WorldWideScience

Sample records for santrallerden elde edilen

  1. Kabuk Maserasyonunun Bornova Misketinden Elde Edilen Şıradaki Aroma Maddeleri Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Turgut Cabaroğlu

    2015-02-01

    Full Text Available Bu çalışmada kabuk maserasyonu süresinin (0, 6, 12 saat 15 °C 'de Bornova misketi üzümünden elde edilen şıraların aroma mad­deleri bileşimi üzerine etkisi araştırılmıştır. Şıralardan aroma maddeleri ekstraksiyonu sıvı-sıvı ekstraksiyon yöntemiyle diklorometan çözgeni (CH2Cl2 kullanılarak gerçekleştirilmiştir. Aroma maddelerinin analizleri gaz kromatografisinde gerçekleştirilmiş ve bu maddelerin tanısında gaz kromatografisi-kütle spektrometresi kullanılmıştır. Şıralarda 13 adet terpen bileşiği. 4 adet 6 karbonlu bileşik. 4 adet yüksek alkol, 2 adet ester ve 8 adet uçucu asit olmak üzere toplam 31 adet aroma maddesi saptanmıştır Maserasyon süresine bağlı olarak şıraların aroma mad­deleri, toplam fenol bileşikleri indisi, esmerleşme indisi, toplam azot ve pH değerlerinin daha yüksek. buna karşın toplam asit miktarının daha düşük olduğu belirlenmiştir.

  2. Toprak Solucanlarından Elde Edilen Vermikompostun Bazı Bitki Patojenleri Üzerindeki Antimikrobiyal Aktivitelerinin Araştırılması

    Directory of Open Access Journals (Sweden)

    Uğur Tutar

    2012-12-01

    Full Text Available Toprak solucanlarının, organik atıkları biyolojik olarak parçalayarak ayrıştırmaları ile oluşturdukları “vemikompost” un, bazı patojen bakteri ve funguslara karşı etkili oldukları yapılan çeşitli araştırmalarla saptanmıştır. Bu çalışmada, Eisenia fetida türü toprak solucanlarından elde edilen vermikompostun; etanol ve kloroform solventleri kullanılarak elde edilen ekstrelerinin, bitkilerde hastalıklara neden olan toprak kaynaklı patojen 9 adet bakteri ve 9 adet fungusa karşı etkinliklerinin belirlenmesi amacıyla “disk difüzyon” ve “MIC” testleri uygulanmıştır. Çalışma sonuçlarına göre, toprak solucanlarından elde edilen vermikompostun kloroform ile elde edilen ekstrelerinin Pseudomonas syringae, Xhantomonas carotae, Sclerotinia sclerotiorum, Fusarim oxysporum, Aspergillus humicola ve Aspergillus fumigatus’ a karşı etkileri güçlü olurken Erwinia chrysanthemi, Pseudomonas fluorescens, ve Penicillium brevicompactum’ a karşı etkilerinin daha zayıf olduğu görülmüştür. Vermikompostun etanol ile elde edilen ekstrelerinin ise Pseudomonas syringae, Xhantomonas campestris ve Aspergillus fumigatus’ a karşı etkilerinin güçlü olduğu, Erwinia herbicola, Erwinia chrysanthemi ve Sclerotinia sclerotiorum’ a  karşı ise daha zayıf bir etki gösterdiği saptanmıştır.

  3. Kabuk Maserasyonunun İskenderiye Misketi Üzümünden Elde Edilen Şıradaki Aroma Maddeleri Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Ahmet Canbaş

    2015-02-01

    Full Text Available Bu çalışmada İskenderiye misketi üzümünün aroma maddeleri ele alınmış ve kabuk maserasyonunun (15°C'de 7 saat şıradaki ser­best ve bağlı aroma maddeleri üzerine etkisi araştırılmıştır. Aroma maddelerinin analizi gaz kromatografisinde gerçekleştirilmiş ve bu maddelerin tanısında gaz kromatografisi - kütle spektrometresi kullanılmıştır. Şırada 19 adet serbest (2 adet alkol, 3 adet altı karbonlu alkol, 8 adet terpen, 5 adet asit, 1 adet fenol ve 37 adet bağlı (4 adet alkol, 3 adet altı karbonlu alkol, 13 adet terpen, 6 adet asit, 1 adet karbonil, 6 adet fe­nol, 4 adet norizoprenoid aroma maddesi belirlenmiştir. Maserasyonla elde edilen şıranın, serbest ve bağlı aroma maddeleri bakımından, ta­nığa göre daha zengin olduğu saptanmıştır. Glikozid haldeki terpen bileşikleri miktarının serbest haldekine göre çok daha fazla olduğu ortaya çıkmıştır. Ayrıca, maserasyonla elde edilen şırada potasyum miktarı, toplam fenol bileşikleri (OY280 ve esmerleşme (OY420 indisleri ve pH değerinin daha yüksek, toplam asit miktarının daha düşük olduğu belirlenmiştir.

  4. Farklı Kalsinasyon Sıcaklıklarında Elde Edilen Kostik Kalsine Manyezitlerin Yüzey Alanlarının ve Porozitelerinin Belirlenmesi

    OpenAIRE

    TÜRKMENOĞLU, Mehmet; KILIÇ, Özen; ANIL, Mesut; YAPICI, Nil

    2017-01-01

    Bu çalıĢmada, manyezit cevherinin 650 oC ile 850 oC arasındaki sıcaklıklarda kalsine edilmesi ile elde edilen kostik kalsine manyezitlerin yüzey alanları ve poroziteleri belirlenmiĢtir. Kimyasal analiz sonuçlarına göre, manyezit örneği %97,02 oranında magnezyum karbonattan oluĢmaktadır. Kalsinasyon sırasında karbondioksit gazının çıkıĢı ile birlikte, manyezit cevherinin BET yüzey alanı 2,71 m2/g’den 70,49 m2/g’a, Langmuir yüzey alanı ise 3,45 m2/g’dan 91,29 m2/g’a yükselmiĢtir. Yüzey alanında...

  5. Beyaz Çürükçül Mantar Trametes versicolor’dan Elde Edilen Lakkaz Enzimi İle 2,4,6-Triklorofenol’ün Enzimatik Deklorinasyonunun Kinetik Modellemesi

    Directory of Open Access Journals (Sweden)

    Arzu Ünal

    2016-03-01

    Full Text Available Bu çalışmada beyaz çürükçül mantar suşu Trametes versicolor’dan elde edilen lakkaz enzimi ile toksik klorlu fenolik bir bileşik olan 2,4,6-triklorofenol’ün deklorinasyonuna bağlı detoksifikasyonunun kinetik modellemesi araştırıldı. Substrat olarak kullanılan 2,4,6-triklorofenol’ün deklorinasyonuna bağlı detoksifikasyon kinetiğinin değerlendirilmesinde bir istatistik programı olan Systat 10 paket programı, deklorinasyonun kinetik davranışlarının açıklanması için iki substratlı çözüm ortamı olarak kullanıldı. Deneyler ve istatistiksel analizler sonucunda, Moser eşitliğinin en uygun kinetik model olduğu gözlendi. Elde edilen istatistiksel verilerden ve grafikten, çift-substratlı modelin deney verileri ile iyi bir uyum içinde olduğu görüldü. Enzimatik deklorinasyon kinetiğini tanımlayan model için elde edilen biyokinetik parametre değerleri Vmax =9,341 ppmO2/dk, Ks =38,254 g/L, Ko =20,747 ppm, R = 1,895 ve N = 1,233 olarak hesaplandı. Literatürde 2,4,6-trikolorofenol’ün degradasyonuna ilişkin herhangi bir kinetik modelleme çalışmasına rastlanmamış olup, bu araştırma ile ilk kez tarafımızdan 2,4,6-trikolorofenol’ün enzimatik deklorinasyonuna bağlı degradasyonunun kinetik modellemesi gerçekleştirildi. GC/MS Analiz sonuçları, lakkaz enzimi ile gerçekleştirilen enzimatik deklorinasyon boyunca kullanılan klorofenolik bileşiğin, %80-%100 oranında parçalandığını gösterdi. GC/MS analiz sonuçlarına bağlı olarak deklorinasyondan sorumlu olan enzimin lakkaz olduğu sonucunun literatür bulgularını da desteklediği görüldü.

  6. Süt Fabrikası Atık Sularından İzole Edilen Mikroorganizmalardan Elde Edilen Biyosürfektanların Bitki Patojeni Fusarium Türleri Üzerine Antifungal Etkilerinin Araştırılması

    Directory of Open Access Journals (Sweden)

    Fadime YILMAZ

    2014-02-01

    Full Text Available Bu çalışmada süt fabrikası atık sularından izole edilen farklı mikroorganizmalardan biyosürfektanlar elde edilmiş ve bu maddelerin antifungal aktiviteleri test edilmiştir. Bu amaçla Ankara Atatürk Orman Çiftliği Süt ve Süt Mamulleri Fabrikası atık su örneklerinden beş farklı mikroorganizma izole edilmiştir. Sadece üç izolatın biyosürfektan ürettiği belirlenmiştir. Biyosürfektan üreten izolatlar, identifikasyon testleri sonucunda Yarrowia lipolytica, Micrococcus luteus ve Burkholderia cepacia olarak tanımlanmışlardır. Y. lipolytica, M. luteus ve B. cepacia'dan üretilen ve sırasıyla BS-I, BS-II ve BS-III olarak kodlanmıştır. Elde edilen biyosürfektanların, bitki patojeni olan Fusarim cinsine ait Fusarium avenaceum ATCC 200466, Fusarium graminearum ATCC 15624, Fusarium inflexum ATCC 32211 ve Fusarium heterosporium ATCC 15625 türleri üzerine antifungal etkileri tespit edilmiştir. Tüm biyosürfektanların denenen funguslara karşı farklı antifungal aktivite sergiledikleri saptanmıştır. BS-III'ün en yüksek ve düşük misel inhibisyon oranları sırasıyla, % 71 oranında F. graminearum' da ve % 39 oranında F. heterosporium'da belirlenmiştir. Anahtar kelimeler: Süt Fabrikası Atık Suları, Biyosürfektan, Antifungal Etki, Fusarium

  7. Farklı Pomza Agrega Türlerinden Elde Edilen Hafif Betonun Sıcaklık Etkisindeki Bazı Özellikleri Üzerine Bir Araştırma

    Directory of Open Access Journals (Sweden)

    Hakan CEYLAN

    2009-04-01

    Full Text Available Bu çalısma, pomzanın tasıyıcı olmayan hafif beton üretiminde, hafif agrega olarak kullanımını ve pomza kullanılarak üretilmis hafif betonların belirli bir sıcaklık etkisine maruz kaldıktan sonraki dayanım degerlerindeki degisimleri incelemektedir. Türkiye'de, degisik türde pomza yataklanmaları mevcuttur. Bu çalısma için, bu türlerden Kayseri ili Talas İlçesi'nden, Nevsehir ili Göre Beldesi'nden çıkarılan pomzalar ve İzmir ili Menderes ilçesi'nden çıkarılan perlitik pomzalar seçilmistir. Çalısmada kullanılan türlerin, hafif agrega özellikleri incelendikten sonra, belirlenen 26 karışıma ait 3 farklı çimento oranında, 78 ayrı hafif beton dökümü yapılmıs ve elde edilen hafif beton numunelerinin kuru birim hacim agırlık, su emme, dayanım, sıcaklık etkisinde dayanım gibi bazı teknik özellikleri belirlenmistir. Arastırmada kullanılan Nevsehir-Göre, Kayseri-Talas pomzası ve İzmir-Menderes perlitik pomzasından üretilen hafif beton numuneleri üzerinde yapılan deneysel çalısmaların sonucunda, çimento oranının hafif beton numunelerinin dayanımına ve birim hacim agırlıgına etkisi, sıcaklıgın hafif beton numunelerinin dayanımına ve kuru birim hacim agırlıgına etkisi, hafif beton numunelerinde kullanılan pomza türlerinin sıcaklık etkisindeki karakteristigi ve pomza türlerinin birbirleri ile kıyaslanması hususunda irdelemeler yapılmıstır. Elde edilen bulgulara göre, pomza türleri ve bu türlerden üretilen hafif betonların sıcaklık etkisinde bazı özellikleri ile ilgili çıkarımlar elde edilmeye çalısılmıstır.

  8. Evsel Atıklardan Elde Edilen Kompostun Mısır ve Biberin Gelişimi ve Besin Elementi İçeriğine Etkisi

    Directory of Open Access Journals (Sweden)

    Derviş AYNACI

    2016-04-01

    Full Text Available Araştırmada, 1 ay süre ile 10 ayrı haneden mutfak atıkları toplanmış, toplanan evsel atıklardan elde edilen kompostun sera koşullarında mısır ve biber bitkilerinin gelişimi ve besin elementi içeriğine etkisi araştırılmıştır. Deneme 2 kg toprak alan saksılarda yürütülmüş olup, kompostun 6 (0, 0.25, 0.50, 1.00, 2.00 ve 4.00 ton/da dozu uygulanmıştır. Araştırma, 4 paralelli olarak, tesadüf parselleri deneme desenine göre planlanmış ve 2 ay süreyle yürütülmüştür. Araştırma sonunda hasat edilen bitkilerde kuru ağırlık değerleriyle N, P, K, Ca, Mg, Fe, Cu, Zn ve Mn konsantrasyonları belirlenmiştir. Uygulanan kompost miktarı arttıkça bitki kuru ağırlığı artmış, biber bitkisinin N konsantrasyonunda 2-2.4 kat arasında artışlar görülmüştür. Mısır bitkisi N konsantrasyonları da kompost dozlarından olumlu etkilenmiş fakat burada dozlar arası fark önemli olmamıştır. Bitkilerde P, K ve Ca konsantrasyonları kompost miktarı arttıkça olumlu yönde etkilenmiş, biberde Fe, Zn ve Mn konsantrasyonları, mısırda ise Mn konsantrasyonu etkisi istatistiksel anlamda önemli bulunmuştur.

  9. Yağ Gülü (Rosa damascena Mill.’nde Tepe Boşluğu Katı Faz Mikro Ekstraksiyonu (HS-SPME ve Konvansiyonel Su Distilasyonu Yöntemleri ile Elde Edilen Uçucu Bileşenlerin Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Hasan BAYDAR

    2016-04-01

    Full Text Available Yağ gülü (Rosa damascena Mill., kendine özgü doğal koku bileşenleri nedeniyle parfüm ve kozmetik endüstrisinde değerlendirilen en önemli kokulu gül türüdür. Bu araştırmada, taze yağ gülü çiçeklerinin sepal (çanak yaprak, petal (taç yaprak, stamen (erkek organ ve pistil (dişi organ olarak ayrılan kısımlarının uçucu bileşenleri gaz kromatografisi/kütle spektrometresi (GC-MS ile kombine edilmiş Tepe Boşluğu-Katı Faz Mikro Ekstraksiyon (HS-SPME tekniği ile tespit edilmiştir. Ayrıca taze yağ gülü çiçekleri konvansiyonel hidro-Clevenger su distilasyonu yöntemi ile damıtılmış, elde edilen uçucu yağların bileşenleri GC-MS ile belirlendikten sonra HS-SPME sonuçları ile karşılaştırılmıştır. HS-SPME yönteminin yağ gülünde uçucu bileşenleri analizinde oldukça hassas ve etkili olduğu anlaşılmış, bir yağ gülü çiçeğinin farklı kısımların farklı koku bileşenlerine sahip olduğu belirlenmiştir. Ayrıca su distilasyonu ile elde edilen gül yağının uçucu yağ bileşenlerinin çiçeğin doğal koku bileşenlerinden farklı olduğu ve distilasyon sürecinde önemli bazı bileşenlerde değişimler ve kayıplar olduğu tespit edilmiştir. Taze gül çiçeğinin en önemli bileşeni olan feniletil alkol çiçeğin en fazla pembe renkli petallerinde (taç yapraklarında, gül yağında varlığı istenmeyen metil öjenol ise çiçeğin en fazla stamenlerinde (erkek organlarında bulunduğu belirlenmiştir.

