposition changed the plasma-polymerization mechanism from radical-chain- to radical-radical-type processes. Subsequently, a shift from linear CH 2 group based chain polymerization to highly disordered fluoropolymer content with branching and cross-linking was observed. Fourier transform infrared spectroscopy studies revealed chemical interaction between depositing SiO 2 and PP-HFP through appearance of absorption bands characteristic of Si-F stretching and expansion of SiO 2 network. The relative amount and composition of plasma-polymerized fluoropolymer in such films can be controlled by changing argon to HFP flow ratio, total chamber pressure, and applied power. These films offer great potential for use as protective coatings in aerospace applications

  3. Improvement of Stability and Antioxidant Activities by Using Phycocyanin - Chitosan Encapsulation Technique

    Science.gov (United States)

    Suzery, Meiny; Hadiyanto; Majid, Dian; Setyawan, Deny; Sutanto, Heri

    2017-02-01

    Encapsulation is a coating process to improve the stability of bioactive compounds. Phycocyanin with high antioxidant activity has been encapsulated with chitosan in microcapsules form. In this study aims to determine the best conditions in the encapsulation process using the extrusion method, characterization of the physicochemical properties of the microcapsules, antioxidant activity test using DPPH, in vitro release performance and evaluate the storage stability against temperature. The results of the encapsulation process is obtained: Na-TPP is better than Na-citrate as crosslinker and chitosan content 3% as a coating with ratio of chitosan to phycocyanin ratio 1: 1. Test of antioxidant activity also showed encapsulation with chitosan content 3% has the highest antioxidant activity. Morphological analysis microcapsules were found to have compact spherical shape with diameter range 900-1000 µm. In vitro release testing showed a quick release in an acidic environment (SGF) for 2 hours and slowly release under alkaline conditions (SIF) for 8 hours under mechanical stirring at 37°C. Phycocyanin much more stable against temperature during storage in microcapsules.

  4. Fasciola hepatica IN BOVINES IN BRAZIL: DATA AVAILABILITY AND SPATIAL DISTRIBUTION

    Directory of Open Access Journals (Sweden)

    Sita C. Bennema

    2014-01-01

    Full Text Available Fasciolosis is a disease of importance for both veterinary and public health. For the first time, georeferenced prevalence data of Fasciola hepatica in bovines were collected and mapped for the Brazilian territory and data availability was discussed. Bovine fasciolosis in Brazil is monitored on a Federal, State and Municipal level, and to improve monitoring it is essential to combine the data collected on these three levels into one dataset. Data were collected for 1032 municipalities where livers were condemned by the Federal Inspection Service (MAPA/SIF because of the presence of F. hepatica. The information was distributed over 11 states: Espírito Santo, Goiás, Minas Gerais, Mato Grosso do Sul, Mato Grosso, Pará, Paraná, Rio de Janeiro, Rio Grande do Sul, Santa Catarina and São Paulo. The highest prevalence of fasciolosis was observed in the southern states, with disease clusters along the coast of Paraná and Santa Catarina and in Rio Grande do Sul. Also, temporal variation of the prevalence was observed. The observed prevalence and the kriged prevalence maps presented in this paper can assist both animal and human health workers in estimating the risk of infection in their state or municipality.

  5. Curcumin-Artemisinin Coamorphous Solid: Xenograft Model Preclinical Study

    Directory of Open Access Journals (Sweden)

    M. K. Chaitanya Mannava

    2018-01-01

    Full Text Available Curcumin is a natural compound present in Indian spice turmeric. It has diverse pharmacological action but low oral solubility and bioavailability continue to limit its use as a drug. With the aim of improving the bioavailability of Curcumin (CUR, we evaluated Curcumin-Pyrogallol (CUR-PYR cocrystal and Curcumin-Artemisinin (CUR-ART coamorphous solid. Both of these solid forms exhibited superior dissolution and pharmacokinetic behavior compared to pure CUR, which is practically insoluble in water. CUR-ART coamorphous solid showed two fold higher bioavailability than CUR-PYR cocrystal (at 200 mg/kg oral dose. Moreover, in simulated gastric and intestinal fluids (SGF and SIF, CUR-ART is stable up to 3 and 12 h, respectively. In addition, CUR-PYR and CUR-ART showed no adverse effects in toxicology studies (10 times higher dose at 2000 mg/kg. CUR-ART showed higher therapeutic effect and inhibited approximately 62% of tumor growth at 100 mg/kg oral dosage of CUR in xenograft models, which is equal to the positive control drug, doxorubicin (2 mg/kg by i.v. administration.

  6. Étude de l’influence des couches de non-tissés intermédiaires dans la réversibilité du doublage thermoplastique au Plextol B500®

    Directory of Open Access Journals (Sweden)

    Virginie Le Poizat

    2012-06-01

    Full Text Available Les choix concernant les matériaux et la mise en œuvre d’un doublage du support original d’une peinture par un textile et des adhésifs synthétiques sont souvent pris de manière empirique par les restaurateurs, sans être précédés de tests précis. La réversibilité, qui est un principe de déontologie primordial est encore imprécise pour ce type de doublage. Nous avons étudié par des expérimentations comment celle-ci peut être déterminée par le choix des couches intermédiaires.Choices about materials and the elaboration of synthetic linings are often made by the conservator, without any precise experimentation. Reversibility is an important deontological principal, not well-known concerning synthetic lining. We studied thanks to experimentations, how it can be influenced by the choice of the intermediate layers.

  7. Activity of encapsulated Lactobacillus bulgaricus in alginate-whey protein microspheres

    Directory of Open Access Journals (Sweden)

    Meng-Yan Chen

    2014-10-01

    Full Text Available In this work, alginate-whey protein was used as wall materials for encapsulating Lactobacillus delbrueckii subsp. bulgaricus (L. bulgaricus. The characteristics of encapsulated and free L. bulgaricus showed that the free L. bulgaricus lost viability after 1 min exposure to simulated gastric fluid (SGF at pH 2.0 and 2.5. However, the viability of encapsulated L. bulgaricus did not decrease in SGF at pH 2.5 for 2 h incubation. The viable numbers of encapsulated L. bulgaricus decreased less than 1.0 log unit for 2 h incubation in SGF at pH 2.0. For bile stability, only 1.2 log units and 2.0 log units viability of the encapsulated L. bulgaricus was lost in 1 and 2% bile for 1 h exposure, respectively, compared with no survival of free L. bulgaricus under the same conditions. Encapsulated L. bulgaricus was completely released from the microspheres in simulated intestinal fluid (SIF, pH 6.8 in 3 h. The viability of the encapsulated L. bulgaricus retained more 8.0 log CFU/g after stored at 4°C for four weeks. However, for free L. bulgaricus, only around 3.0 log CFU/mL was found at the same storage conditions. Results showed that the encapsulation could improve the stability of L. bulgaricus.

  8. Structure of Na2O·MO·SiO2·CaF2 (M=Mg, Ca) oxyfluoride glasses

    International Nuclear Information System (INIS)

    Cheng Jinshu; Deng Wei; Wang Mitang

    2012-01-01

    (9-x)CaO·xMgO·15Na 2 O·60SiO 2 ·16CaF 2 (x=0, 2, 4, 6, and 9) oxyfluoride glasses were prepared. Utilizing the Raman scattering technique together with 29 Si and 19 F MAS NMR, the effect of alkaline metal oxides on the Q species of glass was characterized. Raman results show that as magnesia is added at the expense of calcium oxide, the disproportional reaction Q 3 →Q 4 +Q 2 (Q n is a SiO 4 tetrahedron with n bridging oxygens) prompted due to the high ionic field strength of magnesia, magnesium oxide entered into the silicate network as tetrahedral MgO 4 , and removed other modifying ions for charge compensation. This reaction was confirmed by 29 Si MAS NMR. 19 F MAS NMR results show that fluorine exists in the form of mixed calcium sodium fluoride species in all glasses and no Si-F bonds were formed. As CaO is gradually replaced by MgO (x=6, 9), a proportion of the magnesium ions combines with fluorine to form the MgF + species. Meanwhile, some part of Na + ions complex F - in the form of F-Na(6).