  10. Anadolu'ya Ait Makarnalık Buğdaylardan Cinslerarası Melezleme (Buğday x Mısır ile Elde Edilen Katlanmış Haploid (Doubled Haploid Hatların Tarımsal Kapasiteleri

    Directory of Open Access Journals (Sweden)

    A Şenay

    2009-03-01

    Full Text Available Bu çalışmada yerel makarnalık buğday çeşitlerden (T.durum Desf. Kunduru 1149, Berkmen 469 ve Çakmak 79 ve bunlardan elde edilen katlanmış haploid hatların tarla koşullarında tarımsal kapasiteleri, varyans analizi ve EKÖF testi ile karşılaştırıldı. Kunduru 1149'dan üretilen katlanmış haploid hatlar arasında, bitki yaşam oranı, başak çıkış zamanı, bitki boyu, başak uzunluğu, kardeşlenme sayısı, başakta başakçık sayısı, başakta tane sayısı, 100-tane ağırlığı, bitkide tane verimi ve hasat indeksi bakımından önemli farklılıklar bulundu. 'Berkmen 469'dan üretilen katlanmış haploid hatlar bitkide tane verimi ve kardeş sayısı dışında (P<0.05 morfolojik özelliklerin çoğunda önemli bir farklılık bulunmadı. Bu denemede 'Çakmak 79' dan üretilen hatlar arasında da hiçbir morfolojik özellikte önemli farklılık bulunmadı.

  11. Kabak Çekirdeği Kabuğundan Elde Edilen Aktif Karbon İle Metilen Mavisi Giderimi

    OpenAIRE

    Demiral, İlknur; Aydın Şamdan, Canan

    2015-01-01

    Today, industrialization and population growth have led to an increasing ofenvironmental pollution that is becoming a threat for human life. Synthetic dyes are widely used in various areas such as textile, paper, food, cosmetics, paint and plastic industries. Dyes usually have a synthetic origin and complex aromatic molecular structures which make them more stable and more difficult to biodegrade. Thus, discharging the wastewaters including dyes to natural receiving waters is an undesirable c...

  12. Türkiye'ye İthal Edilen Bir Kalamar Türünün (Illex argentines Castellanos, 1960 Mikrobiyal ve Ağır Metal Yükünün Belirlenmesi Üzerine Bir Araştırma.

    Directory of Open Access Journals (Sweden)

    Emre Çağlak

    2015-12-01

    Full Text Available Bu çalışmada İspanya menşeli aylık olarak ithal edilen dondurulmuş kalamar (Illex argentinus üzerinde; ağır metal (kurşun, kadmiyum, arsenik, cıva, bakır, çinko, mikrobiyolojik (toplam bakteri, koliform, E. coli, Staph. aureus, Salmonella ve sodyum metabisülfit değerleri tesbit edilmiştir. Elde edilen bulgulara göre ithal edilen kalamarların yapılan laboratuar analizlerinin (ağırmetal, mikrobiyolojik ve sodyum metabisülfit sonucunda insan sağlığı yönünden bir tehlike oluşturmadığı saptanmıştır

  13. Türkiye’de Yetiştirilen bazı Soya Varyetelerinden Elde Edilen Soya Sütlerinin Amino Asit Profilinin Belirlenmesi

    OpenAIRE

    Artık, Nevzat

    1989-01-01

    Bu araştırmada Türkiye’de yetiştirilen 5 farklı soya varyetesinden üretilen soya sütlerinin amino asit profilleri incelenmiştir. Ayrıca Japon soya varyetesi amino asit bileşimi ile karşılaştırma yapılmıştır. Soya sütlerinde esansiyel amino asitler yüksek düzeyde bulunmuştur. Esansiyel amino asit miktarı tüm soya varyetelerinde 4.125, 4.922 (mg/g) sınırları içinde değişmektedir. Bu özelliği ile soya sütü insan beslenmesinde önemli bir gıda maddesidir.  

  14. Pasinler İlçesi (Erzurum’nde Şeker Pancarı (Beta vulgaris Bitkilerinden İzole Edilen Fusarium spp. ve Patojeniteleri

    Directory of Open Access Journals (Sweden)

    Ömer Faruk KARYAĞDI

    2016-05-01

    Full Text Available Bu çalışma Pasinler ilçesi (Erzurum’nde şeker pancarı (Beta vulgaris L. bitkilerinden izole edilen Fusarium türlerini ve patojenitelerini belirlemek amacıyla 2009 yılında yürütülmüştür. Şeker pancarı bitkisinden yapılan izolasyon çalışmaları sonucunda 194 Fusarium izolatı elde edilmiştir. Çalışmada elde edilen izolatların %37,63’ü F. equiseti, %31,44’ü F. oxysporum, %13,92’i F. acuminatum, %10,82’si F. solani, %4,12’si F. heterosporum, %1,55’i F. avenaceum ve %0,52’si F. graminearum olarak saptanmıştır. Yapılan patojenite testlerinde F. acuminatum (P2-8A1, F. equiseti (P1-6, F. heterosporum (P10-30, F. oxysporum (P8-24, P9-36 ve F. solani (P8-2 izolatları en yüksek hastalık şiddeti oluşturmuştur. F. acuminatum ve F. graminearum için şeker pancarı bitkisi, Türkiye’de yeni konukçu kaydı olarak belirlenmiştir.

  15. Mikroenkapsüle edilen paratiroid hücrelerinin in - vitro optimizasyonu

    Directory of Open Access Journals (Sweden)

    Emrah Yücesan

    2017-12-01

    Full Text Available Amaç: Enkapsülasyon, bir maddenin ya da bir karışımın diğer bir malzeme ya da sistemle kaplandığı ya da içine sıkıştırıldığı tekniktir. Mikroenkapsülasyon tekniği, tıp dahil olmak üzere pek çok farklı disiplin tarafından uygulanmaya çalışılan ve halen en uygun enkapsülasyon tekniğinin bulunması için araştırmaların yürütüldüğü bir tekniktir. Mikroenkapsülasyon tekniğinde birbirinden farklı maddeler uygulanabilir. Bu maddeler elde edilme kaynaklarına göre doğal ya da sentetiktir. Mikroenkapsülasyon tekniği tıp pratiğinde özellikle pankreas beta hücrelerinin, Tip 1 Diabetes Mellitus (DM hastalarına verilmesinde kullanılmaktadır. Mikroenkapsülasyonun uygulandığı bir başka durum ise hipoparatiroidi tanılı hastalara paratiroid hücrelerinin verilmesidir. Paratiroid hücrelerinin, mikroenkapsülasyon işleminde kullanılabilebilmesinin en önemli özelliklerinden biri, hücrelerin göre ce homojen yapıda olmaları, eksikliğinin organizmada doğrudan gözlemlenebilir semptomlara neden olması dolayısıyla oluşacak yanıtın hızlıca belirlenebilmesidir. Yöntemler: Çalışmamızda paratiroidhiperplazisi tanısı almış insandan elde edilen paratiroid dokularından izole edilen hücrele r, %2’lik ultra saf aljinat ile muamele edildi. İşlem sırasında her bir kapsül sayısı hesaplandı ve kapsül başına 5X106, 10X106, 20X106 ve 50X106 hücre eklendi. Sonrasında 75 gün boyunca içlerinde paratiroid hücresi bulunan kapsüllerin morfolojik özellikleri ve parathormonsekresyon yeteneklerinin zaman bağlı değişimi gözlemlendi. Bulgular: 75 gün sonrasında tüm gruplar için korele olarak parathormon düzeyinde düşüş tespit edildi. Kapsüler formasyonda ciddi bir bozulmanın görülmediği grup, 20X106 hücre uygulanan grup oldu. Sonuç: Çalışmamızda model olarak değerlendirdiğimiz paratiroid hücrelerinin kapsülasyonu için en uygun koşulları (kaps

  16. High-order harmonic generation from eld-distorted orbitals

    DEFF Research Database (Denmark)

    Spiewanowski, Maciek; Etches, Adam; Madsen, Lars Bojer

    We investigate the eect on high-order harmonic generation of the distortion of molecular orbitals by the driving laser eld. Calculations for high-order harmonic generation including orbital distortion are performed for N2 (high polarizability). Our results allow us to suggest that field...... of the minimum in the high-order harmonic spectra. This is in agreement with experiment....

  17. Strong eld ionization of naphthalene: angular shifts and molecular potential

    DEFF Research Database (Denmark)

    Dimitrovski, Darko; Maurer, Jochen; Christensen, Lauge

    We analyze the photoelectron momentum distributions from strong eld ionization of xed-in-space naphthalene molecules by circularly polarized laser pulses. By direct comparison between experiment and theory, we show that the angular shifts in the photoelectron momentum distributions are very...

  18. Tokamak Plasmas: Internal magnetic field measurement in tokamak ...

    Indian Academy of Sciences (India)

    The theory of the measurement and a detailed design of the Zeeman polarimeter constructed to measure the poloidal field profile in the ADITYA tokamak are presented. The Fabry-Perot which we have employed in our design, with photodiode arrays followed by lock-in detection of the polarization signal, allows the ...

  19. Hastane Kanalizasyonlarından İzole Edilen Gram-negatif Bakterilerin Tiplendirilmesi ve Çoklu Antibiyotik Dirençliliklerinin Saptanması

    Directory of Open Access Journals (Sweden)

    Fatih Matyar

    2016-10-01

    Full Text Available Bu çalışmada, hastane kanalizasyonlarından elde edilen Gram-negatif bakteriyel izolatların mikrobiyal çeşitliliği ve antibiyotik dirençlilik düzeylerinin tespiti amaçlanmıştır. 219 Gram-negatif bakteriyel izolatın 16 farklı antibiyotiğe (10 sınıfa ait karşı dirençliliği agar difüzyon metodu kullanılarak araştırılmıştır. Çalışmada 18 farklı türe ait bakteri izole edilmiştir: tüm örneklerden en çok izolasyonu yapılan suşlar Klebsiella oxytoca (%27,4, Klebsiella pneumoniae (%20,5 ve Escherichia coli (%20,1’dir. Amfisiline (%98,6, streptomisine (%95,9 ve eritromisine (%90,0 karşı yüksek oranda dirençlilik bulunurken, sefepime (%13,2, imipeneme (%5,0 ve meropeneme (%3,2 karşı nispeten düşük oranda dirençlilik bulunmuştur. Hastane kanalizasyonlarından izole edilen tüm bakterilerin %35,6’ü, 9 farklı antibiyotiğe karşı dirençlilik göstermiştir. Çoklu antibiyotik dirençliliği (ÇAD indeksi 0,25-0,94 aralığındadır. Sonuçlar çalışılan hastane kanalizasyonlarının kayda değer miktarda antibiyotiğe dirençli Gram-negatif bakteri barındırdığını ve bu bakterilerin halk sağlığı açısından potansiyel risk oluşturduğunu göstermektedir.

  20. Stabilization of Néel order in frustrated magnets with increasing magnetic field

    Directory of Open Access Journals (Sweden)

    Thalmeier Peter

    2013-01-01

    Full Text Available For low-dimensional frustrated quantum magnets, the dependence of the staggered moment ms on a magnetic field is nonmonotonic: For small and intermediate fields, quantum fluctuations are gradually suppressed, leading to an increase of ms (H. For large applied magnetic fields however, the classically expected monotonous decrease is recovered. For the same reasons, the Néel ordering temperature TN of such compounds first increases and then exhibits a reentrant behavior as a function of the field strength. The quantitative analysis of this behavior is an excellent tool to determine the frustration parameter of a given compound. We have derived a general linear spin-wave (LSW theory in the presence of a magnetic field. Based on our LSW theory, including a small interlayer coupling, we use a self-consistent approach determining TN by the condition of a vanishing total moment. We apply our findings to the recently measured field dependence of the magnetic ordering temperature TN of Cu(pz2 (ClO42 in the framework of the S = 1/2 two-dimensional J1-J2 Heisenberg model. The observed increase with increasing field strength can be understood naturally using an intermediate frustration ratio J2/J1 ≈ 0.2, which is in accordance with the field dependence of the staggered moment.

  1. Combined full field stress and strain measurement methods for granular materials

    Directory of Open Access Journals (Sweden)

    Broere W.

    2010-06-01

    Full Text Available The current paper re-introduces the photoelastic measurement method in experimental geomechanics. A full-field phase stepping polariscope suitable for geomechanical model tests has been developed. Additional constraints on the measurement and mechanical setup arising from geomechanical test conditions are outlined as well as the opportunity to measure the displacement fields in the sample with digital image correlation. The capability of the current setup in retrieving the stress and strain field in a granular material is demonstrated.

  2. Demir ve Alüminyumun Doğal Sularda UV Spektrofotometrik Tayini İçin Yöntem Geliştirilmesi ve Elde Edilen Verilerin Kemometrik Kalibrasyon Yöntemleriyle Değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    A. Hakan AKTAŞ

    2015-01-01

    Full Text Available In this study, principal component analysis method (PCA, principal component regression method (PCR, partial least squares method (PLS of chemometry calibration methods, are successfully realized on quantitation of Fe³⁺ and Al³⁺ present at natural water. The data gathered from UV- Visible Spectroscopy are evaluated chemometrically. In the application two distinctive ligand chrome azurol S (CAS and pyrocatechol violet (PCV are tested and studies are proceeded with CAS due to more stable results that are obtained. Optimum parameters (ligand amount, pH, waiting period, relation between metal concentration and absorbance, foreign ion effect and conditions of Fe³⁺ and Al³⁺ CAS and their complexes are determined with spectrophotometric methods. After the optimum conditions are provided, spectrophotometric determinations of natural water including Fe³⁺ and Al³⁺ are realized and obtained data are evaluated as chemometry

  3. Tarımsal atıklardan elde edilen biyokömürün buğday bitkisinin gelişimi ve bazı toprak özellikleri üzerine etkileri

    OpenAIRE

    Namlı, Ayten; Akça, Muhittin Onur; Akça, Hanife

    2017-01-01

    Tavuk altlığı ve fındık kabuğu biyokömürü uygulamalarının, toprağın bazı kimyasal özellikleri ve buğday verim parametreleri üzerine olan etkilerini belirlemek amacıyla, Ankara İli Haymana ilçesinde bir yıl süreli tarla denemesi kurulmuştur. Bu kapsamda, biyokömür materyalleri tek başlarına 150 ve 300 kg da-1 dozlarında ve kimyasal gübrelerle birlikte (kaç cm?) toprak derinliğine tesadüf parselleri deneme desenine göre uygulanmıştır. Hasat sonrası alınan toprak örneklerinde yapılan analizlere ...