  9. Possible evidence for spin-transfer torque induced by spin-triplet supercurrent

    KAUST Repository

    Li, Lailai

    2017-10-04

    Cooper pairs in superconductors are normally spin singlet. Nevertheless, recent studies suggest that spin-triplet Cooper pairs can be created at carefully engineered superconductor-ferromagnet interfaces. If Cooper pairs are spin-polarized they would transport not only charge but also a net spin component, but without dissipation, and therefore minimize the heating effects associated with spintronic devices. Although it is now established that triplet supercurrents exist, their most interesting property - spin - is only inferred indirectly from transport measurements. In conventional spintronics, it is well known that spin currents generate spin-transfer torques that alter magnetization dynamics and switch magnetic moments. The observation of similar effects due to spin-triplet supercurrents would not only confirm the net spin of triplet pairs but also pave the way for applications of superconducting spintronics. Here, we present a possible evidence for spin-transfer torques induced by triplet supercurrents in superconductor/ferromagnet/superconductor (S/F/S) Josephson junctions. Below the superconducting transition temperature T_c, the ferromagnetic resonance (FMR) field at X-band (~ 9.0 GHz) shifts rapidly to a lower field with decreasing temperature due to the spin-transfer torques induced by triplet supercurrents. In contrast, this phenomenon is absent in ferromagnet/superconductor (F/S) bilayers and superconductor/insulator/ferromagnet/superconductor (S/I/F/S) multilayers where no supercurrents pass through the ferromagnetic layer. These experimental observations are discussed with theoretical predictions for ferromagnetic Josephson junctions with precessing magnetization.

  10. Formation and Characterization of Silver Nanoparticle Composite with Poly(p-Br/F-phenylsilane).

    Science.gov (United States)

    Roh, Sung-Hee; Noh, Ji Eun; Woo, Hee-Gweon; Cho, Myong-Shik; Sohn, Honglae

    2015-02-01

    The one-pot production and structural characterization of composites of silver nanoparticles with poly(p-Br/F-phenylsilane), Br/F-PPS, have been performed. The conversion of Ag+ ions to stable Ag0 nanoparticles is mediated by the copolymer Br/F-PPS having both possibly reactive Si-H bonds in the polymer backbone and C-Br bonds in the substituents along with relatively inert C-F bonds. Transmission electron microscopy and field emission scanning electron microscopy analyses show the formation of the composites where silver nanoparticles (less than 30 nm of size) are well dispersed over the Br/F-PPS matrix. X-ray diffraction patterns are consistent with that for face-centered-cubic typed silver. The polymer solubility in toluene implys that the cleavage of C-Br bond and the Si-F dative bonding may not be occurred appreciably at ambient temperature. Nonetheless, thermogravimetric analysis data suggest that some sort of cross-linking could take place at high temperature. Most of the silver particles undergo macroscopic aggregation without Br/F-PPS, which indicates that the polysilane is necessary for stabilizing the silver nanoparticles.

  11. Taste masking of ciprofloxacin by ion-exchange resin and sustain release at gastric-intestinal through interpenetrating polymer network

    Directory of Open Access Journals (Sweden)

    A. Michael Rajesh

    2015-07-01

    Full Text Available The aim of the study was to taste mask ciprofloxacin (CP by using ion-exchange resins (IERs followed by sustain release of CP by forming interpenetrating polymer network (IPN. IERs based on the copolymerization of acrylic acid with different cross linking agents were synthesised. Drug-resin complexes (DRCs with three different ratios of drug to IERs (1:1, 1:2, 1:4 were prepared & evaluated for taste masking by following in vivo and in vitro methods. Human volunteers graded ADC 1:4, acrylic acid-divinyl benzene (ADC-3 resin as tasteless. Characterization studies such as FTIR, SEM, DSC, P-XRD differentiated ADC 1:4, from physical mixture (PM 1:4 and confirmed the formation of complex. In vitro drug release of ADC 1:4 showed complete release of CP within 60 min at simulated gastric fluid (SGF i.e. pH 1.2. IPN beads were prepared with ADC 1:4 by using sodium alginate (AL and sodium alginate-chitosan (AL-CS for sustain release of CP at SGF pH and followed by simulated intestinal fluid (SIF i.e. pH 7.4. FTIR spectra confirmed the formation of IPN beads. The release of CP was sustain at SGF pH (75%. The kinetic model of IPN beads showed the release of CP was non-Fickian diffusion type.

  12. Capacity Fade and Its Mitigation in Li-Ion Cells with Silicon-Graphite Electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Bareño, Javier [Chemical; Shkrob, Ilya A. [Chemical; Gilbert, James A. [Chemical; Klett, Matilda [Chemical; Abraham, Daniel P. [Chemical

    2017-09-15

    In this study we scrutinize the causes for capacity fade in lithium-ion cells containing silicongraphite (Si-Gr) blends in the negative electrode and examine approaches for minimizing this fade. The causal mechanisms are inferred from data obtained by electrochemistry, microscopy, spectroscopy and thermogravimetry techniques. The presence of SiOxFy signals in the Si-Gr electrode, LixPOyFz compounds in the electrolyte, and SiO2 species on the NCM523 positive electrode, highlight the crucial role of hydrolytically generated HF, which accelerates the degradation of Si particles. The hydrolysis could result from residual moisture in the current electrode fabrication process, which uses aqueous binders. Water can also be released when silanol groups on the Si nanoparticles react with HF to form Si-F compounds. We note that the primary cause of capacity fade in the full cells is the loss of solid electrolyte interphase (SEI) integrity resulting from volume changes in Si particles during electrochemical cycling. Adding fluoroethylene carbonate (FEC) to the conventional electrolyte slows capacity fade through the formation of a cross linked polymer with elastomeric properties. Further gains in cell longevity are possible by excluding water during electrode fabrication, using hydrolytically stable lithium salts, and adopting electrolyte systems that provide more elasticity to the SEI layers.

  13. Atomic-scale study of the adsorption of calcium fluoride on Si(100) at low-coverage regime

    International Nuclear Information System (INIS)

    Chiaravalloti, Franco; Dujardin, Gerald; Riedel, Damien; Pinto, Henry P.; Foster, Adam S.

    2011-01-01

    We investigate, experimentally and theoretically, the initial stage of the formation of Ca/Si and Si/F structures that occurs during the adsorption of CaF 2 molecules onto a bare Si(100) surface heated to 1000 K in a low-coverage regime (0.3 monolayer). A low-temperature (5 K) scanning tunneling microscope (STM) is used to observe the topographies and the electronic properties of the exposed silicon surfaces. Our atomic-scale study reveals that several chemical reactions arise during CaF 2 deposition, such as dissociation of the CaF 2 molecules and etching of the surface silicon dimers. The experimental and calculated STM topographies are compared using the density functional theory, and this comparison enables us to identify two types of reacted structures on the Si(100) surface. The first type of observed complex surface structure consists of large islands formed with a semiperiodic sequence of 3 x 2 unit cells. The second one is made of isolated Ca adatoms adsorbed at specific sites on the Si(100)-2 x 1 surface.

  14. IgG binding of mugwort pollen allergens and allergoids exposed to simulated gastrointestinal conditions measured by a self-developed ELISA test

    Directory of Open Access Journals (Sweden)

    RATKO M. JANKOV

    2004-07-01

    Full Text Available This study considers the influence of exposure to simulated gastrointestinal conditions (saliva, gut, intestine and acidic conditions of the gut on IgG binding of unmodified allergens and three types of LMW allergoids of Artemisia vulgaris pollen extract obtained by means of potassium cyanate, succinic and maleic anhydride. It also concerns the optimization of a self-developed ELISA assay for comparison of the specific IgG binding of mugwort pollen extract and modified mugwort pollen derivatives. The ELISA was conducted with a mugwort pollen extract coupled to the plate, using the sera from 12 mugwort-pollen allergic patients. The exposure to saliva fluid for 2 min did not influence the IgG binding properties of allergens and allergoids. Exposure of mugwort pollen allergens and LMW allergoids to the acidic conditions of the gut did not dramatically change their IgG binding properties. By exposing mugwort pollen extract and LMW derivatives to the SGF conditions for 1 h, the percent of IgG binding epitopes was reduced to a half of its starting value in the extract and to about 30 % in all the allergoid samples. After prolonged exposure only the carbamyl derivative showed reduced IgG binding. Changes of the IgG binding potential of all four samples after exposure in SIF followed a similar pattern.