  4. Nedelsky ve Angoff Standart Belirleme Yöntemleri ile Elde Edilen Kesme Puanlarının Genellenebilirlik Kuramı ile Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Gülşen TAŞDELEN

    2010-06-01

    Full Text Available In this study, according to generalizability theory (G theory the variance components of the cutting scores obtained from Nedelsky and Angoff standards setting methods were compared. The data of this research were collected by using the 16 science and technology items which were asked on elementary 6th grade “Achievement Determination Exam (Seviye Belirleme Sınavı (SBS”. These items were graded by 40 science and technology experts (raters working in Ankara according to these two standards setting methods. The variance components of the cutting scores were obtained by using G theory. According to the results of the study, it is determined that the differences of the items can be revealed by using both Angoff and Nedelsky standards setting methods. While there is a rater consistency for the cutting scores obtained by Angoff method, rater consistency was not observed for the cutting scores obtained by Nedelsky method. In G study which both methods were taken in hand together, it was observed that the differences of the items could be revealed and there is a rater consistency for the cutting scores

  5. Farklı Oranlarda DPDS Kullanılarak Devulkanize Edilmiş Atık Taşıt Lastikleri İlave Edilen SBR Malzemenin Mekanik Özelliklerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Fazliye Karabörk

    2015-08-01

    Full Text Available Oda sıcaklığında öğütülen atık taşıt lastiği tozu mikrodalga yöntemiyle devulkanize edilmiştir. İşlemde devulkanizasyon ajanı olarak, kükürt bağlarının (S-S koparılmasında etkinliği çeşitli çalışmalarda ortaya konulmuş olan, DPDS (difenildisülfür kullanılmıştır. Mikrodalga gücü sabit tutularak, zamanın ve DPDS miktarının prosese etkileri incelenmiştir. İşlem görmemiş atık lastik tozu fiziksel ve termal olarak karakterize edilmiştir. 20 phr oranında atık lastik tozu ve aynı oranda devulkanize kauçuk (DVR stiren bütadien kauçuğa (SBR 1723 ve SBR 1502 katılarak kompozit malzemeler hazırlanmıştır. Bu kompozitler orijinal SBR’den hazırlanan kontrol numunesiyle karşılaştırılmıştır. Devulkanizasyonun etkinliğini ortaya koyabilmek için devulkanize numunelerin çözünme oranları (sol content belirlenmiş ve Fourier Transform Infrared Spektrofotometre (FTIR analizi yapılmıştır. Elde edilen kompozit malzemelerin mekanik özellikleri incelenmiştir. Çalışmada, DVR katılan malzemelerde atık lastik tozu katılan malzemelere göre daha iyi özellikler elde edilmiştir, sonuçlar mikrodalga devulkanizasyonunun önemli avantajlar sağladığını göstermiştir. Kopma uzaması değeri, işlem görmemiş atık lastik tozu katılan kompozit malzemede %481 iken, 1 g DPDS katılarak 4 dk. süreyle devulkanize edilen kauçuğun katıldığı DVR/SBR kompozitte %578 olarak elde edilmiştir, böylece kopma uzaması değeri atık lastik tozunun devulkanizasyonuyla %20 oranında artmıştır.

  6. Success and limits of the relativistic mean field description of nuclear ...

    Indian Academy of Sciences (India)

    The talk presents the current status and the perspectives of the relativistic mean field (RMF) description of various nuclear properties. Some remarkable successful applications of RMF to several different class of nuclear properties are first sketched in a short list. Three selective applications of RMF to the: Loosely bound ...

  7. Simulations of the electromagnetic calorimeter in the presence of magnetic eld for the FCChh

    CERN Document Server

    Matas, Marek

    2016-01-01

    This work was focused on studying the properties of the electromagnetic calorimeter for the Future Circular Collider (FCC) [1]. FCC is an accelerator that will possibly be built in the 2040s-2050s. Its circumference would be 100 km with the center of mass energy ps=100TeV in proton-proton collisions. Detectors used to record FCC collisions will consist of the tracker, cryostat, electromagnetic calorimeter (EMCal), hadronic calorimeter (HCal) and muon chambers. In this work, we shall study the EMCal and its properties. One of the properties of the environment that this particular detector will have to face is the presence of a strong magnetic eld in the volume of the calorimeter. Studies carried out in this work are preliminary studies focused on addressing the eects that the magnetic eld will have on the electromagnetic shower evolution.

  8. A relativistic mean-field study of magic numbers in light nuclei from ...

    Indian Academy of Sciences (India)

    In an axially deformed relativistic mean-field calculation of single-particle energy spectra of = 8 (Li–Mg) and = 14, 16 (C–Mg) isotonic chain and the one- and two-neutron separation energies of various isotopes of Li–Mg, new magic numbers are found to exist at = 6 and = 16 and/or = 14, which are in addition to the ...

  9. Numerical simulation of stress fi eld in inclusions of large rudder arm steel castings

    Directory of Open Access Journals (Sweden)

    Yang Dixin

    2009-08-01

    Full Text Available The infl uence of non-metallic inclusions on quality and performance of steel depends on not only the quantity of inclusions, but also the type, shape, size, distribution, and deformation behavior. In this paper, ANSYS fi nite element analysis software is used to simulate the stress fi eld of inclusions appearing in heavy rudder arm steel castings, the effects of inclusion type, shape, distribution, and various loading conditions were studied. The micromechanics of inclusions in such castings were also analyzed. Such research provides further clarifi cation on reaction mechanism of inclusions under complex loading conditions.

  10. MHC class II β genes in the endangered Hainan Eld's deer (Cervus eldi hainanus).

    Science.gov (United States)

    Liu, Hong-Yi; Xue, Fei; Wan, Qiu-Hong; Ge, Yun-Fa

    2013-01-01

    Contrary to neutral markers, the major histocompatibility complex (MHC) can reflect the fitness and adaptive potential of a given species due to its association with the immune system. For this reason, the use of MHC in endangered wildlife management has increased greatly in recent years. Here, we isolated complementary DNA (cDNA) and genomic DNA (gDNA) sequences to characterize the MHC class II β genes in Hainan Eld's deer (Cervus eldi hainanus), a highly endangered cervid, which recovered from a severe population bottleneck consisting of 26 animals. Analysis of 7 individuals revealed the presence of 3 DRB and 3 DQB putatively functional gDNA sequences. The Ceel-DRB and DQB sequences displayed high variability in exon 2, and most nonsynonymous substitutions were detected in this region. Phylogenetic analysis indicated that trans-species evolution of MHC class II β might occur in the Cervinae subfamily. Comparison of the number of sequences between gDNA and cDNA revealed that all sequences isolated from the genome were detectable in the cDNA libraries derived from different tissues (including the liver, kidney, and spleen), suggesting none of these sequences were derived from silent genes or pseudogenes. Characterization of the MHC class II β genes may lay the foundation for future studies on genetic structure, mate choice, and viability analysis in Hainan Eld's deer.

  11. Long-term monitoring of nitrate transport to drainage from three agricultural clayey till fields

    DEFF Research Database (Denmark)

    Ernstsen, Vibeke; Olsen, Preben; Rosenbom, Annette E.

    2015-01-01

    precipitation, high concen-tration of nitrate-N, and short-term low intensity drainage at air temperatures often below 5 ◦C; (ii) medium net precip-itation, medium concentration of nitrate-N, and short-term medium-intensity drainage at air temperatures often above 5 ◦C; and (iii) high net precipitation, low...... concentration of nitrate-N and long-term high intensity drainage at air tem-peratures above 5 ◦C. For each type, on-field water manage-ment actions, such as the selection of crop types and in-troduction of catch crops, appeared relevant, whereas off-field actions only seemed relevant for the latter two field types...

  12. Viscoelastic material properties’ identification using high speed full field measurements on vibrating plates

    Directory of Open Access Journals (Sweden)

    Pierron F.

    2010-06-01

    Full Text Available The paper presents an experimental application of a method leading to the identification of the elastic and damping material properties of isotropic vibrating plates. The theory assumes that the searched parameters can be extracted from curvature and deflection fields measured on the whole surface of the plate at two particular instants of the vibrating motion. The experimental application consists in an original excitation fixture, a particular adaptation of an optical full-field measurement technique, a data preprocessing giving the curvature and deflection fields and finally in the identification process using the Virtual Fields Method (VFM. The principle of the deflectometry technique used for the measurements is presented. First results of identification on an acrylic plate are presented and compared to reference values. Details about a new experimental arrangement, currently in progress, is presented. It uses a high speed digital camera to over sample the full-field measurements.

  13. Simplified and Expanded Input in a Focused Stimulation Program for a Child with Expressive Language Delay (ELD)

    Science.gov (United States)

    Wolfe, Donna L.; Heilmann, John

    2010-01-01

    There is considerable debate regarding the simplification of adults' language when talking to young children with expressive language delays (ELD). While simplified input, also called telegraphic speech, is used by many parents and clinicians working with young children, its use has been discouraged in much of the clinical literature. In addition…

  14. Russian spiritual tradition through the conception of «The Confessionalization field»

    Directory of Open Access Journals (Sweden)

    Khondzinskii Pavel, archpriest

    2015-04-01

    Full Text Available Confessionalization theory appeared in the second half of the twentieth century to describe the history of the German Protestantism in XVI-XVII centuries. The theory infers the gradual isolation of the denomination religiously, culturally, socially and politically. Later, this same theory was used to describe the same process in the catholic countries. Today, the scientific community is actively discussing the possibility of an «orthodox» confessionalization. Further to this discussion, the author tries to clarify this theory. Firstly, if the straight and narrow sense the process of «confessionalization» (especially in the sense of «a new symbiosis between church and state institutions» is a particular modern history process and the product of modernization, then in a broader sense, in the sense of a strong commitment to the breeding of the traditions (not at all possible levels, but only on the mental or cultural, this process can be extended to other periods, and other denominations. Secondly, the very need of confessionalization (no matter how consistent is its realization, arises only in the common cultural fi eld where the borders should be raised. The need for this is confessionalization. The above mentioned theory is presented in this article on the example of the Russian Church tradition. Particularly, the confessionalization concept can explain the emergence of theological and philosophical ideas introduced by the fi rst Slavophiles.

  15. Lag Vidasının Farklı Sabitleme Pozisyonunda, Dinamik Kalça Çivisi ile Tedavi Edilen İntertrokanterik Femoral Kırıklarının Kararlılığı

    Directory of Open Access Journals (Sweden)

    Talip ÇELİK

    2014-06-01

    Full Text Available Bu çalışmada, Dinamik Kalça Çivisinin (DKÇ sabitlenmesinde lag vidasının farklı konumlarına göre intertrokanterik femur kırıklarının kararlılığı analitik olarak incelenmektedir. Bilgisayarlı tomografi görüntüleri kullanılarak oluşturulan insan femurunun üç boyutlu modelinin trokanterik bölgesinde intertrokanterik femur kırığı oluşturulur. DKÇ implantı, Solidworks programında üç boyutlu olarak oluşturulup 10 farklı pozisyonda kırık femur modeline yerleştirilir. Elde edilen modeller üzerinden belirlenen noktaların koordinatları Solidwork programı ile belirlenir. Bu noktalardaki statik momentler yürüme esnasında femur başına etkiyen maksimum kuvvet uygulanarak analitik olarak hesaplanır. Femur baş kısmının inferior (alt bölgesine yerleştirilen implantta düşük momentler hesaplandı. En yüksek moment değerleri Superior (üst bölgesine yerleştirilen lag vidasında hesaplandı. Analitik analiz şunu göstermiştir ki; kırık kararlılığı açısından lag vidası femur başının inferior (alt ya da medial (orta bölgesinde ve femur uç (apeks bölgesine yakın pozisyonlandırılmalıdır

  16. International validation of the EORTC QLQ-ELD14 questionnaire for assessment of health-related quality of life elderly patients with cancer.

    Science.gov (United States)

    Wheelwright, S; Darlington, A-S; Fitzsimmons, D; Fayers, P; Arraras, J I; Bonnetain, F; Brain, E; Bredart, A; Chie, W-C; Giesinger, J; Hammerlid, E; O'Connor, S J; Oerlemans, S; Pallis, A; Reed, M; Singhal, N; Vassiliou, V; Young, T; Johnson, C

    2013-08-20

    Older people represent the majority of cancer patients but their specific needs are often ignored in the development of health-related quality of life (HRQOL) instruments. The European Organisation for Research and Treatment of Cancer (EORTC) QLQ-ELD15 was developed to supplement the EORTC's core questionnaire, the QLQ-C30, for measuring HRQOL in patients aged >70 years in oncology studies. Patients (n=518) from 10 countries completed the QLQ-C30, QLQ-ELD15 and a debriefing interview. Eighty two clinically stable patients repeated the questionnaires 1 week later (test-retest analysis) and 107 others, with an expected change in clinical status, repeated the questionnaires 3 months later (response to change analysis, RCA). Information from the debriefing interview, factor analysis and item response theory analysis resulted in the removal of one item (QLQ-ELD15QLQ-ELD14) and revision of the proposed scale structure to five scales (mobility, worries about others, future worries, maintaining purpose and illness burden) and two single items (joint stiffness and family support). Convergent validity was good. In known-group comparisons, the QLQ-ELD14 differentiated between patients with different disease stage, treatment intention, number of comorbidities, performance status and geriatric screening scores. Test-retest and RCA analyses were equivocal. The QLQ-ELD14 is a validated HRQOL questionnaire for cancer patients aged 70 years. Changes in elderly patients' self-reported HRQOL may be related to both cancer evolution and non-clinical events.

  17. Bazı Sebzelere İnokule Edilen Salmonella typhimurium ’un Limon Suyu ve Sirke ile İnaktivasyonu

    Directory of Open Access Journals (Sweden)

    İlkin Yücel Şengün

    2015-02-01

    Full Text Available Bu çalışmada limon suyu, sirke ve limon suyu-sirke karışımlarının; roka, taze soğan ve havuç örneklerine inoküle edilen Salmonellatyphimurium hücreleri üzerine göstermiş oldukları antimikrobiyal etki araştırılmıştır. Farklı sebzelerde yıkama sıvılarının oluşturdukları antimikrobiyal etki ve maksimum antimikrobiyal etkinin gözlendiği süreler istatistiksel olarak değerlendirilmiştir. Analiz sonuçları, denemelerde kullanılan limon suyu, sirke ve limon suyu-sirke karışımlarının (1:1, sebzelere inokule edilen Salmonella hücreleri üzerine antimikrobiyal etki gösterdiğini, bu etkinin kullanılan sebze tipine, inokulum dozuna ve antimikrobiyal test sıvısı içerisinde bekletme süresine bağlı olarak değiştiğini göstermiştir. Araştırma sonuçlarına göre roka ve havuç örneklerinde en etkili limon suyu-sirke karışımı iken taze soğan örneklerinde sirke en etkili bulunmuştur.

  18. International validation of the EORTC QLQ-ELD14 questionnaire for assessment of health-related quality of life elderly patients with cancer

    NARCIS (Netherlands)

    Wheelwright, S.; Darlington, A.S.; Fitzsimmons, D.; Fayers, P.; Arraras, J.I.; Bonnetain, F.; Brain, E.; Bredart, F.; Chie, W.C.; Giesinger, J.; Hammerlid, E.; O'Connor, S.J.; Oerlemans, S.; Pallis, A.; Reed, M.; Singhal, N.; Vassiliou, Y.; Young, T.; Johnson, C.

    2013-01-01

    Background: Older people represent the majority of cancer patients but their specific needs are often ignored in the development of health-related quality of life (HRQOL) instruments. The European Organisation for Research and Treatment of Cancer (EORTC) QLQ-ELD15 was developed to supplement the

  19. Effect of biostimulant sprays on Phaeomoniella chlamydospora and esca proper infected vines under greenhouse and fi eld conditions

    Directory of Open Access Journals (Sweden)

    S. Di Marco

    2009-05-01

    Full Text Available Biostimulants are compounds that infl uence physiological processes in plants, producing better growth and enhancing stress tolerance. The effect of some biostimulants on vines was investigated over a number of years to assess their effect both on the incidence of esca leaf symptoms in the vineyard and on the growth of Phaeomoniella chlamydospora artifi cially inoculated into potted vines. Field trials were carried out for 4–7 years in fi ve 15-20-yearold vineyards infected with esca proper. Potted plants were sprayed with biostimulants, after which the vine trunks were inoculated with P. chlamydospora, and then the vines were sprayed again with biostimulants in the following 2 or 3 growing seasons. On the whole, biostimulants in the fi eld did not reduce foliar symptoms. The percentage of symptomatic vines that had shown symptoms in previous years was higher in the biostimulant-sprayed plots. In the greenhouse, a certain reduction of internal necrosis caused by P. chlamydospora was seen with three of the four biostimulants tested. Prospects for biostimulants as a means control esca are discussed.