  15. Acid digestion of geological and environmental samples using open-vessel focused microwave digestion.

    Science.gov (United States)

    Taylor, Vivien F; Toms, Andrew; Longerich, Henry P

    2002-01-01

    The application of open vessel focused microwave acid digestion is described for the preparation of geological and environmental samples for analysis using inductively coupled plasma-mass spectrometry (ICP-MS). The method is compared to conventional closed-vessel high pressure methods which are limited in the use of HF to break down silicates. Open-vessel acid digestion more conveniently enables the use of HF to remove Si from geological and plant samples as volatile SiF4, as well as evaporation-to-dryness and sequential acid addition during the procedure. Rock reference materials (G-2 granite, MRG-1 gabbros, SY-2 syenite, JA-1 andesite, and JB-2 and SRM-688 basalts) and plant reference materials (BCR and IAEA lichens, peach leaves, apple leaves, Durham wheat flour, and pine needles) were digested with results comparable to conventional hotplate digestion. The microwave digestion method gave poor results for granitic samples containing refractory minerals, however fusion was the preferred method of preparation for these samples. Sample preparation time was reduced from several days, using conventional hotplate digestion method, to one hour per sample using our microwave method.

  16. Self-Passivation by Fluorine Plasma Treatment and Low-Temperature Annealing in SiGe Nano wires for Biochemical Sensors

    International Nuclear Information System (INIS)

    Chang, K.; Chen, C.; Kuo, P.; Chen, Y.; Chang, T.; Lai, C.; Whang, A. J.; Lai, Y.; Chen, H.; Hsieh, I.

    2014-01-01

    Nano wires are widely used as highly sensitive sensors for electrical detection of biological and chemical species. Modifying the band structure of strained-Si metal-oxide-semiconductor field-effect transistors by applying the in-plane tensile strain reportedly improves electron and hole mobility. The oxidation-induced Ge condensation increases the Ge fraction in a SiGe-on-insulator (SGOI) and substantially increases hole mobility. However, oxidation increases the number of surface states, resulting in hole mobility degradation. In this work, 3-aminopropyltrimethoxysilane (APTMS) was used as a biochemical reagent. The hydroxyl molecule on the oxide surface was replaced by the methoxy groups of the APTMS molecule. We proposed a surface plasma treatment to improve the electrical properties of SiGe nano wires. Fluorine plasma treatment can result in enhanced rates of thermal oxidation and speed up the formation of a self-passivation oxide layer. Like a capping oxide layer, the self-passivation oxide layer reduces the rate of follow-up oxidation. Pre oxidation treatment also improved the sensitivity of SiGe nano wires because the Si-F binding was held at a more stable interface state compared to bare nano wire on the SiGe surface. Additionally, the sensitivity can be further improved by either the N 2 plasma posttreatment or the low-temperature post annealing due to the suppression of out diffusion of Ge and F atoms from the SiGe nano wire surface.

  17. Stochastic modeling of thermal fatigue crack growth

    CERN Document Server

    Radu, Vasile

    2015-01-01

    The book describes a systematic stochastic modeling approach for assessing thermal-fatigue crack-growth in mixing tees, based on the power spectral density of temperature fluctuation at the inner pipe surface. It shows the development of a frequency-temperature response function in the framework of single-input, single-output (SISO) methodology from random noise/signal theory under sinusoidal input. The frequency response of stress intensity factor (SIF) is obtained by a polynomial fitting procedure of thermal stress profiles at various instants of time. The method, which takes into account the variability of material properties, and has been implemented in a real-world application, estimates the probabilities of failure by considering a limit state function and Monte Carlo analysis, which are based on the proposed stochastic model. Written in a comprehensive and accessible style, this book presents a new and effective method for assessing thermal fatigue crack, and it is intended as a concise and practice-or...

  18. Synthesis, characterization and pharmacological evaluation of amide prodrugs of Flurbiprofen

    International Nuclear Information System (INIS)

    Mishra, Ashutosh; Veerasamy, Ravichandran; Jain, Prateek Kumar; Dixit, Vinod Kumar; Agrawal, Ram Kishor

    2008-01-01

    Flurbiprofen (FB) suffers from the general side effects of NSAIDs, owing to presence of free carboxylic acid group. The study was aimed to retard the adverse effects of gastrointestinal origin. Ten prodrugs of FB were synthesized by amidation with ethyl esters of amino acids, namely, glycine, L-phenylalanine, L-tryptophan, L-valine, L-isoleucine, L-alanine, L-leucine, L-glutamic acid, L-aspartic acid and β alanine. Purified synthesized prodrugs were characterized by m.p., TLC, solubility, partition coefficients, elemental analyses, UV, FTIR, NMR and MS. Synthesized prodrugs were subjected for bioavailability studies, analgesic, anti-inflammatory activities and ulcerogenic index. Marked reduction of ulcerogenic index and comparable analgesic, antiinflammatory activities were obtained in all cases as compared to FB. Among synthesized prodrugs AR-9, AR-10 and AR-2 showing excellent pharmacological response and encouraging hydrolysis rate both in (Simulated Intestinal Fluid) SIF and in 80% human plasma. Prodrugs with increased aliphatic side chain length or introduction of aromatic substituent resulted in enhanced partition coefficient but diminished dissolution and hydrolysis rate. Such prodrugs can be considered for sustained release purpose. (author)

  19. Synthesis, characterization and pharmacological evaluation of amide prodrugs of Flurbiprofen

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, Ashutosh; Veerasamy, Ravichandran; Jain, Prateek Kumar; Dixit, Vinod Kumar; Agrawal, Ram Kishor [Dr. H. S. Gour Vishwavidyalaya, Sagar (India). Dept. of Pharmaceutical Sciences. Pharmaceutical Chemistry Research Lab.]. E-mail: dragrawal2001@yahoo.co.in

    2008-07-01

    Flurbiprofen (FB) suffers from the general side effects of NSAIDs, owing to presence of free carboxylic acid group. The study was aimed to retard the adverse effects of gastrointestinal origin. Ten prodrugs of FB were synthesized by amidation with ethyl esters of amino acids, namely, glycine, L-phenylalanine, L-tryptophan, L-valine, L-isoleucine, L-alanine, L-leucine, L-glutamic acid, L-aspartic acid and {beta} alanine. Purified synthesized prodrugs were characterized by m.p., TLC, solubility, partition coefficients, elemental analyses, UV, FTIR, NMR and MS. Synthesized prodrugs were subjected for bioavailability studies, analgesic, anti-inflammatory activities and ulcerogenic index. Marked reduction of ulcerogenic index and comparable analgesic, antiinflammatory activities were obtained in all cases as compared to FB. Among synthesized prodrugs AR-9, AR-10 and AR-2 showing excellent pharmacological response and encouraging hydrolysis rate both in (Simulated Intestinal Fluid) SIF and in 80% human plasma. Prodrugs with increased aliphatic side chain length or introduction of aromatic substituent resulted in enhanced partition coefficient but diminished dissolution and hydrolysis rate. Such prodrugs can be considered for sustained release purpose. (author)

  20. Effect of non-cross-linked calcium on characteristics, swelling behaviour, drug release and mucoadhesiveness of calcium alginate beads.