  20. opraktan izole edilen Bacillus türlerinin tanımlanması ve biyolojik özelliklerinin araştırılması

    Directory of Open Access Journals (Sweden)

    Hatice Katı

    2016-08-01

    Full Text Available Bu çalışmada, Giresun adasından toplanan toprak örneklerinden Bacillus izolasyonu yapılmıştır. Bu izolatlar morfolojik, biyokimyasal ve moleküler olarak tanımlanmıştır. Tanımlanan Bacillus’larda bazı ekstrasellüler enzimlerinin varlığı kalitatif olarak incelenmiştir. Ayrıca Bacillus izolatlarının bazı bakterilere karşı antibakteriyal aktiviteleri agar difüzyon metoduna göre araştırılmıştır. Sonuç olarak 38 izolat B. cereus grubu üyesi, 7 izolat B. thuringiensis, 10 izolat B. megaterium, 6 izolat B. pumilus ve 12 izolat Bacillus sp. olarak tanımlanmıştır. Bacillus izolatlarının ekstrasellüler enzim aktivite sonuçları değerlendirildiğinde 38 izolatın amilaz, 53 izolatın lipaz/esteraz, 16 izolatın kitinaz, 7 izolatın ksilanaz, 2 izolatın pektinaz, 73 izolatın proteaz ve 35 izolatın selülaz enzim aktivitesi pozitif olarak bulunmuştur. Çalışmada kullanılan Bacillus izolatları test edilen mikroorganizmaların gelişmelerini değişik oranlarda engellemiştir. Dokuz izolat yüksek antibakteriyal aktivite göstermiştir.

  1. MEMS-based contact stress field measurements at a rough elastomeric layer: local test of Amontons’ friction law in static and steady sliding regimes

    Directory of Open Access Journals (Sweden)

    Debrégeas G.

    2010-06-01

    Full Text Available We present the results of recent friction experiments in which a MEMS-based sensing device is used to measure both the normal and tangential stress fields at the base of a rough elastomer film in frictional contact with smooth, rigid, glass indentors. We consider successively multicontacts under (i static normal loading by a spherical indentor and (ii frictional steady sliding conditions against a cylindrical indentor, for an increasing normal load. In both cases, the measured fields are compared to elastic calculations assuming (i a smooth interface and (ii Amontons’ friction law. In the static case, significant deviations are observed which decrease with increasing load and which vanish when a lubricant is used. In the steady sliding case, Amontons’ law reproduces rather satisfactorily the experiments provided that the normal/tangential coupling at the contact interface is taken into account. We discuss the origin of the difference between the Amontons fields and the measured ones, in particular the effect of the finite normal and tangential compliances of the multicontact interface.

  2. Çeşitli Klinik Örneklerden İzole Edilen Acinetobacter spp. Suşlarının Antibiyotik Direnç Durumunun Belirlenmesi

    OpenAIRE

    ŞAY COŞKUN, Umut; Coşkun, Gökhan

    2014-01-01

    Acinetobacter spp. infeksiyonlarının tedavisinde kullanılan antibiyotiklere karşı giderek artan direnç tüm dünyada olduğu gibi ülkemizde de önemli bir sağlık sorunudur. Bu çalışma Erbaa Devlet Hastanesi’nde çeşitli poliklinik ve servislerden gönderilen kültür örneklerinden izole edilen Acinetobacter spp. suşlarının antimikrobiyal direnç profilinin belirlenmesi amacıyla yapılmıştır. Ocak 2010 ve Aralık 2013 tarihleri arasında Erbaa Devlet Hastanesi Mikrobiyoloji Laboratuvarına çeşitli poliklin...

  3. Comparison of antibody response to a non-adjuvanted, live canarypox-vectored recombinant rabies vaccine and a killed, adjuvanted rabies vaccine in Eld's deer (Rucervus eldi thamin).

    Science.gov (United States)

    Marrow, Judilee C; Padilla, Luis R; Hayek, Lee-Ann C; Bush, Mitch; Murray, Suzan

    2014-06-01

    Captive Eld's deer (Rucervus eldi thamin) were evaluated for the presence of rabies virus-neutralizing antibodies using a rapid fluorescent focus inhibition after vaccination with either a live canarypox-vectored recombinant rabies vaccine or a killed monovalent rabies vaccine. Twelve deer were vaccinated with 1.0 ml of killed, adjuvanted, monovalent rabies vaccine at 5-33 mo of age then annually thereafter, and 14 deer were vaccinated with 1.0 ml nonadjuvanted, live canarypox-vectored rabies vaccine at 3-15 mo of age then annually thereafter. Banked serum was available or collected prospectively from deer at 6 mo and 1 yr after initial vaccination, then collected annually. Rabies virus-neutralizing antibodies considered adequate (>0.5 IU/ml) were present in 20/34 samples vaccinated with canarypox-vectored rabies vaccine and in 12/14 samples vaccinated with killed adjuvanted rabies vaccine. Poor seroconversion was noted in deer less than 6 mo of age vaccinated with the canarypox-vectored rabies vaccine.

  4. CollAborative care for Screen-Positive EldeRs with major depression (CASPER plus): a multicentred randomised controlled trial of clinical effectiveness and cost-effectiveness.

    Science.gov (United States)

    Bosanquet, Katharine; Adamson, Joy; Atherton, Katie; Bailey, Della; Baxter, Catherine; Beresford-Dent, Jules; Birtwistle, Jacqueline; Chew-Graham, Carolyn; Clare, Emily; Delgadillo, Jaime; Ekers, David; Foster, Deborah; Gabe, Rhian; Gascoyne, Samantha; Haley, Lesley; Hamilton, Jahnese; Hargate, Rebecca; Hewitt, Catherine; Holmes, John; Keding, Ada; Lewis, Helen; McMillan, Dean; Meer, Shaista; Mitchell, Natasha; Nutbrown, Sarah; Overend, Karen; Parrott, Steve; Pervin, Jodi; Richards, David A; Spilsbury, Karen; Torgerson, David; Traviss-Turner, Gemma; Trépel, Dominic; Woodhouse, Rebecca; Gilbody, Simon

    2017-11-01

    Depression in older adults is common and is associated with poor quality of life, increased morbidity and early mortality, and increased health and social care use. Collaborative care, a low-intensity intervention for depression that is shown to be effective in working-age adults, has not yet been evaluated in older people with depression who are managed in UK primary care. The CollAborative care for Screen-Positive EldeRs (CASPER) plus trial fills the evidence gap identified by the most recent guidelines on depression management. To establish the clinical effectiveness and cost-effectiveness of collaborative care for older adults with major depressive disorder in primary care. A pragmatic, multicentred, two-arm, parallel, individually randomised controlled trial with embedded qualitative study. Participants were automatically randomised by computer, by the York Trials Unit Randomisation Service, on a 1 : 1 basis using simple unstratified randomisation after informed consent and baseline measures were collected. Blinding was not possible. Sixty-nine general practices in the north of England. A total of 485 participants aged ≥ 65 years with major depressive disorder. A low-intensity intervention of collaborative care, including behavioural activation, delivered by a case manager for an average of six sessions over 7-8 weeks, alongside usual general practitioner (GP) care. The control arm received only usual GP care. The primary outcome measure was Patient Health Questionnaire-9 items score at 4 months post randomisation. Secondary outcome measures included depression severity and caseness at 12 and 18 months, the EuroQol-5 Dimensions, Short Form questionnaire-12 items, Patient Health Questionnaire-15 items, Generalised Anxiety Disorder-7 items, Connor-Davidson Resilience Scale-2 items, a medication questionnaire, objective data and adverse events. Participants were followed up at 12 and 18 months. In total, 485 participants were randomised (collaborative

  5. From research to field action: example of the fight against cholera in the Democratic Republic of Congo

    Directory of Open Access Journals (Sweden)

    R. Piarroux

    2010-09-01

    Full Text Available The Democratic Republic of Congo (DRC is the country in the world which reported the highest number of cholera cases to WHO from 2002 to 2007 (128 936 cases out of a worldwide 902 071 cases. We, therefore, implemented research work which intends to understand the epidemiology of cholera in the DRC and to ensure improvements in the strategy to fight against cholera. This broad study enabled us to accurately determine the cholera epidemic’s mechanisms on different scales; to identify the source zones of the disease, and the groups of populations acting as vectors of the spread. It was then possible to demonstrate the role of “sanctuary”, played by some suburbs of lakeside cities. A collaborative network, including several scientific institutions in Europe and in the DRC, local and national government administrations in the field of public health and sanitation, international agencies, NGOs and private foundations, was progressively set up. Following the conclusions of our epidemiological studies, a drastic change of strategy was proposed: the limited curative approach on the one hand, the few existing water/sanitation programs on the other hand, have been merged in a global approach involving a larger scale water and sanitation infrastructure improvement, environmental protection, hygiene awareness and medical surveys targeting a few focus areas playing a central role in the epidemics. In conclusion, by better targeting intervention zones, one can gather human and technical resources previously scattered on the vast territory of the DRC. The strategy presented here revives the hope to eliminate cholera in the DRC.La République Démocratique du Congo (RDC est le pays qui a déclaré le plus grand nombre de cas de choléra à l’OMS entre 2002 et 2007 (128 936 cas sur un nombre total de 902 071 de cas dans le monde. Face à cette situation, nous avons mis en œuvre un travail de recherche qui vise à comprendre l’épidémiologie du

  6. Loneliness and Social Isolation among Eldely People

    Directory of Open Access Journals (Sweden)

    Engin Püllüm

    2017-11-01

    Full Text Available Social isolation is defined as the process of people losing their contacts with other social resources or their willingness to participate. Social isolation is a grave and widespread problem among seniors in society causing many harmful health conditions. Social isolation may be prevented by defining risk factors in seniors and leading them to suitable resources. The elderly should be encouraged to share their experiences and continue to produce for as long as possible, so that they are prevented from feeling isolated from society and the continuity of their economic productivity is ensured.

  7. Characterization of axially-symmetric magnetic elds

    CERN Document Server

    AUTHOR|(CDS)2087237; Buzio, Marco

    In solenoids for particle accelerators, the magnetic field is usually mapped by means of 3D Hall-sensing systems through a burdensome and costly procedure. A further problem arises from a coherent treatment between the beam physics requirements, the qualification of numerical models, the design and manufacturing of the magnet, and the magnetic measurements. For example, when the magnet is misaligned with respect to the longitudinal direction of the mapper, the fringe field shows spurious components. A method was therefore developed for measuring the magnetic field of axisymmetric magnets by exploiting their inherent symmetry. The method yields a measurement of the magnetic flux linked with a pair of sensing coils as a function of their longitudinal position. An induction transducer, sensitive to the longitudinal and radial components of the solenoid under test, has been designed and constructed. A transport system moves the transducer along the magnet axis, covering the full length of the magnet and including...

  8. Mastitisli Sütlerden İzole Edilen Bakterilerin Virulens Faktörlerinin Konvansiyel ve Moleküler Yöntemlerle Saptanması (Detection of virulence factors of bacterial strains isolated from bovine mastitis by conventional and molecular methods)

    OpenAIRE

    AKAN, Mehmet; İZGÜR, Müjgan; CANTEKİN, Zafer; TOSUN, Gökçen; ÇETİN, Seyda

    2008-01-01

    Çalışma kapsamında incelenen 1135 adet süt örneğinden 178 (%15.7) Staphylococcus spp, 99 (8.7%) E.coli ve 65 (%7.7) Streptococcus spp. izole edildi. Stafilokok suşlarının 126 (%70.8)’sı S.aureus olarak identifiye edildi. İzole edilen 65 adet Streptokok suşunun 35 (%53.9)’i S.uberis, 16 (%24.6)’sı S.agalactiae ve 14 (%21.5)’ü S.dysgalactiae olarak ayrıldı.İncelenen 178 stafilokok suşunun 126 (%70.8)’si koagülaz, 122 (%68.5)’si clumping faktör, 133 (%74.7)’ü hemoliz, 121 (%68)’i DNaz, 68 (%38.2...

  9. The central position currently occupied by remittances in the economic fi eld has largely restricted its scope on the monetary dimension of them, setting aside their hidden complexity and the variety of forms, uses and meanings that they can take. In fact

    Directory of Open Access Journals (Sweden)

    Joan Lacomba Vázquez

    2013-12-01

    Full Text Available The central position currently occupied by remittances in the economic fi eld has largely restricted its scope on the monetary dimension of them, setting aside their hidden complexity and the variety of forms, uses and meanings that they can take. In fact, the social dimension of different types of remittances, as mainly own social remittances, should be considered more as one of the most signifi cant effects of migration in relation to human development. The purpose of this paper is try to contribute to the field of remittances, both in studying the socia dimensions that they contain, and in trying to make a more precise onceptualization on them.

  10. University Chemical Laboratories, Lensfield Road. Cambridge CB2 ...

    African Journals Online (AJOL)

    The. combined organic layer was dried with. Na2SO.,, the solvent removed to give an oily residue. The residue was cleaned by column cinematography (ether) to give 2.78 g (91 %) which was further purified by recrystallisation to give 1.86 g (70%) of pure crystalline Meldruin's acid. Found 145.0491 (M* +1); MS m/z: I45.

  11. A complete characterization of Galois subfields of the generalized Giulietti–Korchmaros function field

    DEFF Research Database (Denmark)

    Anbar Meidl, Nurdagül; Bassa, Alp; Beelen, Peter

    2017-01-01

    We give a complete characterization of all Galois subfields of the generalized Giulietti–Korchm´aros function fields Cn/Fq 2n for n ≥ 5. Calculating the genera of the corresponding fixed fields, we find new additions to the list of known genera of maximal function fields.......We give a complete characterization of all Galois subfields of the generalized Giulietti–Korchm´aros function fields Cn/Fq 2n for n ≥ 5. Calculating the genera of the corresponding fixed fields, we find new additions to the list of known genera of maximal function fields....

  12. MARS APAREYİ VE KLİNİK UYGULAMASI- THE CLINICAL ASPECTS OF THE MARS APPLIANCE

    OpenAIRE

    Öztürk, Yıldız; erbay, elif

    2013-01-01

    Anahtar kelimeler: Herbst apareyi, Mars apareyi, Class II maloklüzyon, Fonksiyonel ortopedik tedaviMars apareyi, iskeletsel II. sınıf düzensizliklerin tedavisinde başarı ile kullanılan ve hasta işbirliğini gerektirmeyen sabit bir fonksiyonel aygıttır. Bu yazıda Mars apareyinin özelliklerinden söz edilerek, bu aparey ile tedavi edilen bir vakadan elde edilen klinik ve radyolojik bulgular bildirilmektedir.Key Words: Herbst appliance, Mars appliance, Class II malocclusion, Functional orthopedic ...