    Science.gov (United States)

    Dalaty, Adnan Al; Karam, Ayman; Najlah, Mohammad; Alany, Raid G; Khoder, Mouhamad

    2016-04-20

    In this study, ibuprofen-loaded calcium alginate beads (CABs) with varying amounts of non-cross-linked calcium (NCL-Ca) were prepared using different washing methods. The influence of NCL-Ca on beads properties was investigated. Increasing the number or duration of washes led to significant decreases in the amount of NCL-Ca whereas the impact of the volume of washes was not significant. Approximately 70% of the initial amount of Ca(2+) was NCL-Ca which was removable by washing while only 30% was cross-linked (CL-Ca). Ca(2+) release from the CABs was bimodal; NCL-Ca was burst-released followed by a slower release of CL-Ca. Washing methods and the amount of NCL-Ca had significant influences on the encapsulation efficiency, beads weight, beads swelling, drug release profile and the mucoadhesiveness of CABs. This study highlighted the importance of washing methods and the amount of NCL-Ca to establish CABs properties and understand their behaviour in the simulated intestinal fluids (SIFs). Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Native plant species suitable as bioindicators and biomonitors for airborne fluoride

    International Nuclear Information System (INIS)

    Weinstein, Leonard H.; Davison, Alan W.

    2003-01-01

    The strengths and limitations of techniques for biomonitoring and bioindicating fluorides are reviewed. - For 30-40 years airborne fluoride, usually in the form of HF or SiF 4 , was one of the most important and damaging air pollutants affecting forests, crops and natural vegetation. It is much more toxic than most other air pollutants such as O 3 or SO 2 because injury to the most sensitive species begins when they are exposed to a concentration below 1 ppb (ca. 0.8 μg m -3 ) for a 1- to 3-day period. The long-term threshold concentration is around 0.25-0.30 μg m -3 . Higher concentrations and longer durations of exposure induce much more rapid and extensive injury. However, there is a difference in sensitivity between the most and least sensitive species of around 2-3 orders of magnitude and most species possess a degree of resistance. Dramatic improvements in engineering technology have greatly reduced emissions but because of the high toxicity, cases of vegetation injury are still common, even in developed countries, and cases involving litigation still occur. Therefore there is a continuing need for bioindicators and biomonitoring of fluorides, so this paper reviews the subject, drawing attention to the strengths and limitations of the techniques. Visible symptoms are described and illustrated and tables of relative sensitivity are given and their limitations discussed. Finally, examples of biomonitoring in Europe and the USA are presented

  2. The Photoluminescent Properties of New Cationic Iridium(III Complexes Using Different Anions and Their Applications in White Light-Emitting Diodes

    Directory of Open Access Journals (Sweden)

    Hui Yang

    2015-09-01

    Full Text Available Three cationic iridium(III complexes [Ir(ppy2(phen][PF6] (C1, [Ir(ppy2(phen]2SiF6 (C2 and [Ir(ppy2(phen]2TiF6 (C3 (ppy: 2-phenylpyridine, phen: 1, 10-phenanthroline using different anions were synthesized and characterized by 1H Nuclear magnetic resonance (1HNMR, mass spectra (MS, Fourier transform infrared (FTIR spectra and element analysis (EA. After the ultraviolet visible (UV-vis absorption spectra, photoluminescent (PL properties and thermal properties of the complexes were investigated, complex C1 and C3 with good optical properties and high thermal stability were used in white light-emitting diodes (WLEDs as luminescence conversion materials by incorporation with 460 nm-emitting blue GaN chips. The integrative performances of the WLEDs fabricated with complex C1 and C3 are better than those fabricated with the widely used yellow phosphor Y3Al5O12:Ce3+ (YAG. The color rendering indexes of the WLEDs with C1 and C3 are 82.0 and 82.6, the color temperatures of them are 5912 K and 3717 K, and the maximum power efficiencies of them are 10.61 Lm·W−1 and 11.41 Lm·W−1, respectively.

  3. Evaluation of Pentafluoroethane and 1,1-Difluoroethane for a Dielectric Etch Application in an Inductively Coupled Plasma Etch Tool

    Science.gov (United States)

    Karecki, Simon; Chatterjee, Ritwik; Pruette, Laura; Reif, Rafael; Sparks, Terry; Beu, Laurie; Vartanian, Victor

    2000-07-01

    In this work, a combination of two hydrofluorocarbon compounds, pentafluoroethane (FC-125, C2HF5) and 1,1-difluoroethane (FC-152a, CF2H-CH3), was evaluated as a potential replacement for perfluorocompounds in dielectric etch applications. A high aspect ratio oxide via etch was used as the test vehicle for this study, which was conducted in a commercial inductively coupled high density plasma etch tool. Both process and emissions data were collected and compared to those provided by a process utilizing a standard perfluorinated etch chemistry (C2F6). Global warming (CF4, C2F6, CHF3) and hygroscopic gas (HF, SiF4) emissions were characterized using Fourier transform infrared (FTIR) spectroscopy. FC-125/FC-152a was found to produce significant reductions in global warming emissions, on the order of 68 to 76% relative to the reference process. Although etch stopping, caused by a high degree of polymer deposition inside the etched features, was observed, process data otherwise appeared promising for an initial study, with good resist selectivity and etch rates being achieved.

  4. New Mononuclear Cu(II Complexes and 1D Chains with 4-Amino-4H-1,2,4-triazole

    Directory of Open Access Journals (Sweden)

    Marinela M. Dîrtu

    2013-12-01

    Full Text Available The crystal structures of two mononuclear Cu(II NH2trz complexes [Cu(NH2trz4(H2O](AsF62 (I and [Cu(NH2trz4(H2O](PF62 (II as well as two coordination polymers [Cu(μ2-NH2trz2Cl]Cl∙H2O (III and [Cu(μ2-NH2trz2Cl] (SiF60.5∙1.5H2O (IV are presented. Cationic 1D chains with bridging bis-monodentate μ2-coordinated NH2trz and bridging μ2-coordinated chloride ligands are present in III and IV. In these coordination polymers, the Cu(II ions are strongly antiferromagnetically coupled with J = −128.4 cm−1 for III and J = −143 cm−1 for IV (H = −JΣSiSi+1, due to the nature of the bridges between spin centers. Inter-chain interactions present in the crystal structures were taken into consideration, as well as g factors, which were determined experimentally, for the quantitative modeling of their magnetic properties.

  5. Controlled drug release from bifunctionalized mesoporous silica

    Science.gov (United States)

    Xu, Wujun; Gao, Qiang; Xu, Yao; Wu, Dong; Sun, Yuhan; Shen, Wanling; Deng, Feng

    2008-10-01

    Serial of trimethylsilyl-carboxyl bifunctionalized SBA-15 (TMS/COOH/SBA-15) have been studied as carriers for controlled release of drug famotidine (Famo). To load Famo with large capacity, SBA-15 with high content of carboxyl groups was successfully synthesized by one-pot synthesis under the assistance of KCl. The mesostructure of carboxyl functionalized SBA-15 (COOH/SBA-15) could still be kept even though the content of carboxyl groups was up to 57.2%. Increasing carboxyl content could effectively enhance the loading capacity of Famo. Compared with pure SBA-15, into which Famo could be hardly adsorbed, the largest drug loading capacity of COOH/SBA-15 could achieve 396.9 mg/g. The release of Famo from mesoporous silica was studied in simulated intestine fluid (SIF, pH=7.4). For COOH/SBA-15, the release rate of Famo decreased with narrowing pore size. After grafting TMS groups on the surface of COOH/SBA-15 with hexamethyldisilazane, the release of Famo was greatly delayed with the increasing content of TMS groups.