  13. BRINE SHRIMP LETHALITY BIOASSAY OF GLAUCIUM GRANDIFLORUM VAR. GRANDIFLORUM

    OpenAIRE

    A. SARI, Ç. ÜNSAL, İ. SARIOĞLU, A. SARI, Ç. ÜNSAL, İ. SARIOĞLU

    2013-01-01

    Türkiye'nin 3 farklı bölgesinden toplanan Glaucium grandiflorum Boiss. et Huet var. grandiflorum örneklerinin toprak üstü kısımlarından elde edilen alkaloit ekstreleri ve bu ekstrelerden elde edilen majör alkaloitler allokriptopin, protopİn, (+)-izokoridin, (+)-korİdin üzerinde brİne shrimp lethality testi yapılarak sitotoksisiteleri İncelenmiştir. Glaucium grandiflorum var. grandiflorum türünün 3 örneği de önemli oranda sitotoksik aktİvite göstermiştir. Allokriptopin, protopin, (+)-izok...

  14. Mikrobiyel transglutaminaz enziminin yoğurt dondurması üretiminde kullanımı

    OpenAIRE

    KIRIMHAN, Evren Ülkü

    2011-01-01

    Bu çalışmada; Streptoverticillum mobaraense'den elde edilen mikrobiyel kaynaklı transglutaminaz enziminin (R- glutaminly- peptide: amine gama- glutamyl- transferase (EC 2.3.2.13)) yoğurt dondurması üretiminde kullanım olanakları araştırılmıştır. Bu amaçla, farklı aşamalarda TGase enzimi ile muamele edilmiş yağsız ve yağlı yoğurtlar kullanılarak üretilen yoğurt dondurmalarının fiziksel bazı nitelikleri ile tekstürel ve duyusal özellikleri değerlendirilmiştir.Elde edilen so...

  15. Punica granatum L. Çekirdek ve Kabuk Ekstrelerinin Antioksidan Aktiviteleri

    OpenAIRE

    DEMİR, Hülya

    2008-01-01

    Bu çalışmada, Punica granatum L.(Punicaceae) "Nar", meyve çekirdeği ile kabuk ekstraklarının antioksidan aktiviteleri araştırıldı. Punica granatum L. çekirdek ve kabuğunun metanol ve hekzan ekstrelerinde serbest radikal giderme aktivite, indirgenme gücü analizleri yapıldı. Elde edilen sonuçlar standart antioksidan olarak bilinen askorbik asit ile karşılaştırıldı. Bu çalışmada elde edilen sonuçlara göre antioksidan aktivite Askorbik asit> Punica granatum L. kabuğu> Puni...

  16. THE SIMULATION MODEL OF SALT AND BORON TRANSPORT IN SURFACE SOIL

    Directory of Open Access Journals (Sweden)

    Satea M. OMAR

    1998-03-01

    Full Text Available Kaba ve ince bünyeli iki farklı toprakta laboratuvar denemesi kurularak bor ve tuz hareketi üzerine bilgisayar similasyon yıkama modeli uygulanmıştır. Denemede 5 cm göllendirme ve aralıklı sulama yöntemleriyle yıkama yapılmıştır. İki farklı toprakta yıkama esnasında belirlenen tuz ve bor konsantrasyonları bilgisayar program madeli ile tahmin edilen sonuçlarla kıyaslanmıştır. Elde edilen sonuçlara göre, yıkama işlemi süresince aralıklı sulama yöntemi uygulanmış topraklarda elde edilen EC ve bor değerleri bilgisayar program modeli ile tahmin edilen sonuçlarla uyum göstermiştir. Tuz yıkanmasına oranla bor yıkanması için 4-5 kat daha fazla su gerekmektedir.

  17. Capturing relativistic wake eld structures in plasmas using ultrashort high-energy electrons as a probe

    CERN Document Server

    Zhang, C J; Xu, X L; Li, F; Pai, C -H; Wan, Y; Wu, Y P; Gu, Y Q; Mori, W B; Joshi, C; Lu, W

    2016-01-01

    A new method capable of capturing coherent electric field structures propagating at nearly the speed of light in plasma with a time resolution as small as a few femtoseconds is proposed. This method uses a few femtoseconds long relativistic electron bunch to probe the wake produced in a plasma by an intense laser pulse or an ultra-short relativistic charged particle beam. As the probe bunch traverses the wake, its momentum is modulated by the electric field of the wake, leading to a density variation of the probe after free-space propagation. This variation of probe density produces a snapshot of the wake that can directly give many useful information of the wake structure and its evolution. Furthermore, this snapshot allows detailed mapping of the longitudinal and transverse components of the wakefield. We develop a theoretical model for field reconstruction and verify it using 3-dimensional particle-in-cell (PIC) simulations. This model can accurately reconstruct the wakefield structure in the linear regime...

  18. On permutation polynomials over finite fields: differences and iterations

    DEFF Research Database (Denmark)

    Anbar Meidl, Nurdagül; Odzak, Almasa; Patel, Vandita

    2017-01-01

    The Carlitz rank of a permutation polynomial f over a finite field Fq is a simple concept that was introduced in the last decade. Classifying permutations over Fq with respect to their Carlitz ranks has some advantages, for instance f with a given Carlitz rank can be approximated by a rational...... linear transformation. In this note we present our recent results on the permutation behaviour of polynomials f+g, where f is a permutation over Fq of a given Carlitz rank, and g ∈ Fq[x] is of prescribed degree. We describe the relation of this problem to the well-known Chowla-Zassenhaus conjecture. We...

  19. Metal–insulator crossover in high c cuprates: A gauge field ...

    Indian Academy of Sciences (India)

    A metal–insulator crossover appears in the experimental data for in-plane resistivity of underdoped cuprates and a range of superconducting cuprates in the presence of a ... Dipartimento di Fisica 'G.Galilei' and INFN-Sez. di Padova, Italy; Institute of Theoretical Physics, CAS Beijing 100080, China; International Centre for ...

  20. Quality of life and nursing service need in eldly low vision patients

    Directory of Open Access Journals (Sweden)

    Hui-Lan Zheng

    2017-01-01

    Full Text Available AIM: To investigate the quality of life of elderly patients with low vision and its nursing service demand, in order to improve the quality of life of elderly low vision group and provide theory basis. METHODS: A cross-sectional study method, in a tertiary hospital in Fuzhou city elderly patients with low vision 200 cases were as the research object, USES the Chinese version of quality of life scale(CLVQOL, low vision care service demand questionnaire investigation were taken. RESULTS: In elderly patients with low vision life quality score was 54.92±12.11, the nursing service demand score 30.34±8.93, medium and high demand was of 88%. Quality of life was negatively correlated with nursing service demand value(r=-0.266, PCONCLUSION: The quality of life of elderly patients with low vision was low, nursing service demand is high, especially on visual function recovery training of nursing service requirements. Aging brings important social problems in China, attaches great importance to the elderly care service demand, discussion with precise visual nursing care intervention in low vision group, it is necessary to improve the quality of life.

  1. Tuning the band gap of semiconducting carbon nanotube by an axial magnetic field

    OpenAIRE

    G. Fedorov

    2010-01-01

    We have investigated the magnetic field dependence of transfer characteristics of a device fabricated in a configuration of a field-effect transistor with a conduction channel formed by a semiconducting multiwalled carbon nanotube. Our results unambiguously indicate that an axial magnetic field suppresses the band gap of the nanotube. Quantitative analysis of the data indicates linear dependence of the band gap on magnetic field as well as a linear splitting between the K and K′ subbands of t...

  2. The Environmental Impact of Oilfield Formation Water on a ...

    African Journals Online (AJOL)

    bases industries. In Nigeria were oil exploration activities are being carried out, Formation water is one of the major pollutants of the aquatic environment ... Pollution incidents are generally monitored in a questionable manner involving measurements taken only after the occurrence of the incident (Snowden and likweozor,.

  3. Karagöl (Yamanlar, İzmir'ün Sucul Coleoptera (Classis: Insecta Faunasına Katkılar.

    Directory of Open Access Journals (Sweden)

    Esat Tarık Topkara

    2015-12-01

    Full Text Available Bu çalışmada, Karagöl (Yamanlar-İzmir’den 18 Mayıs 2006 tarihinde yapılan örnekleme sonucu elde edilen sucul Coleoptera örnekleri değerlendirilmiştir. Sistematik açıdan yapılan değerlendirmede, Adephaga altfamilyasının Gyrinidae ve Dytiscidae familyalarına ait 4 tür, Polyphaga altfamilyasının Helophoridae, Hydrophilidae, Hydraenidae ve Dryopidae familyalarına ait 7 tür tespit edilmiştir. Tespit edilen türler bu gölün sucul Coleoptera faunası için yeni kayıt niteliğindedir

  4. Bayesci Genelleştirilmiş Lineer Karma Modellerde Önsel Seçimleri ve Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Zeynep ÖZTÜRK

    2017-06-01

    Full Text Available Parametre tahmininde ve model seçiminde uzman görüşlerin modele katılmasını öngören Bayesci yaklaşımda en önemli nokta parametreler hakkında önsel bilgi seçimi ve kullanımıdır. Bu nedenle, bu çalışmada, önsel dağılımların seçimleri tanıtılmış, genelleştirilmiş lineer karma modeller için farklı önseller ile elde edilen modeller hem parametre tahmini hem de model uyumu anlamında karşılaştırılmıştır. Akciğer kanseri hastalarının yaşam kaliteleri ve aldıkları tedavinin çıktılarını ölçmek amacıyla yapılan bir çalışmaya ait gerçek bir veri kullanılmıştır. SAS 9.3 programında Markov Zinciri Monte Carlo algoritması ile elde edilen parametre tahminleri bulunmuş ve modeller kurulmuştur. Farklı önsel seçimleri ile Sapma Bilgi kriteri (DIC ne göre en iyi model bilgilendirici önsel dağılım ile elde edilen model olmuştur.

  5. SU-PROPİONİK ASİT-ÇÖZÜCÜ SİSTEMLERİ SIVI-SIVI DENGE VERİLERİNE UNIFAC MODELİNİN UYGULANMASI

    OpenAIRE

    ÇEHRELİ, Süheyla

    2003-01-01

    Su-Propionik Asit-Benzil Alkol, Su-Propionik Asit-Benzil Asetat ve Su-Propionik Asit-Dibenzil Eter üçlü sistemlerine ait sıvı-sıvı denge verileri UNIFAC Modeli kullanılarak tahmin edilmiştir. Bunun için çok varyanslı Newton-Raphson yönteminin uygulandığı bir bilgisayar programı kullanılmıştır. Elde edilen model verileri deneysel verilerle karşılaştırılmıştır.

  6. SU-PROPİONİK ASİT-ÇÖZÜCÜ SİSTEMLERİ SIVI-SIVI DENGE VERİLERİNE UNIFAC MODELİNİN UYGULANMASI

    Directory of Open Access Journals (Sweden)

    Süheyla ÇEHRELİ

    2003-01-01

    Full Text Available Su-Propionik Asit-Benzil Alkol, Su-Propionik Asit-Benzil Asetat ve Su-Propionik Asit-Dibenzil Eter üçlü sistemlerine ait sıvı-sıvı denge verileri UNIFAC Modeli kullanılarak tahmin edilmiştir. Bunun için çok varyanslı Newton-Raphson yönteminin uygulandığı bir bilgisayar programı kullanılmıştır. Elde edilen model verileri deneysel verilerle karşılaştırılmıştır.

  7. Zeytin (Olea europaea L.) Genotiplerinin DNA Markörleri Yardımı ile Karakterizasyonu

    OpenAIRE

    ÇETİN, Öznur; MISIRLI, Adalet; TANYOLAÇ, M. Bahattin

    2017-01-01

    Bu çalışmada ulusal zeytin arazi gen bankasındaki 96 genotip DNA’ya dayalı yöntemler olan RAPD, AFLP veSSR markör teknikleri uygulanarak moleküler düzeyde tanımlanmıştır. RAPD markör analizinde 52 primerden215 polimorfik bant, AFLP markör analizinde 26 primerden 919 polimorfik bant ve SSR markör analizinde ise 14primerden 62 polimorfik bant elde edilmiştir. Her teknikten elde edilen veriler ile genetik uzaklık matrisi vedendrogram oluşturulmuştur. Ayrıca üç tekniğin verilerinin birleştirilmes...

  8. Düsük Kalorili Konya Linyitlerinin Azotlu Gübre Olarak Kullanılması

    Directory of Open Access Journals (Sweden)

    Hüseyin DEVECİ

    2009-04-01

    Full Text Available Bu çalısmada, Türkiye'nin genç linyitlerinden olan Konya çevresindeki düsük kalori degerli Beysehir, Ilgın ve Ermenek linyitlerinin hümik asit (HA ve azot içerikleri belirlenmistir. Linyitlerden maksimum azot içerikli organo-mineral gübre elde edilmesi için optimum deney sartları tespit edilmistir. Linyit ve HA'lerden elde edilen organo-mineral gübrelerin sera sartlarında uygulanabilirligi arastırılmıs ve tarımda kullanılabilecegi sonucuna varılmıstır.

  9. Mağnezitin Kalsinasyon Kinetiği ve Saf MgO Üretimi

    OpenAIRE

    ABALI, Yüksel

    2000-01-01

    Bu çalışmada, % 97.35 MgCO3 ihtiva eden mağnezit minerali 500 - 900 0C sıcaklık aralığında kalsine edildi. Kalsinasyon reaksiyonunun ikinci mertebeden olduğu bulundu ve bu reaksiyona ait aktivasyon enerjisi 173.1 kj/mol olarak hesaplandı. Kalsine cevherin asetik asit çözeltilerinde çözündürülmesiyle elde edilen Mg(CH3COO)2’a NaOH çözeltisi ilave edildi ve Mg(OH)2 üretildi. Mg(OH)2’in 700 0C’de kalsine edilmesi ile saf MgO elde edildi.

  10. Production of polarized ^3He gas by means of very low temperature and high magnetic field

    OpenAIRE

    田中, 正義; 猪股, 亨; 高橋, 豊; 藤原, 守; 輿曽井, 優; 郡, 英輝; 太田, 岳史; 森崎, 知治; 国松, 貴之

    2009-01-01

    最近、我々は極低温(~ 4mK)と超強磁場(最大17T)を用いた所謂Brute force法による偏極固体^3Heの生成と急速解凍による偏極^3Heプロジェクトをスタートした。このプロジェクトの目的は、偏極^3Heガスをハイパー偏極^3He MR(I 核磁気共鳴イメージング)に用いて医学に応用することである。^3He-^4He希釈冷凍器に取り付けられるポメンランチュークセルが設計され、製作されている。最初のテスト実験では、ポメランチュクセルは低い冷凍能力を有する^3He-^4He希釈冷凍器(IBC; In Beam Cryostat)に取り付けられる。そこでは、1Tの超伝導 ソレノイドコイルが用いられる。一方、本実験では、ポメランチュクセルは高い冷凍能力を有する^3He-^4He希釈冷凍器(DRS 2500)に取り付けられる。そこでは、17Tの超伝導ソレノイドコイルが用いられる。このレポートで、我々は、^3Heを偏極させる原理と実験装置の設計・製作の現状を述べる。|Recently, we started a project on polarized ^3He gas gener...

  11. The effect of continuous exposure to electromagnetic fïeld on four successive generations of mice

    Directory of Open Access Journals (Sweden)

    Oentoeng Soeradi

    2002-03-01

    Full Text Available The objective of this study is to know the biobgical effects of  electromagnetic field treatment on four successive generations of mice. Fourty eight male and female mice of Swiss Webster Strain, 3 months of old, and 35 - 40 g body weight, were kept in a controlled environment and fed a standard diet. Mice were divided into 6 groups of four couples each. The first group was exposed to electromagnetic field of I kV/10 cm, the second group to 2 kV/10 cm, and the third group to 3 kV/10 cm. The remaining 3 groups were served as untreated controls of the first, second, and third group, respectively. Each couple of mice was placed in a cage (26x20x11 cm with wire metal cage tops. The cages of experimental groups with mice inside, were then put on the negative terminal plate of a pair of parallel aluminium plate electrodes. These cages were  perpendicular to the positive electrode plate at a distance of I0 cm. Subsequently, the electrodes were connected to stepup transformer as an alternating current power supply. All mice belonging to experimental and untreated control groups were allowed to mate, gastate, and deliver the first up to fourth generations, During investigation, all generations of experimental groups were continuously treated to electromagnetic field, while generations of untreated control groups received no treatment to electromagnetic field, During the study, all mice were housed in a room having a temperature of 26ᵒ C and a light - dark cycle of 12:12 hours. The results of this study showed that exposure of mice to electromagnitic field results in reduced fertility with no change in sex ratio of the offspring. Exposure to electromagnetic field, however, were effective in inducing congenital anomalies, such as micropthalmy, white eyes, short hind legs, dwarf mice, and tumors in both sexes of the offspring which caused of death after 3 - 4 months of old. A large mortality rate were found, especially in the third and fourth generations. No congenital anomalies and tumors were noted in untreated controls. ln conclusion, we suggest that several facts which found in this study were the result of changes in genetic material of the sperm or eggs during spermatogenesis or oogenesis, respectively, i.e. a mutagenic effect. This interaction between electromagnetic field and the living cell, may then cause biological effects on cells, tissues, and organs, so that finally there are consequences for the whole organisms. (Med J Indones 2002; 11: 3-10Keywords: electromagnetic field, fertility, mortality rate, congenital anomalies, tumor, mice

  12. İMKB 30 İndeksini Oluşturan Hisse Senetleri İçin Parçacık Sürü Optimizasyonu Yöntemlerine Dayalı Portföy Optimizasyonu

    Directory of Open Access Journals (Sweden)

    Azize Zehra ÇELENLİ

    2015-01-01

    Full Text Available 1950 yılına kadar menkul kıymet çeşidi arttıkça portföy riskinin azalacağı savunulmaktadır. Getirisi yüksek olan menkul kıymetlere yatırım yapılmasını öneren geleneksel portföy teorisi, ortalama varyans modelinin geliştirilmesi ve böylece modern portföy teorisinin temellerinin ortaya atılması ile terk edilmiştir. Ortalama varyans modeli matematiksel programlama yöntemleri ile çözümlenmektedir. Son yıllarda portföy optimizasyonunda, yapay zeka yöntemleri kullanılmaktadır. Bu çalışmada klasik ve garanti yakınsamalı parçacık sürü optimizasyonu yöntemleri İMKB 30 indeksini oluşturan hisse senetlerinden oluşacak portföy optimizasyonu için uygulanmış ve elde edilen sonuçlar matematiksel programlamadan elde edilen sonuçlar ile karşılaştırılmıştır.

  13. ROTOR-RULMAN SİSTEMLERİNİN TASARIM OPTİMİZASYONU

    Directory of Open Access Journals (Sweden)

    Hamit SARUHAN

    2003-03-01

    Full Text Available Bu makale rotor-rulman sistemlerinin analizi ve optimizasyonunu göz önüne alarak yazarın çalışmaları ile birlikte literatürden kısa bir bilgi sunumu mahiyetinde bir çalışmadır. Çalışmayla, rotor-rulman sistemlerinin optimizasyonu alanında çalışmak isteyen tasarımcıya bir motivasyon ve fikir verme amaç edinilmiştir. Çalışmada genetik algoritmalar methoduyla elde edilen sonuçlar numeric metodla elde edilen sonuçlarla kıyas edilerek genetik algoritmaların kabiliyeti gösterilmiştir. Genetik algoritmalar tabii seleksiyon (seçim tekniğini kullanarak tanımlanan sınırlar içinde tarama yapan ve genetik fikrine dayalı uygun araştırma teknikleridirler. Günümüzde genetik algoritmalar bir çok alanda kullanılmaktadır.

  14. Seçilen Bazı Pestisitlerin Bal Örneklerinde Analizi

    Directory of Open Access Journals (Sweden)

    Hale SEÇİLMİŞ CANBAY

    2014-07-01

    Full Text Available Bu çalışmada, Isparta'dan temin edilmiş bal örneklerinde pestisit analizi yapılmıştır. Pestisit analizleri, katı faz ekstraksiyon (SPE işleminden sonra, gaz kromatografi/azot fosfor dedektörü (GC/NPD kullanılarak gerçekleştirilmiştir. On adet pestisit kalıntısı analizi, yirmi adet örnekte yapılmıştır. Çalışılan pestisitlerin, GC/NPD kullanılarak elde edilen dedeksiyon limitler 0.5-3.50 ng/g arasındadır. Elde edilen geri kazanma değerleri % 84,4 ile % 90,8 aralığındadır. Klorpirifos (0,024 ng/g, diazinon (0,021 ng/g, ethion (0,046 ng/g, sipermetrin (0,021 ng/g, deltametrin (0,019 ng/g ve malathion (0,020 ng/g kalıntıları bal örneklerinde tespit edilmiştir.

  15. AISI 1030 ÇELİĞİNİN AŞINDIRICILI SU JETİ İLE KESİLMESİNDE YÜZEY PÜRÜZLÜLÜĞÜNÜN VE KESME ÖNÜ GEOMETRİSİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Adnan AKKURT

    2009-01-01

    Full Text Available Alternatif bir üretim yöntemi olarak gündeme gelen aşındırıcı su jeti (ASJ ile kesme, endüstriyel amaçlı malzemelerdeki gelişmelere paralellik gösterecek şekilde, işlenmesi güç malzemelerin biçimlendirilmesinde etkili bir yöntem olarak kullanılmaktadır. Bu çalışmada, endüstride yaygın kullanılan AISI 1030 malzemeden hazırlanan farklı kalınlıklardaki numuneler işleme parametrelerinden yanal hız değişken, diğer parametreler sabit tutularak, ASJ ile kesilmiş ve elde edilen yüzeylerin kesme önü geometrisi karakterize edilmiştir. Elde edilen sonuçlar dik kenar, keskin köşe ve benzeri yüzeylerin işlenmesinde aşındırıcılı su jeti ile kesme metodunun kullanılabileceğini göstermiştir.

  16. ATATÜRK’ÜN İKTİSADİ GÖRÜŞLERİNİN TÜRKİYE EKONOMİSİ ÜZERİNE ETKİLERİ

    OpenAIRE

    DİŞBUDAK, Cem

    2006-01-01

    Türkiye Cumhuriyeti Osmanlı İmparatorluğu’ndan devralınan bir enkaz üzerine inşa edilmeye çalışılmıştır. İmparatorluktan devralınan miras göz önünde bulundurulduğunda 1923-1938 yılları arasında ekonomi alanında elde edilen başarıların son derece önemli olduğu görülür. Ekonomik gelişmeler iki dönemde ele alınabilir: Liberal uygulamaların ön planda olduğu 1923-1929 yılları ve Devletçilik uygulamalarının söz konusu olduğu 1933-1938. Özellikle devletçilik döneminde elde edilen başarılar oldukça ö...

  17. Genç futbolcularda treadmille belirlenen amaksimal oksijen tüketimi ile yo-yo ve mekik testine verilen performans cevaplarının incelenmesi

    OpenAIRE

    ARSLAN, Erşan

    2009-01-01

    Bu araştırma, direk ölçülen VO2max değerleri ile Mekik ve Yo-Yo testlerinden formüllerle elde edilen indirekt VO2max değerlerinin karşılaştırılması amacıyla yapılmıştır. Elde edilen bulgular sonucunda futbolcularda VO2max tahmininde, Yo-Yo ve Mekik testlerinden hangisinin daha uygun olduğunu tespit etmek amaçlanmıştırAraştırmaya, Ankaraspor profesyonel futbol takımının alt yapısında B genç grubunda futbol oynayan 15.38±0.51 yıl, 177.38±5.53cm, 69.36± 5.48kg, 5.54± 0.78 antrenm...

  18. Gezgin Satıcı Problemi İçin Merkezden Kenarlara Hipersezgisel Yöntem

    Directory of Open Access Journals (Sweden)

    Fidan NURİYEVA

    2016-06-01

    Full Text Available Bu makalede Gezgin Satıcı Problemi için yeni bir hipersezgisel algoritma önerilmiştir. Bu yöntemde önce N adet şehir içerisinden merkez şehir ve 4 uç şehir seçilip, sonra ise merkez ile ikişer-ikişer uç şehirlerin orta noktaları belirlenerek merkez şehirden başlanarak bu 9 şehirden geçen bir devre oluşturulmuştur. Daha sonra “en kısa yol” ve “ekleme sezgiseli” algoritmaları kullanılarak bulunan devre tüm şehirlerden geçecek şekilde genişletilmiştir.  Önerilen algoritmalar ile kütüphane problemleri üzerinde hesaplama denemeleri yapılmış, elde edilen sonuçlar “en yakın komşu” algoritmasından elde edilen sonuçlar ile karşılaştırılmıştır. Hesaplama denemeleri önerilen algoritmanın verimli olduğunu göstermektedir.

  19. Yazım Kılavuzu'nda tespit edilen tutarsızlıklar üzerine artzamanlı bir inceleme

    National Research Council Canada - National Science Library

    DİREKCİ, Bekir; YASTI, Mehmet

    2010-01-01

    ... günümüze kadar devam ede gelmiştir. Yeni alfabede söyleyişe dayalı bir yazım düzeni benimsenmiştir. Kelimelerin nasıl yazılacağı da Türk Dil Kurumu tarafından hazırlanan Yazım Kılavuzu...

  20. EPS Ara Dolgu Kullanımının Ankastre İstinat Duvarlarının Statik Davranışı Üzerindeki Etkileri

    Directory of Open Access Journals (Sweden)

    Özgür L. Ertuğrul

    2012-03-01

    Full Text Available Bu çalışmada, genleştirilmiş polistren (EPS ara dolgu kullanımının, farklı duvar esnekliklerine sahip olan ankastre istinat duvarlarında oluşan yanal basınç ve duvar sehimleri üzerindeki etkileri araştırılmaktadır. Bu amaç doğrultusunda, 0.7 m yüksekliğinde ve çeşitli kalınlıklarda istinat duvarı modelleri hazırlanarak laboratuvar ortamında deneyler yapılmıştır. Birinci grup testlerde, duvar ile kohezyonsuz dolgu arasında herhangi bir ara dolgu yer almaması durumu incelenmiş, ikinci ve üçüncü test gruplarında ise duvar ile dolgu arasında iki farklı kalınlıkta EPS'den imal edilen ara dolgu bulunması durumu incelenmiştir. Dört farklı kalınlıkta duvar için deneyler tekrarlanarak elde edilen bulgular karşılaştırmalı olarak değerlendirilmiştir. Duvar esnekliği arttıkça ara dolgunun sağladığı yük azaltıcı etki azalmaktadır. Buna rağmen, esnek duvarlarda deforme olabilen ara dolgu kullanımı, yanal zemin itkisi ve duvar sehimlerinde önemli oranlarda düşüş sağlayarak daha ekonomik duvar tasarımlarına imkân verebilir. Model deneyler neticesinde elde edilen yanal zemin basıncı katsayıları, Coulomb yöntemi ile elde edilen aktif yanal basınç katsayılarıyla karşılaştırılmaktadır. Duvar esnekliği ve ara dolgu özelliklerinin çeşitli kombinasyonları için, statik yanal basınç katsayılarının tahmini amacıyla bir grafik sunulmaktadır.

  1. Folikül Büyüklüğü ve Folikül Uyarıcı Hormon Konsantrasyonunun Sığır Oositlerinin İn Vitro Nükleer Olgunlaşması Üzerine Etkisi

    Directory of Open Access Journals (Sweden)

    Uğur Şen

    2015-07-01

    Full Text Available Bu çalışma folikül büyüklüğü ve folikül uyarıcı hormon (FSH konsantrasyonunun sığır oositlerinin in vitro nükleer olgunlaşması üzerine etkisini araştırmak amacıyla yapılmıştır. Sığır ovaryumundaki (87 adet foliküller küçük (<3 mm, 128 adet, orta (3–8 mm, 168 adet ve büyük (9–12 mm, 148 adet olmak üzere 3 sınıfa ayrılmıştır. Farklı büyüklüklerdeki foliküllerden aspire edilen oositler, %10 FCS ve farklı konsantrasyonlarda FSH (0,5; 1,0 ve 10,0 μg/ml içeren doku kültür medyumunda (TCM–199 22 saat süreyle 38,5°C’de, %5 CO2 ve yaklaşık %95 oranında nem içeren ortamda in vitro olgunlaştırılmaya alınmışlardır. Kültür işlemi sonunda oositlerin nükleer olgunlaşmaları (MII; Metafaz II safhasına ulaşanlar bisbenzimide (Hoechst 33258 DNA boyası ile floresan mikroskop altında belirlenmiştir. Mevcut çalışmada folikül çapının sığır oositlerinin in vitro nükleer olgunlaşması üzerine etkisinin küçük foliküllerden elde edilen oositlerde MII safhasına ulaşmış oositlerin oranı, orta ve büyük foliküllerden elde edilenlerinkinden önemli oranda daha düşük olduğu tespit edilmiştir. İn vitro olgunlaştırma medyumuna 10,0 μg/ml FSH eklenmesinin oositlerin nükleer olgunlaşmadaki başarı oranını 0,5 ve 1,0 μg/ml’ye göre arttırdığı saptanmıştır. Ayrıca yüksek FSH konsantrasyonunun nükleer olgunlaşmadaki iyileştirici etkisi, küçük foliküllerden elde edilen oositlerde daha fazla gözlemlenmiştir. Mevcut çalışmanın sonuçları 3–8 mm çapındaki foliküllerden elde edilen oositlerin daha başarılı bir olgunlaşma sergiledikleri, buna karşın küçük foliküllerden elde edilen oositlerin yüksek FSH konsantrasyonunda oransal olarak daha yüksek olgunlaşma başarısı sergileri saptanmıştır.

  2. Bahar GEDİKa,*, Görkem DÜLGERb

    Directory of Open Access Journals (Sweden)

    Bahar GEDİK

    2015-05-01

    Full Text Available Bu çalışmanın amacı, beş patojenik Candida türü üzerindeki Lavandula stoechas L. ekstrelerinin antimikrobiyal aktivtesini belirlemektir. Test mikroorganizmaları olarak, Düzce Üniversitesi Tıp Fakültesine başvuran hastalardan izole edilmiş olan Candida (Candida albicans, Candida krusei, Candida tropicalis, Candida guilliermondii ve Candida glabrata türleri kullanıldı. Etil alkol, kloroform ve etil asetat ekstreleri, Soxhlet aracılığıyla bitkiden elde edildi. Bu ekstrelerden 25 ul, 50 ul ve 75 ul si steril disklere emdirildi ve anti-candidal aktivite spektrumları test mikroorganizmaları üzerinde disk difuzyon metodu kullanılarak belirlendi. Kontrol grubu olarak, standart antifungal antibiyotikler (Griseofulvin, Fluconazole, Amphotericin B, Miconazole, Nystatin, Flucytosine, Clotrimazole, Ketoconazole, Itraconazole kullanıldı ve sonuçlar karşılaştırıldı. Sonuç itibariyle, L. stoechas L. bitkisiden elde edilen ekstrelerin standart antibiyotiklerle karşılaştırıldığında oldukça etkili anti-candidal bir aktiviteye sahip olduğu ortaya çıktı. Sonuçlarımıza göre, L. stoechas L. ekstrelerinden elde edilen anti-candidal aktivite standart antifungal antibiyotiklerden çok daha fazladır. Bu yüzden, bu durum bitkinin etnobotanik kullanımını desteklemektedir. Buna ilaveten, alternatif tıpta yaygın olarak kullanılan bitkinin potansiyel ekstreleri gelecekte Candidemia tedavisi için de kullanılabilecektir

  3. RL yükünü besleyen 6 anahtarlı 3-seviyeli evirici tasarımı

    Directory of Open Access Journals (Sweden)

    Ali Saygın

    2016-10-01

    Full Text Available Bu çalışmada, çok-seviyeli evirici topolojilerine alternatif bir topoloji verilmiştir. Bu evirici topolojisinde 6 adet IGBT yarıiletken anahtar kullanılmış ve eviricinin her bir çıkış uçlarına çift sarımlı bobinler bağlanmıştır. Bobin gerilimleri kullanılarak 6 anahtar ile 3 seviyeli evirici elde edilmiştir. Yapılan simülasyon çalışmasında Proportional Integral (PI denetleyici kullanılmıştır. Denetleyiciden elde edilen veriler kullanılarak 6 anahtarlı 3-seviyeli eviricideki yarıiletken anahtarların çalışması için gerekli sinyaller üretilmiştir. Bu sinyaller, uzay vektör darbe genişlik modülasyon tekniği ile elde edilmiştir. Bilgisayar ortamında 10 Ω ve 0.2 H değerinde RL yük esas alınarak benzetim çalışmaları yapılmış ve evirici performansı incelenmiştir.