  6. Multilayered piezomagnetic/piezoelectric composites with periodic interfacial cracks subject to in-plane loading

    International Nuclear Information System (INIS)

    Tian, Wenxiang; Zhong, Zheng; Li, Yaochen

    2016-01-01

    A two-dimensional fracture problem of periodically distributed interfacial cracks in multilayered piezomagnetic/piezoelectric composites is studied under in-plane magnetic or electric loading. The magnetic permittivity of the piezoelectric material and the dielectric constant of the piezomagnetic material are considered. A system of singular integral equations of the second kind with a Cauchy kernel is obtained by means of Fourier transform and further solved by using Jacobi polynomials. The problem is solved in the real domain by constructing real fundamental solutions. The primary interfacial fracture mechanic parameters, such as the stress intensity factors (SIFs), the electric displacement intensity factors (EDIFs), the magnetic induction intensity factors (MIIFs) and the energy release rates (ERRs) are then obtained. It is found that a magnetic or electric loading normal to the crack surfaces can lead to a mixture of mode I and mode II type stress singularities at the crack tips. Numerical results show that increasing the thickness of the active layer will favor the crack initiation. Inversely, increasing the thickness of the passive layer will retard the crack initiation. Furthermore, the results indicate that the crack initiation can be inhibited by adjusting the direction of the applied magnetic or electric loading. (paper)

  7. Sample pretreatment for the determination of metal impurities in silicon wafer

    International Nuclear Information System (INIS)

    Chung, H. Y.; Kim, Y. H.; Yoo, H. D.; Lee, S. H.

    1999-01-01

    The analytical results obtained by microwave digestion and acid digestion methods for sample pretreatment to determine metal impurities in silicon wafer by inductively coupled plasma--mass spectrometry(ICP-MS) were compared. In order to decompose the silicon wafer, a mixed solution of HNO 3 and HF was added to the sample and the metal elements were determined after removing the silicon matrix by evaporating silicon in the form of Si-F. The recovery percentages of Ni, Cr and Fe were found to be 95∼106% for both microwave digestion and acid digestion methods. The recovery percentage of Cu obtained by the acid digestion method was higher than that obtained by the microwave digestion method. For Zn, however, the microwave digestion method gave better result than the acid digestion method. Fe was added to a silicon wafer using a spin coater. The concentration of Fe in this sample was determined by ICP-MS, and the same results were obtained in the two pretreatment methods

  8. Morphology and dynamics of aurora at fine scale: first results from the ASK instrument

    Directory of Open Access Journals (Sweden)

    H. Dahlgren

    2008-05-01

    Full Text Available The ASK instrument (Auroral Structure and Kinetics is a narrow field auroral imager, providing simultaneous images of aurora in three different spectral bands at multiple frames per second resolution. The three emission species studied are O2+ (5620 Å, O+ (7319 Å and O (7774 Å. ASK was installed and operated for the first time in an observational campaign on Svalbard, from December 2005 to March 2006. The measurements were supported by data from the Spectrographic Imaging Facility (SIF. The relation between the morphology and dynamics of the visible aurora and its spectral characteristics is studied for selected events from this period. In these events it is found that dynamic aurora is coupled to high energy electron precipitation. By studying the O2+/O intensity ratio we find that some auroral filaments are caused by higher energy precipitation within regions of lower energy precipitation, whereas other filaments are the result of a higher particle flux compared to the surroundings.

  9. Recon2Neo4j: applying graph database technologies for managing comprehensive genome-scale networks.

    Science.gov (United States)

    Balaur, Irina; Mazein, Alexander; Saqi, Mansoor; Lysenko, Artem; Rawlings, Christopher J; Auffray, Charles

    2017-04-01

    The goal of this work is to offer a computational framework for exploring data from the Recon2 human metabolic reconstruction model. Advanced user access features have been developed using the Neo4j graph database technology and this paper describes key features such as efficient management of the network data, examples of the network querying for addressing particular tasks, and how query results are converted back to the Systems Biology Markup Language (SBML) standard format. The Neo4j-based metabolic framework facilitates exploration of highly connected and comprehensive human metabolic data and identification of metabolic subnetworks of interest. A Java-based parser component has been developed to convert query results (available in the JSON format) into SBML and SIF formats in order to facilitate further results exploration, enhancement or network sharing. The Neo4j-based metabolic framework is freely available from: https://diseaseknowledgebase.etriks.org/metabolic/browser/ . The java code files developed for this work are available from the following url: https://github.com/ibalaur/MetabolicFramework . ibalaur@eisbm.org. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.

  10. Spectrophotometric determination of trace and ultratrace levels of boron in silicon and chlorosilane samples

    International Nuclear Information System (INIS)

    Chen, J.S.; Lin, H.M.; Yang, M.H.

    1991-01-01

    Spectrophotometric methods for the determination of boron in the low μg/g and ng/g range in high-purity silicon and dichloro- and trichlorosilanes were investigated in detail. The procedures established involve dissolution of silicon samples and the hydrolyzed products of chlorosilane samples in hydrofluoric acid-containing reagents followed by evaporation of the silicon matrix as H 2 SiF 6 . The boron retained in the treated sample solution was then determined by a spectrophotometric method using carminic acid as a chromatic reagent. Special effort has been paid to the control of the analytical blank and reproducible determination of boron. The results indicate that addition of mannitol and proper control of the evaporation process are effective in preventing volatilization of boron during the evaporation of silicon matrix and can thus attain high recovery of boron and reproducible analysis. Through meticulous control of the analytical blank and experimental conditions, the limit of detection for boron determination with the established method can be as low as ng/g levels. Application of the methods to the determination of boron in various stages of purification of silicon and trichlorosilane as well as in borophosphosilicate film was conducted. (orig.)

  11. Wrinkling in the deflation of elastic bubbles

    KAUST Repository

    Aumaitre, Elodie

    2013-03-01

    The protein hydrophobin HFBII self-assembles into very elastic films at the surface of water; these films wrinkle readily upon compression. We demonstrate and study this wrinkling instability in the context of non-planar interfaces by forming HFBII layers at the surface of bubbles whose interfaces are then compressed by deflation of the bubble. By varying the initial concentration of the hydrophobin solutions, we are able to show that buckling occurs at a critical packing fraction of protein molecules on the surface. Independent experiments show that at this packing fraction the interface has a finite positive surface tension, and not zero surface tension as is usually assumed at buckling. We attribute this non-zero wrinkling tension to the finite elasticity of these interfaces. We develop a simple geometrical model for the evolution of the wrinkle length with further deflation and show that wrinkles grow rapidly near the needle (used for deflation) towards the mid-plane of the bubble. This geometrical model yields predictions for the length of wrinkles in good agreement with experiments independently of the rheological properties of the adsorbed layer. © 2013 EDP Sciences, SIF, Springer-Verlag Berlin Heidelberg.

  12. Nonlinear detection for a high rate extended binary phase shift keying system.

    Science.gov (United States)

    Chen, Xian-Qing; Wu, Le-Nan

    2013-03-28

    The algorithm and the results of a nonlinear detector using a machine learning technique called support vector machine (SVM) on an efficient modulation system with high data rate and low energy consumption is presented in this paper. Simulation results showed that the performance achieved by the SVM detector is comparable to that of a conventional threshold decision (TD) detector. The two detectors detect the received signals together with the special impacting filter (SIF) that can improve the energy utilization efficiency. However, unlike the TD detector, the SVM detector concentrates not only on reducing the BER of the detector, but also on providing accurate posterior probability estimates (PPEs), which can be used as soft-inputs of the LDPC decoder. The complexity of this detector is considered in this paper by using four features and simplifying the decision function. In addition, a bandwidth efficient transmission is analyzed with both SVM and TD detector. The SVM detector is more robust to sampling rate than TD detector. We find that the SVM is suitable for extended binary phase shift keying (EBPSK) signal detection and can provide accurate posterior probability for LDPC decoding.

  13. Nonlinear Detection for a High Rate Extended Binary Phase Shift Keying System

    Directory of Open Access Journals (Sweden)

    Le-Nan Wu

    2013-03-01

    Full Text Available The algorithm and the results of a nonlinear detector using a machine learning technique called support vector machine (SVM on an efficient modulation system with high data rate and low energy consumption is presented in this paper. Simulation results showed that the performance achieved by the SVM detector is comparable to that of a conventional threshold decision (TD detector. The two detectors detect the received signals together with the special impacting filter (SIF that can improve the energy utilization efficiency. However, unlike the TD detector, the SVM detector concentrates not only on reducing the BER of the detector, but also on providing accurate posterior probability estimates (PPEs, which can be used as soft-inputs of the LDPC decoder. The complexity of this detector is considered in this paper by using four features and simplifying the decision function. In addition, a bandwidth efficient transmission is analyzed with both SVM and TD detector. The SVM detector is more robust to sampling rate than TD detector. We find that the SVM is suitable for extended binary phase shift keying (EBPSK signal detection and can provide accurate posterior probability for LDPC decoding.

  14. Investigation of Mixed-Type Craters and the Role of Bifluoride Additives to Produce Zirconia-Toughened Alumina-Based PEO Coating

    Science.gov (United States)

    Ur Rehman, Zeeshan; Shin, Seong Hun; Ahmad, Tanveer; Koo, Bon Heun

    2018-05-01

    Al2O3-ZrO2 composite ceramic coatings were prepared on Al6061 aluminum alloy by plasma electrolytic oxidation in Na3PO4-K2ZrF6-Na2SiF6-based alkaline electrolyte. Optimum processing time for the coating formation was found to be 50 min. Cross section and surface morphology of the coatings were analyzed using scanning electron microscope. From the phase and elemental composition analysis, the presence of m-ZrO2 and t-ZrO2 phases was confirmed. It was further observed that the peak intensities of t-ZrO2 and α-Al2O3 phases increased with processing time, which was attributed to the enhanced crystallinity caused by the efficient sintering conditions. Corrosion properties were investigated by potentiodynamic polarization test in 3.5 wt.% NaCl solution. The results showed high improvement in corrosion rate with minimum recorded value 0.25 mmy (mm/year) and corrosion current 0.15 × 10-6 A/cm2.

  15. Exploring stakeholder perceptions of acceptability and feasibility of needle exchange programmes, syringe vending machines and safer injection facilities in Tijuana, Mexico.

    Science.gov (United States)

    Philbin, Morgan M; Mantsios, Andrea; Lozada, Remedios; Case, Patricia; Pollini, Robin A; Alvelais, Jorge; Latkin, Carl A; Magis-Rodriguez, Carlos; Strathdee, Steffanie A

    2009-07-01

    Injection drug use is a growing public health crisis along the U.S.-Mexican border and rising rates of blood-borne infections highlight the pressing need for harm reduction interventions. We explored the acceptability and feasibility of such interventions in Tijuana, a city adjacent to San Diego, California. Using in-depth qualitative interviews conducted from August 2006-March 2007 with 40 key stakeholders - pharmacists, legal professionals, health officials, religious officials, drug treatment providers, and law enforcement personnel - we explored the acceptability and feasibility of interventions to reduce drug-related harm in Tijuana, Mexico. Interviews were taped with consent, transcribed verbatim, and translated. Content analysis was conducted to identify themes which included barriers, structural limitations, and suggestions for implementation. Topics included acceptance and feasibility of needle exchange programmes (NEPs), syringe vending machines, and safer injection facilities (SIFs), structural barriers and suggestions for implementation. Of these interventions, NEPs were deemed the most acceptable (75%); however, only half believed these could be feasibly implemented, citing barriers involving religion, police, and lack of political will, public awareness, and funding. Increasing HIV infection rates among injection drug users in Tijuana have prompted interest in public health responses. Our results may assist policy strategists in implementing social-structural interventions that will help create enabling environments that facilitate the scale-up and implementation of harm reduction in Tijuana.

  16. Effect of Fluorine Diffusion on Amorphous-InGaZnO-Based Thin-Film Transistors.

    Science.gov (United States)

    Jiang, Jingxin; Furuta, Mamoru

    2018-08-01

    This study investigated the effect of fluorine (F) diffusion from a fluorinated siliconnitride passivation layer (SiNX:F-Pa) into amorphous-InGaZnO-based thin-film transistors (a-IGZO TFTs). The results of thermal desorption spectroscopy and secondary ion mass spectrometry revealed that F was introduced into the SiOX etch-stopper layer (SiOX-ES) during the deposition of a SiNX:F-Pa, and did not originate from desorption of Si-F bonds; and that long annealing times enhanced F diffusion from the SiOX-ES layer to the a-IGZO channel. Improvements to the performance and threshold-voltage (Vth) negative shift of IGZO TFTs were achieved when annealing time increased from 1 h to 3 h; and capacitance-voltage results indicated that F acted as a shallow donor near the source side in a-IGZO and induced the negative Vth shift. In addition, it was found that when IGZO TFTs with SiNX:F-Pa were annealed 4 h, a low-resistance region was formed at the backchannel of the TFT, leading to a drastic negative Vth shift.

  17. Defects in silicon carbide grown by fluorinated chemical vapor deposition chemistry

    Science.gov (United States)

    Stenberg, Pontus; Booker, Ian D.; Karhu, Robin; Pedersen, Henrik; Janzén, Erik; Ivanov, Ivan G.

    2018-04-01

    Point defects in n- and p-type 4H-SiC grown by fluorinated chemical vapor deposition (CVD) have been characterized optically by photoluminescence (PL) and electrically by deep-level transient spectroscopy (DLTS) and minority carrier transient spectroscopy (MCTS). The results are considered in comparison with defects observed in non-fluorinated CVD growth (e.g., using SiH4 instead of SiF4 as silicon precursor), in order to investigate whether specific fluorine-related defects form during the fluorinated CVD growth, which might prohibit the use of fluorinated chemistry for device-manufacturing purposes. Several new peaks identifying new defects appear in the PL of fluorinated-grown samples, which are not commonly observed neither in other halogenated chemistries, nor in the standard CVD chemistry using silane (SiH4). However, further investigation is needed in order to determine their origin and whether they are related to incorporation of F in the SiC lattice, or not. The electric characterization does not find any new electrically-active defects that can be related to F incorporation. Thus, we find no point defects prohibiting the use of fluorinated chemistry for device-making purposes.

  18. Drug use in business bathrooms: An exploratory study of manager encounters in New York City

    Science.gov (United States)

    Wolfson-Stofko, Brett; Bennett, Alex S.; Elliott, Luther; Curtis, Ric

    2017-01-01

    Background Though public bathroom drug injection has been documented from the perspective of people who inject drugs, no research has explored the experiences of the business managers who oversee their business bathrooms and respond to drug use. These managers, by default, are first-responders in the event of a drug overdose and thus of intrinsic interest during the current epidemic of opioid-related overdoses in the United States. This exploratory study assists in elucidating the experiences that New York City business managers have with people who inject drugs, their paraphernalia, and their overdoses. Methods A survey instrument was designed to collect data on manager encounters with drug use occurring in their business bathrooms. Recruitment was guided by convenience and purposive approaches. Results More than half of managers interviewed (58%, n = 50/86) encountered drug use in their business bathrooms, more than a third (34%) of these managers also found syringes, and the vast majority (90%) of managers had received no overdose recognition or naloxone training. Seven managers encountered unresponsive individuals who required emergency assistance. Conclusion The results from this study underscore the need for additional research on the experiences that community stakeholders have with public injection as well as educational outreach efforts among business managers. This research also suggests that there is need for a national dialogue about potential interventions, including expanded overdose recognition and naloxone training and supervised injection facilities (SIF)/drug consumption rooms (DCR), that could reduce public injection and its associated health risks. PMID:27768996

  19. Modeling Business Processes of the Social Insurance Fund in Information System Runa WFE

    Science.gov (United States)

    Kataev, M. Yu; Bulysheva, L. A.; Xu, Li D.; Loseva, N. V.

    2016-08-01

    Introduction - Business processes are gradually becoming a tool that allows you at a new level to put employees or to make more efficient document management system. In these directions the main work, and presents the largest possible number of publications. However, business processes are still poorly implemented in public institutions, where it is very difficult to formalize the main existing processes. Us attempts to build a system of business processes for such state agencies as the Russian social insurance Fund (SIF), where virtually all of the processes, when different inputs have the same output: public service. The parameters of the state services (as a rule, time limits) are set by state laws and regulations. The article provides a brief overview of the FSS, the formulation of requirements to business processes, the justification of the choice of software for modeling business processes and create models of work in the system Runa WFE and optimization models one of the main business processes of the FSS. The result of the work of Runa WFE is an optimized model of the business process of FSS.