  4. BİLYALI RULMAN YUVARLANMA ELEMANI KUSURUNUN TİTREŞİM ANALİZİ YÖNTEMİYLE İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Hakan ARSLAN

    2007-02-01

    Full Text Available Bu çalışmada, titreşim analizi yöntemi kullanılarak radyal bilyalı rulman yuvarlanma elemanındaki bölgesel bir yüzey kusurunun etkisi analitik ve deneysel olarak incelenmiştir. Bu amaçla bilyalı rulman yuvarlanma elemanı çalışma yüzeyinde yapay bir bölgesel kusur oluşturulmuş ve radyal yöndeki mil titreşimleri kaydedilmiştir. Analitik inceleme için, teorik bir model oluşturulmuş ve bu modele göre sağlam ve kusurlu durumdaki rulmanları analiz edebilen bir simülasyon programı geliştirilmiştir. Bu simülasyon programı, deney setinde kullanılan mil ve rulman boyutları girilerek çalıştırılmış ve farklı mil hızları için milin titreşim spektrumları elde edilmiştir. Analitik ve deneysel yolla elde edilen titreşim spektrumları karşılaştırıldığında her iki durumda da benzer sonuçlar elde edilmiştir.

  5. Aısı 1040 Çeliğinin Aşındırıcı Su Jeti İle tornalama İşleminde İşleme Paremetrelerinin Talaş Kaldırma Hacmine Ve Kesme Derinliğine Etkisi

    Directory of Open Access Journals (Sweden)

    Fuat Kartal

    2014-01-01

    Full Text Available Bu çalışmada, AISI 1040 çeliğinin aşındırıcı su jeti ile tornalanması esnasında işleme parametrelerinin kaldırılan talaş hacmime ve kesme derinliğine etkisi araştırılmıştır. Yapılan çalışmada deney sayısının en az olması için literatürde yapılmış olan çalışmalar göz önüne alınmış ve ön deneyler sonucu elde edilen tecrübelerle en uygun işleme parametre değerleriyle deneyler gerçekleştirilmiştir. Deneysel çalışmalarda pompa basıncı (350 MPa, aşındırıcı boyutu (Garnet formunda ve boyutu 80 mesh ve nozul çapı (1.2 mm sabit tutulmuştur. Ø 30 ve 240 mm ebatlarında 1040 çeliği, dört farklı aşındırıcı akış oranı (50, 150, 250 ve 350 gr/dak., nozul mesafesi (2, 5, 8 ve 11 mm, nozul ilerleme miktarı (5, 15, 25 ve 35 mm/dak. ve torna aynası deviri (25, 50, 75 ve 100 dev/dak. işleme parametreleri değerlerinde işlenmiştir. Elde edilen bulgulara göre en yüksek talaş hacmi 5 mm/dak nozul ilerleme miktarında 1387,25 mm3 elde edilmiştir. En yüksek kesme derinliği ise 0,94 mm olarak 100 dev/dak torna aynası devrinde elde edilmiştir.

  6. Değişik kalitedeki sulama sularının soya fasulyesi verimine etkisi

    OpenAIRE

    YURTSEVER, Engin

    1989-01-01

       Bu araştırmada, Calland çeşidi soya fasulyesi (Glycine max) ile tarla koşullarında, 4 sulama suyu tuz luluğu (0.6, 1.5, 2.5 ve 5.0 dS m-1)ve 3 yıkama gereksini mi yüzdesi (%0, 25 ve 50) konularında faktöriyel düzende iki yıl süre ile denemeler yapılmıştır. Elde edilen bul gular, tane verimi, bitki su tüketimi, tane fiziksel ve kimyasal kalite özellikleri ve sulama suyu tuzluluğunun toprak tuzlulaşmasma etkisi konularında değerlendiril miştir. Sulama suyu tu...

  7. TÜRKİYE’DE PARA ARZI, FAİZ ORANI VE HİSSE SENEDİ FİYATLARI ARASINDAKİ NEDENSEL İLİŞKİLERİN ANALİZİ

    OpenAIRE

    Serpil TÜRKYILMAZ; Özata, Erkan

    2009-01-01

    Bu çalışmada, Türkiye’de 2001:05-2005:12 dönemi için Para Arzı (M1), Faiz Oranları ve Hisse Senedi Fiyatları arasındaki dinamik ilişkiler incelenmiştir. Bu amaçla, bir Standart VAR Modeli altında, Granger Nedensellik Testi ile değişkenler arasındaki nedensellik ilişkilerinin yönü belirlenmeye çalışılmış, Para Arzı’ ndan Hisse Senedi Fiyatları’ na doğru tek yönlü bir nedensellik ilişkisi bulunmuştur. Standart VAR modeli yardımıyla elde edilen Etki- Tepki Analizi ve Varyans Ayrımlaştırma Analiz...

  8. Süt dişlerinde restoratif materyal seçimi ve etkileyen faktörler

    OpenAIRE

    MUTLUAY, Merve Safa

    2016-01-01

    Son yıllarda, çürüklü süt dişlerinin restorasyonunda kullanılan materyallerde yeni gelişmeler elde edilmiştir. Süt ve karışık dişlenme döneminde estetik özellikleri nedeniyle sıklıkla tercih edilen cam iyonomer siman, rezin modifiye cam iyonomer, poliasit modifiye kompozit rezin (kompomer) ve kompozit rezin gibi materyaller günden güne geliştirilmektedir. Süt dişlenmede diş renginde restoratif materyallerin kullanımı, düşük başarısızlık oranlarıyla birlikte konservatif kavite preperasyonları ...

  9. FUZEL YAĞINDAN İZOAMİL ASETAT ÜRETİMİ

    OpenAIRE

    GÜVENÇ, Afife; AYDOĞAN, Özlem; KAPUCU, Nurcan; Ülkü MEHMETOĞLU

    2013-01-01

    Fermentasyonla üretilen etanolün damıtma ile ayırılması sonucunda yan ürün olarak elde edilen fuzel yağı, bazıdeğerli alkolleri içermektedir. Bu düşük molekül ağırlıklı alkoller ve bunların asetat esterleri endüstridekullanılan önemli bileşenlerdir. Özellikle, izoamil asetat tat ve koku bileşeni olarak, gıda, ilaç ve kozmetikendüstrilerinde katkı maddesi olarak ekonomik değere sahiptir. Bu çalışmada, ülkemizde etkin olarakdeğerlendirilemeyen bir yan ürün olan fuzel yağı kullanılarak kuvvetli ...

  10. Antalya Körfezi ve civarındaki sert substratumda dağılım gösteren Polyplacophora ve Gastropoda türleri

    OpenAIRE

    Banu Bitlis Bakır; Bilal Öztürk

    2016-01-01

    Bu çalışma, Türkiye’nin Levant Denizi kıyılarında yer alan Antalya Körfezi ve civarında dağılım gösteren Polyplacophora ve Gastropoda türlerini tespit etmek için gerçekleştirilmiştir. İncelenen bentik materyal, kuadrat örnekleme yöntemiyle supralittoral ve mediolittoral zonların derinliklerinde yer alan kayalık, kırmızı alg ve kahverengi alglerden oluşan biyotop yapısına sahip, 14 farklı istasyondan alınmıştır. Elde edilen materyalin incelenmesi sonucunda Polyplacophora ve G...

  11. KLİNİK VE BİLİMSEL ARAŞTIRMALARDA ETİK KURALLAR

    OpenAIRE

    Esenlik, Elçin; Bolat, Esra

    2011-01-01

    Özet Klinik ve bilimsel çalışmalardan elde edilen sonuçların topluma duyurulması önemli bir husustur. Bilim hayatının ortaya çıkarttığı ürünlerin hatalı ve yanıltıcı olması tüm toplumu etkileyebilir. Bu durumdan kaçınmak için, bilimsel çalışmalar etik ilkeler tarafından düzenlenmektedir. Bu derlemede; bilimsel çalışmalar ve bunların sağlık alanındaki izdüşümleri olan klinik araştırmalar ve bu araştırmalarda uyulması gereken etik kavramlar ve kurallar hakkında bilgi verilecek, etik ihl...

  12. Van Bölgesi Keçilerinde Parainfluenza Virus – 3 (PIV-3) ve Bovine Herpesvirus-1 (BHV-1) Enfeksiyonlarının Seroprevalansı

    OpenAIRE

    ATASEVEN, Veysel Soydal; BAŞARAN, Zeynep; YILMAZ, Volkan; DAĞALP, Seval Bilge

    2010-01-01

    Bu çalışmada, Van merkez ve ilçelerinde yetiştirilen keçi sürülerinden alınan 407 adet kan serum örneğinde bovine herpesvirus-1 (BHV-1) ve parainfluenza virus-3 (PIV-3) spesifik antikorlarının varlığı virus nötralizasyon (VN) testi ile araştırıldı. Serum örneklerinin 21 adedinde (%5.2) PIV-3 ve 3 adedinde (%0.7) BHV-1’e karşı spesifik antikor varlığı tespit edildi. Elde edilen veriler, Van ilindeki yerli ırk keçilerde PIV-3 ve BHV-1 enfeksiyonlarının varlığını ortaya koymaktadır...

  13. ÜLKE RİSKİNİN HİSSE SENEDİ GETİRİSİNE ETKİSİ: Ampirik Bir Analiz

    OpenAIRE

    Ayaydın, Hasan; PALA, Fahrettin; Barut, Abdülkadir

    2016-01-01

    ÖZET Bu çalışmanın amacı ülke riskinin hisse senedi fiyatları üzerindeki etkisini incelemektir. Son dönemlerde çalışmalarda sıklıkla kullanılan ve güvenilirliği kabul edilmiş ICRG (International Country Risk Guide) tarafından hesaplanan ekonomik risk, politik risk, finansal risk ve ülke riski değişkenleri ile BİST 100 endeksi getirisi arasındaki ilişki, 2002:M1- 2015:M15 aylık dönemleri için Zaman Serileri Analizi ile test edilmiştir. Araştırmadan elde edilen bulgulara göre; hisse senedi geti...

  14. Measurement of The Spectroscopic Properties of Benzoic Acid-Solvent Systems By Uv-Spectrophotometry

    OpenAIRE

    Tekin, Nalan

    2003-01-01

    Bu çalışmada, dissosiasyon ortamında benzoik asit çözeltilerinin sıcaklık ve konsantrasyon ile dissosiasyon özelliklerinin değişimi UV-VIS Spektrofotometrik yöntem ile incelenmiştir. Her çözelti sistemi için, farklı sıcaklıklarda konsantrasyon, c, ve absorbans, A, arasındaki ilişkiler belirlenmiştir. Elde edilen sonuçlar, benzen, etil alkol, n-propil alkol, iso-propil alkol and N,N-dimetilformamid çözücüleriyle hazırlanan çözeltiler için Lambert-Beer yasasının sırasıyla 1.00x10-3M to 6.25x10-...

  15. Düzce İli Atmosferinin Polen ve Spor Dağılımının İncelenmesi

    OpenAIRE

    Serbes, Ayşe Belgin; Kaplan, Ayşe

    2014-01-01

    Bu çalışma 1 Ocak 2006 / 1 Ocak 2007 tarihleri arasında Düzce ili havasında yapılan bir yıllık aeropalinolojik çalışma olup, polen ve sporların neden olduğu alerjik hastalıkların teşhis ve tedavisinde hekimlere yardımcı olmayı amaçlamaktadır. Düzce ili Yimpaş A.Ş binası üzerine yerleştirilen iki farklı Durham cihazı kullanılarak Gravimetrik yöntemle elde edilen preparatlar incelenmiştir. Düzce ili atmosferindeki polen ve sporların hangi taksonlarına ait oldukları saptanmış ve morfolojik tanım...

  16. Ulex europaeus Lektininin Kan Grubu Bağlama Özgüllüğü

    OpenAIRE

    ATEŞ, Ali; ÖZGÜR, Yeşim

    2002-01-01

    Bu çalışmada, Ulex europaeus bitkisinden elde edilen Ulex europaeus Aglutinin-I (UEA-I)’in insan kan grubu bağlama özgüllüğü ölçüldü. Bu deney için U tabanlı mikrotitrasyon kabı kullanıldı. 50µg/ml lektin çözeltisi, PBS (phosphate buffered saline) ile hazırlanarak başlangıç konsantrasyonu olarak alındı ve UEA-I’in seri sulandırılması ile insan kan grubu özgüllüğü belirlendi. Sonuç olarak, UEA-I’in %2’lik A grubu eritrositlerini 25µg/ml konsantrasyonda, B grubu eritrositlerini 6.25µg/ml konsan...

  17. PROPİYONİK ASİT-SU-ÇÖZÜCÜ (n-AMİL ALKOL VE n-AMİL ASETAT) ÜÇLÜ SİSTEMLERİNİN SIVI-SIVI DENGELERİ

    OpenAIRE

    ÖZMEN, Dilek

    2005-01-01

    Propiyonik asit-su-n-amil alkol ve propiyonik asit-su-n-amil asetat üçlü sistemlerine ait sıvı-sıvı dengeleri 25 oC'de izotermal şartlarda incelenmiştir. Elde edilen bağlantı doğrusu verilerinin doğruluğu Othmer-Tobias ve Hand korelasyonları kullanılarak test edilmiştir. Deneysel verilerden yararlanarak dağılma katsayıları ve ayırma faktörleri hesaplanmıştır. İncelenen her bir sisteme ait denge verileri, UNIFAC metodu ile de hesaplanmıştır. Deneysel denge verileri ve UNIFAC metodu ile bu...

  18. Bağlarbaşı-Tekke (Gümüşhane) karayolundaki kaya şevlerinin kinematik ve limit denge yöntemleri ile değerlendirilmesi

    OpenAIRE

    Alemdağ, Selçuk; Gürocak, Zülfü; Özkirişci Oktay, Ceren

    2015-01-01

    Kinematik analiz yöntemi, kaya şevlerinde düzlemsel, kama ve devrilme gibi yenilmeleri değerlendirmek için yaygın olarak kullanılan analiz yöntemlerinden birisidir. Bu yöntemde, olası yenilme tiplerini belirlemek için şev ve süreksizliklerin yönelimleri ile süreksizliklerin içsel sürtünme açıları kullanılır. Ancak, kinematik analizlerden elde edilen sonuçların güvenirliği optimum şev tasarımı için yeterli değildir. Bu nedenle, kinematik analiz sonuçlarının limit denge analizleri veya...