  20. A new concept for spatially divided Deep Reactive Ion Etching with ALD-based passivation

    International Nuclear Information System (INIS)

    Roozeboom, F; Kniknie, B; Lankhorst, A M; Winands, G; Knaapen, R; Smets, M; Poodt, P; Dingemans, G; Keuning, W; Kessels, W M M

    2012-01-01

    Conventional Deep Reactive Ion Etching (DRIE) is a plasma etch process with alternating half-cycles of 1) Si-etching with SF 6 to form gaseous SiF x etch products, and 2) passivation with C 4 F 8 that polymerizes as a protecting fluorocarbon deposit on the sidewalls and bottom of the etched features. In this work we report on a novel alternative and disruptive technology concept of Spatially-divided Deep Reactive Ion Etching, S-DRIE, where the process is converted from the time-divided into the spatially divided regime. The spatial division can be accomplished by inert gas bearing 'curtains' of heights down to ∼20 μm. These curtains confine the reactive gases to individual (often linear) injection slots constructed in a gas injector head. By horizontally moving the substrate back and forth under the head one can realize the alternate exposures to the overall cycle. A second improvement in the spatially divided approach is the replacement of the CVD-based C 4 F 8 passivation steps by ALD-based oxide (e.g. SiO 2 ) deposition cycles. The method can have industrial potential in cost-effective creation of advanced 3D interconnects (TSVs), MEMS manufacturing and advanced patterning, e.g., in nanoscale transistor line edge roughness using Atomic Layer Etching.

  1. Brightly Luminescent and Color-Tunable Colloidal CH3NH3PbX3 (X = Br, I, Cl) Quantum Dots: Potential Alternatives for Display Technology.

    Science.gov (United States)

    Zhang, Feng; Zhong, Haizheng; Chen, Cheng; Wu, Xian-gang; Hu, Xiangmin; Huang, Hailong; Han, Junbo; Zou, Bingsuo; Dong, Yuping

    2015-04-28

    Organometal halide perovskites are inexpensive materials with desirable characteristics of color-tunable and narrow-band emissions for lighting and display technology, but they suffer from low photoluminescence quantum yields at low excitation fluencies. Here we developed a ligand-assisted reprecipitation strategy to fabricate brightly luminescent and color-tunable colloidal CH3NH3PbX3 (X = Br, I, Cl) quantum dots with absolute quantum yield up to 70% at room temperature and low excitation fluencies. To illustrate the photoluminescence enhancements in these quantum dots, we conducted comprehensive composition and surface characterizations and determined the time- and temperature-dependent photoluminescence spectra. Comparisons between small-sized CH3NH3PbBr3 quantum dots (average diameter 3.3 nm) and corresponding micrometer-sized bulk particles (2-8 μm) suggest that the intense increased photoluminescence quantum yield originates from the increase of exciton binding energy due to size reduction as well as proper chemical passivations of the Br-rich surface. We further demonstrated wide-color gamut white-light-emitting diodes using green emissive CH3NH3PbBr3 quantum dots and red emissive K2SiF6:Mn(4+) as color converters, providing enhanced color quality for display technology. Moreover, colloidal CH3NH3PbX3 quantum dots are expected to exhibit interesting nanoscale excitonic properties and also have other potential applications in lasers, electroluminescence devices, and optical sensors.

  2. Precipitation and Carbon-Water Coupling Jointly Control the Interannual Variability of Global Land Gross Primary Production

    Science.gov (United States)

    Zhang, Yao; Xiao, Xiangming; Guanter, Luis; Zhou, Sha; Ciais, Philippe; Joiner, Joanna; Sitch, Stephen; Wu, Xiaocui; Nabel, Julian; Dong, Jinwei; hide

    2016-01-01

    Carbon uptake by terrestrial ecosystems is increasing along with the rising of atmospheric CO2 concentration. Embedded in this trend, recent studies suggested that the interannual variability (IAV) of global carbon fluxes may be dominated by semi-arid ecosystems, but the underlying mechanisms of this high variability in these specific regions are not well known. Here we derive an ensemble of gross primary production (GPP) estimates using the average of three data-driven models and eleven process-based models. These models are weighted by their spatial representativeness of the satellite-based solar-induced chlorophyll fluorescence (SIF). We then use this weighted GPP ensemble to investigate the GPP variability for different aridity regimes. We show that semi-arid regions contribute to 57% of the detrended IAV of global GPP. Moreover, in regions with higher GPP variability, GPP fluctuations are mostly controlled by precipitation and strongly coupled with evapotranspiration (ET). This higher GPP IAV in semi-arid regions is co-limited by supply (precipitation)-induced ET variability and GPP-ET coupling strength. Our results demonstrate the importance of semi-arid regions to the global terrestrial carbon cycle and posit that there will be larger GPP and ET variations in the future with changes in precipitation patterns and dryland expansion.

  3. Ascertainment of the concentration of hypoxanthine in frozen meat of chicken

    Directory of Open Access Journals (Sweden)

    Robson Lopes d e Abreu

    2015-12-01

    Full Text Available ABSTRACT. Abreu R.L., Godoy R.L.O., Pacheco S., Pereira V.L. & Salgado N.L.G. [Ascertainment of the concentration of hypoxanthine in frozen meat of chicken.] Averiguação da concentração de hipoxantina em carne congelada de frango. Revista Brasileira de Medicina Veterinária, 37(4:350-352, 2015. Departamento de Epidemiologia e Saúde Pública, Instituto de Veterinária, Universidade Federal Rural do Rio de Janeiro, BR 465, km 7, Seropédica, RJ 23890-000, Brasil. E-mail: robsonlopesabreu@uol.com.br The objective of this study was to ascertain the concentration of hypoxanthine of the product “Cut Frozen Chicken (drumsticks” from the SIF 2423, by the method of high performance liquid chromatography (HPLC with ultraviolet detection. The sample presented 284µg.g-1 (2.08µmoles.g-1 of hypoxanthine, showing that reached the optimal maturation in terms of sensory, which occurs when concentration of hypoxanthine reaches 1.5 to 2.0 µmoles.g-1 of meat. This was a consequence of the high concentration of triphosphate of adenosine (ATP present in the sample, due to cuts in question are energy storage.

  4. Synthesis and photoluminescence spectroscopy of BaGeF6:Mn4+ red phosphor

    Science.gov (United States)

    Sekiguchi, Daisuke; Adachi, Sadao

    2015-04-01

    We synthesized Mn4+-activated BaGeF6 red phosphor by the chemical reaction method from HF, H2SiF6, BaF2, KMnO4, and GeO2 powder. The structural and optical properties of BaGeF6:Mn4+ were investigated using X-ray diffraction analysis, secondary electron microscopy observation, electron spin resonance measurement, photoluminescence (PL), PL excitation (PLE) and Raman scattering spectroscopies, and luminescence decay time measurement. Temperature dependence of the PL intensity was measured from T = 20 to 500 K and analyzed by taking into consideration the Bose-Einstein phonon occupation number. The PLE spectra measured at T = 20 and 300 K and luminescence decay time at T = 20-460 K were also analyzed based on the Franck-Condon and conventional thermal quenching models, respectively. Comprehensive discussion was given on the Mn4+-related PL properties and Raman scattering behaviors in a family of the barium hexafluorometallate phosphors.

  5. Effect of additive gases and injection methods on chemical dry etching of silicon nitride, silicon oxynitride, and silicon oxide layers in F2 remote plasmas

    International Nuclear Information System (INIS)

    Yun, Y. B.; Park, S. M.; Kim, D. J.; Lee, N.-E.; Kim, K. S.; Bae, G. H.

    2007-01-01

    The authors investigated the effects of various additive gases and different injection methods on the chemical dry etching of silicon nitride, silicon oxynitride, and silicon oxide layers in F 2 remote plasmas. N 2 and N 2 +O 2 gases in the F 2 /Ar/N 2 and F 2 /Ar/N 2 /O 2 remote plasmas effectively increased the etch rate of the layers. The addition of direct-injected NO gas increased the etch rates most significantly. NO radicals generated by the addition of N 2 and N 2 +O 2 or direct-injected NO molecules contributed to the effective removal of nitrogen and oxygen in the silicon nitride and oxide layers, by forming N 2 O and NO 2 by-products, respectively, and thereby enhancing SiF 4 formation. As a result of the effective removal of the oxygen, nitrogen, and silicon atoms in the layers, the chemical dry etch rates were enhanced significantly. The process regime for the etch rate enhancement of the layers was extended at elevated temperature

  6. Oral Vaccination Based on DNA-Chitosan Nanoparticles against Schistosoma mansoni Infection

    Directory of Open Access Journals (Sweden)

    Carolina R. Oliveira

    2012-01-01

    Full Text Available The development of a vaccine would be essential for the control of schistosomiasis, which is recognized as the most important human helminth infection in terms of morbidity and mortality. A new approach of oral vaccination with DNA-chitosan nanoparticles appears interesting because of their great stability and the ease of target accessibility, besides chitosan immunostimulatory properties. Here we described that chitosan nanoparticles loaded with plasmid DNA encoding Rho1-GTPase protein of Schistosoma mansoni, prepared at different molar ratios of primary amines to DNA phosphate anion (N/P, were able to complex electrostatically with DNA and condense it into positively charged nanostructures. Nanoparticles were able to maintain zeta potential and size characteristics in media that simulate gastric (SGF and intestinal fluids (SIF. Further in vivo studies showed that oral immunization was not able to induce high levels of specific antibodies but induced high levels of the modulatory cytokine IL-10. This resulted in a significative reduce of liver pathology, although it could not protect mice of infection challenge with S. mansoni worms. Mice immunized only with chitosan nanoparticles presented 47% of protection against parasite infection, suggesting an important role of chitosan in inducing a protective immune response against schistosomiasis, which will be more explored in further studies.

  7. Efficient removal of sulfur hexafluoride (SF6) through reacting with recycled electroplating sludge.

    Science.gov (United States)

    Zhang, Jia; Zhou, Ji Zhi; Liu, Qiang; Qian, Guangren; Xu, Zhi Ping

    2013-06-18

    This paper reports that recycled electroplating sludge is able to efficiently remove greenhouse gas sulfur hexafluoride (SF6). The removal process involves various reactions of SF6 with the recycled sludge. Remarkably, the sludge completely removed SF6 at a capacity of 1.10 mmol/g (SF6/sludge) at 600 °C. More importantly, the evolved gases were SO2, SiF4, and a limited amount of HF, with no toxic SOF4, SO2F2, or SF4 being detected. These generated gases can be readily captured and removed by NaOH solution. The reacted solids were further found to be various metal fluorides, thus revealing that SF6 removal takes place by reacting with various metal oxides and silicate in the sludge. Moreover, the kinetic investigation revealed that the SF6 reaction with the sludge is a first-order chemically controlled process. This research thus demonstrates that the waste electroplating sludge can be potentially used as an effective removal agent for one of the notorious greenhouse gases, SF6.

  8. Fault feature analysis of cracked gear based on LOD and analytical-FE method

    Science.gov (United States)

    Wu, Jiateng; Yang, Yu; Yang, Xingkai; Cheng, Junsheng

    2018-01-01

    At present, there are two main ideas for gear fault diagnosis. One is the model-based gear dynamic analysis; the other is signal-based gear vibration diagnosis. In this paper, a method for fault feature analysis of gear crack is presented, which combines the advantages of dynamic modeling and signal processing. Firstly, a new time-frequency analysis method called local oscillatory-characteristic decomposition (LOD) is proposed, which has the attractive feature of extracting fault characteristic efficiently and accurately. Secondly, an analytical-finite element (analytical-FE) method which is called assist-stress intensity factor (assist-SIF) gear contact model, is put forward to calculate the time-varying mesh stiffness (TVMS) under different crack states. Based on the dynamic model of the gear system with 6 degrees of freedom, the dynamic simulation response was obtained for different tooth crack depths. For the dynamic model, the corresponding relation between the characteristic parameters and the degree of the tooth crack is established under a specific condition. On the basis of the methods mentioned above, a novel gear tooth root crack diagnosis method which combines the LOD with the analytical-FE is proposed. Furthermore, empirical mode decomposition (EMD) and ensemble empirical mode decomposition (EEMD) are contrasted with the LOD by gear crack fault vibration signals. The analysis results indicate that the proposed method performs effectively and feasibility for the tooth crack stiffness calculation and the gear tooth crack fault diagnosis.

  9. Experiments on phase retrapping in φ Josephson junctions

    Energy Technology Data Exchange (ETDEWEB)

    Goldobin, Edward; Menditto, Rosina; Koelle, Dieter; Kleiner, Reinhold [University of Tuebingen, Tuebingen (Germany); Weides, Martin [KIT, Karlsruhe (Germany)

    2015-07-01

    We experimentally study retrapping of the phase in φ Josephson junctions (JJs) based on superconductor-insulator-ferromagnet-superconductor (SIFS) 0-π heterostructures. Such φ JJs have a doubly degenerate ground state (two potential energy wells) with the phases ±φ (0 < φ < π). We study in which of these two wells the phase is trapped upon return of the JJ to the zero voltage state. We find that for T>T* ∼ 2.4 K (large damping) the phase is always trapped in the +φ state. However, for lower T (small damping) the trapping result is a statistical mixture of the +φ and the -φ states due to the presence of noise in the system. The probability for retrapping to the -φ state increases and oscillates as T is decreasing below T*, reaching a saturation value of ∝ 30% for T

  10. Assessing the influence of media composition and ionic strength on drug release from commercial immediate-release and enteric-coated aspirin tablets.

    Science.gov (United States)

    Karkossa, Frank; Klein, Sandra

    2017-10-01

    The objective of this test series was to elucidate the importance of selecting the right media composition for a biopredictive in-vitro dissolution screening of enteric-coated dosage forms. Drug release from immediate-release (IR) and enteric-coated (EC) aspirin formulations was assessed in phosphate-based and bicarbonate-based media with different pH, electrolyte composition and ionic strength. Drug release from aspirin IR tablets was unaffected by media composition. In contrast, drug release from EC aspirin formulations was affected by buffer species and ionic strength. In all media, drug release increased with increasing ionic strength, but in bicarbonate-based buffers was delayed when compared with that in phosphate-based buffers. Interestingly, the cation species in the dissolution medium had also a clear impact on drug release. Drug release profiles obtained in Blank CarbSIF, a new medium simulating pH and average ionic composition of small intestinal fluid, were different from those obtained in all other buffer compositions studied. Results from this study in which the impact of various media parameters on drug release of EC aspirin formulations was systematically screened clearly show that when developing predictive dissolution tests, it is important to simulate the ionic composition of intraluminal fluids as closely as possible. © 2017 Royal Pharmaceutical Society.

  11. Hamiltonian analysis of a magnetoelectroelastic notch in a mode III singularity

    International Nuclear Information System (INIS)

    Zhou, Z H; Xu, X S; Leung, A Y T

    2013-01-01

    The stress intensity factor (SIF) of a multi-material magnetoelectroelastic wedge in anti-plane deformation is analytically determined by the symplectic method. The Lagrangian equations in configuration variables alone are transformed to Hamiltonian equations in dual variables (configuration and momentum) which allow the use of the method of separation of variables. The solutions of the Hamiltonian equations can be expanded analytically in terms of the symplectic eigenfunctions with coefficients to be determined by the boundary conditions. For the wedge problem, the pairs of anti-plane displacements and shear stresses, electric fields and electric displacements, and magnetic fields and magnetic inductions are proved to be the dual (momentum) variables of the configuration variables. The singularity orders depend directly on the first few eigenvalues whose real parts are less than one but greater than zero. Numerical results for various conditions show the variations of the singularity orders. In particular, special behaviors of the order of the singularity for some special wedge angles are noted. (paper)