  19. FEN LABORATUARLARININ İŞLEVSELLİĞİNİN İLKÖĞRETİM OKULLARINDA DEĞERLENDİRİLMESİ

    OpenAIRE

    YILAYAZ, Ömer; TURAN, Mehmet; BAHŞİ, Muammer

    2009-01-01

    Bu araştırmada, ilköğretim okullarındaki fen laboratuarlarının işlevselliğine ilişkin öğrenci görüşlerinin belirlemesi amaçlanmıştır. Bu amaçla 19 maddelik bir anket formu hazırlanmıştır. Çalışma, Fırat Üniversitesi Eğitim Fakültesi Fen ve Teknoloji öğretmenliği bölümünde öğrenim gören 76 öğrenciye (4. sınıf) uygulanmıştır. Anket sonucunda elde edilen veriler, SPSS paket istatistik programında değerlendirilmiştir.

  20. Doğumsal ve Edinsel Penis Kısalığında Penis Uzatılması

    OpenAIRE

    Şengezer, Mustafa; ÖZTÜRK, Serdar; Deveci, Mustafa

    1999-01-01

    Bu makalede penis kısalığı olan hastaların tedavisinde uygulanan penis uzatma işlemi ve elde edilen sonuçlar sunulmaktadır. Bu çalışmada; 3 ateşli silah yaralanması, 4 sünnet hatası, 1 köpek ısırması ve 6 hipospadias sonucu penis kısalığı bulunan olgular değerlendirildi. Tüm olgulara penisin suspansuvar ligamanının kesilmesi ve suprapubik cildin ters V-Y plasti ile uzatılması tekniği ile penis uzatılması operasyonu uygulandı. Penis uzunlukları bazı olgularda penis tam ereksiyonda iken, bazıla...

  1. Karma Yemlerde Aflatoksin Oluşum Potansiyeli

    OpenAIRE

    Sert, Selahattin

    2014-01-01

    Aspergillus parasiticus ile aşılanan steril besi, süt ve yumurta karma yemlerinde aflatoksin oluşum potansiyeli araştırılmıştır. Örnekler A. parasiticus sporlarıyla aşılanmış ve %85 nisbi nemde, 25 oC de 1, 3, 5 hafta depolanmışlardır. Bu süreler sonunda ince tabaka kromatografisi yöntemi ile yapılan analizlerde sırasıyla, besi yeminde; 9427, 3904, 1286 mg/kg, süt yeminde; 11367, 3884, 4639 mg/kg, yumurta yeminde; 3047, 8381, 3134 mg/kg aflatoksin (B1±G1) tespit edilmiştir. Elde edilen bu değ...

  2. Döviz Kuru Belirsizliğinin İhracata Etkisi: Türkiye İçin Bir Uygulama

    OpenAIRE

    Recep TARI; YILDIRIM, Durmus Çağrı

    2014-01-01

    Bu çalışmada Türkiye’de döviz kuru belirsizliği ve ihracat hacmi arasındaki ilişki 1989:Q1 ile 2007:Q3 dönemi arasında üç aylık veriler kullanılarak araştırılmıştır. Elde edilen ampirik sonuçlara göre, inceleme dönemi için döviz kuru belirsizliği uzun dönemde ihracat hacmini negatif etkilerken kısa dönemde döviz kuru belirsizliğinin ihracat hacmi üzerinde etkiye sahip olmadığı görülmüştür

  3. Çok Boyutlu Yoksulluğun Sınıfsal Analizi: Mersin-Erzurum Örneği

    OpenAIRE

    GÜL, Zafer Barış; ZANBAK, Mehmet

    2014-01-01

    Bu çalışmada öncelikle çok boyutlu yoksulluk temelinde Mersin ve Erzurum illerindeki sosyoekonomik sınıfların yoksulluk hesaplamaları yapılmakta, ardından elde edilen bulgular ışığında adı geçen illerdeki sınıfların, birbirleriyle karşılaştırılmak suretiyle, yoksullukları analiz edilmektedir. Yoksulluğu ölçmede çok boyutlu hesaplama yöntemi (Alkire ve Foster 2007; 2011a) kullanılmaktayken, sosyoekonomik sınıfların ayrımında Köse, Pınar ve Bahçe (2009) ve Günaydın’ın (2011) teorik varsayımlara...

  4. Kefir Mikroflorası Üzerinde Araştırma

    OpenAIRE

    Ergüllü, Erol; Üçüncü, Mustafa

    2015-01-01

      Çalışmada, çeşitli yörelerden sağlanmış 7 kefir örneğinin mikroflorası araştırılmış ve elde edilen bulgulara göre, kefir mikroflorasında süt asidi bakterileri (Streptokok ve Laktobasiller) ile mayaların çoğunlukta olduğu belirlenmiştir. Bu bakteri türlerinden her birinin kefir oluşumunda ayrı bir yeri bulunmaktadır. Süt asidi bakterileri sütü pıhtılaştırmakta ve bunlardan bazıları da ayrıca uçucu asitler oluşturarak, kefirin tat ve kokusunun meydana gelmesine katkıda bulunmaktadırlar. Mayal...

  5. Kefir Mikroflorası Üzerinde Araştırma

    OpenAIRE

    Ergüllü, Erol; Üçüncü, Mustafa

    2014-01-01

      Çalışmada, çeşitli yörelerden sağlanmış 7 kefir örneğinin mikroflorası araştırılmış ve elde edilen bulgulara göre, kefir mikroflorasında süt asidi bakterileri (Streptokok ve Laktobasiller) ile mayaların çoğunlukta olduğu belirlenmiştir. Bu bakteri türlerinden her birinin kefir oluşumunda ayrı bir yeri bulunmaktadır. Süt asidi bakterileri sütü pıhtılaştırmakta ve bunlardan bazıları da ayrıca uçucu asitler oluşturarak, kefirin tat ve kokusunun meydana gelmesine katkıda bulunmaktadırlar. Mayal...

  6. Gıda endüstrisinde kitosanın kullanımı

    OpenAIRE

    OĞUZHAN YILDIZ, Pınar; YANGILAR, Filiz

    2014-01-01

    Yenilebilir film ve kaplamalar; gıdalarda kalite kayıplarını önlemek ve raf ömrünü uzatmak amacıyla gıdanın yüzeyinde ya da gıda bileşenleri arasında oluşmuş, ince tabakalı, gıdayla birlikte yenilebilen, sentetik olmay an doğal kaynaklardan elde edilen maddelerdir. Bunlardan birisi olan kitosan, çok geniş bir uygulama alanına sahip olması nedeniyle son zamanlarda ilgi odağı haline gelmiştir. Kitosan; yengeç, karides, ıstakoz gibi eklembacaklıların kabuklarında, bazı bakt eri ve mantarların hü...

  7. KİŞİLİK ÖZELLİKLERİNİN YENİLİKÇİLİK EĞİLİMİ ÜZERİNE ETKİSİNİ BELİRLEMEYE YÖNELİK KAMUDA ÇALIŞAN YÖNETİCİLER ÜZERİNDE BİR ARAŞTIRMA

    OpenAIRE

    Bozkurt, Öznur; Meriç, Sağbetullah; Bozkurt, İlhan

    2017-01-01

    Yenilik yapmak veya yeniliklere başkalarını yönlendirmek çevresel unsurlar kadar liderin taşıdığı kişilik özelliklerine de bağlıdır. Bu çalışmada, kişilik özelliklerinin yenilikçilik eğilimine etkisi bir kamu kurumu olan ve hizmet sektöründe faaliyet gösteren öğretmen evi yöneticileri açısından incelenmiştir. Nicel araştırma yöntemlerinden anket tekniği ile veriler toplanmıştır. İl merkezlerinde görev yapan öğretmen evi yöneticilerinden elde edilen verilerin analizi neticesinde araştırmaya ka...

  8. SULU KOŞULLARDA YAZLIK YULAF ÇEŞİTLERİ MİKRO ve MAKRO VERİM DENEMELERİ

    OpenAIRE

    Tosun, F.; Sencar, Ö.; Kırtok, Y.

    2010-01-01

    ÖZET Erzurum Ekolojik koşullarında, yüksek verimli, hastalık ve yatmaya dayanıklı yulaf çeşitlerini belirlemek amacıyla, Amerika Birleşik Devletleri'nden getirilen 22 çeşitle Atatürk Üniversitesi Ziraat Fakültesi Zirai Araştırma Enstitüsü arazisinde 1969-1971 yılları arasında adaptasyon verim denemeleri yapılmıştır.İik yıl (1969) elde edilen sonuçlara göre, talie verimleri yü...

  9. KİLİS 7 ARALIK ÜNİVERSİTESİ ÖĞRENCİLERİNİN KİLİS EKONOMİSİNE KATKISI: 2011-2012 EĞİTİM-ÖĞRETİM YILI ÖRNEĞİ

    OpenAIRE

    SOYSAL, Abdullah; BAKAN, Sumru; ÖZÇALICI, Mehmet; KAYMAZ, Yunus; SÖYLEMEZ, Cevat

    2012-01-01

    Üniversiteler bulundukları bölgelerin eğitim ve öğretim ihtiyacını karşılamakla beraber, kuruldukları yerlerin ekonomik olarak kalkınmasını da sağlamaktadırlar. Bu anlamda üniversiteler, kuruldukları ve henüz gelişmesini tamamlamamış olan şehirlerin ekonomilerinde özellikle hizmet sektörünün gelişmesine, doğrudan ve dolaylı katkılar sağlamaktadır. Bu çalışmada Kilis 7 Aralık Üniversitesi’nde öğrenim gören öğrenciler üzerinde uygulanan ankete göre elde edilen veriler SPSS istatistik programı i...

  10. Sodyum Akrilat Esaslı Hidrojel ve Kriyojellerin Şişme, Adsorpsiyon ve Mekanik Özelliklerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Ayça Bal

    2014-07-01

    Full Text Available Bu çalışmada, sodyum akrilat esaslı hidrojel ve kriyojellerin şişme davranışları (şişme kapasitesi, denge şişme değeri ve şişme kinetiği, boyar madde (metilen mavisi adsorpsiyonu ve mekanik özellikleri karşılaştırmalı olarak incelenmiştir. Kinetik paramatreler, doğrusal ve doğrusal olmayan metotlar kullanılarak belirlenmiştir. Buna ek olarak, kriyojel ve hidrojel yapıların yüzey morfolojileri, taramalı elektron mikroskobu (SEM kullanılarak karakterize edilmiştir. Analizlerden elde edilen tüm sonuçlar karşılaştırmalı olarak değerlendirilmiştir.

  11. Wave Energy and Technical Potential of Turkey

    OpenAIRE

    Mustafa SAĞLAM; SULUKAN, Egemen; UYAR, Tanay Sıdkı

    2015-01-01

    Ekonomik olduğu sürece, üç tarafı denizlerle çevrili olan Türkiye, mevcut dalga hareketi potansiyelinden en üst seviyede fayda sağlamalıdır. Bu makalede, mevcut Türk Enerji Programına dalga enerji sistemlerinin entegrasyonunun sunulmaktadır. Türk kıyılarında birçok mevkide yaklaşık dalga enerji yoğunluğu hesaplamak için gerekli veri MEDCOAST Yayınlarının “Türk Sahilleri Rüzgar ve Derin Su Dalga Atlası”ndan elde edilen veri, "RETScreen ® International” tarafından geliştirilen “Küçü...

  12. Relative efficiencies of the Burkard 7-Day, Rotorod and Burkard Personal samplers for Poaceae and Urticaceae pollen under field conditions

    DEFF Research Database (Denmark)

    Peel, Robert George; Kennedy, Roy; Smith, Matt

    2014-01-01

    Introduction: In aerobiological studies it is often necessary to compare concentration data recorded with different models of sampling instrument. Sampler efficiency typically varies from device to device, and depends on the target aerosol and local atmospheric conditions. To account for these di...

  13. Time-dependent restricted-active-space self-consistent eld theory: Formulation and application to laser-driven many-electron dynamics

    DEFF Research Database (Denmark)

    Miyagi, Haruhide; Madsen, Lars Bojer

    We have developed a new theoretical framework for time-dependent many-electron problems named time-dependent restricted-active-space self-consistent field (TD-RASSCF) theory. The theory generalizes the multicongurational time-dependent Hartree-Fock (MCTDHF) theory by truncating the expansion...... at a specific excitation level. In a numerical application to laser-driven electron dynamics of the one-dimensional beryllium atom, the TD-RASSCF method performs accurately while largely reducing the computational complexity compared to the MCTDHF method....

  14. Assessing enclosure design and husbandry practices for successful keeping and breeding of the Burmese brow antlered deer (Eld's deer, Rucervus eldii thamin) in European zoos.

    Science.gov (United States)

    Wall, Ellis L; Hartley, Matt

    2017-05-01

    The endangered Burmese brow antlered deer (Rucervus eldii thamin) is a medium sized tropical cervid kept in a number of European zoos. Studbook data and anecdotal reports have suggested that this species suffers from poor reproductive success and relatively high neonatal mortality in captivity. Questionnaires were sent to 10 European zoos, holding 91 (20.71.0) deer, in order to record information on husbandry practices and enclosure design. Studbook analysis was performed to determine reproductive success and mortality values at each of the zoos participating in the study. Statistical analysis was carried out to identify any links between husbandry or enclosure design and the population parameters calculated from the studbook. From the nine zoos that were analyzed in this study, no significant differences were found for population parameters between male and female deer. Neonatal mortality was negatively correlated to enclosure size (in males) and enclosure cover (in females). Positive correlations were found between enclosure cover, average temperature and group size with life expectancy, and negative correlations between enclosure visibility and visitor distance with female life expectancy. These results may be useful for informing husbandry guidelines, although further research into stress responses in captivity is recommended for this species to improve their welfare. © 2017 Wiley Periodicals, Inc.

  15. Energy Conservation and Renewable Energy From Sewage Treatment in the UK = Enerji Tasarrufu ve İngilterede Atıksulardan Yenilenebilir Enerji Elde Edilmesi

    Directory of Open Access Journals (Sweden)

    Ali Reza ZIARATI

    2004-01-01

    Full Text Available This paper is an attempt to assess the performance and limitations of Biogas Combined Heat and Power (CHP plants available to the water companies. This includes measuring the capacity of an average Sewage Treatment work (STW for producing sludge and ultimately producing Biogas. It also investigates the amount of electricity produced and the works self-sufficiency in terms of energy utilised.

  16. TÜRKİYE’DE ORDU İLİNDEN ELDE EDİLEN PROPOLİSİN ANTİMİKROBİYAL AKTİVİTESİ

    OpenAIRE

    ERTÜRK, Ömer; Yavuz, Ceren; Sıralı, Recep

    2015-01-01

    Bu çalışmada Türkiye’nin Ordu ilinden propolis örneklerine aseton, etil asetat, kloroform, etanol, metanol, dimetil sülfoksit ve su ekstraklarıyla antimikrobiyal ve antifungal etkiler araştırılmıştır. Propolisin antimikrobiyal aktivitesi propolis türlerine, propolis dozuna ve tüm mikrobiyal organizmalar için ekstraksiyon çözücülerine bağlı olarak değişmektedir. On beş türe ait mikroorganizmalar Staphylococcus aureus, Stereptococcus salivarius, Klebsiella pneumonia, Escherichia coli, Salmonell...

  17. CASPER plus (CollAborative care in Screen-Positive EldeRs with major depressive disorder): study protocol for a randomised controlled trial.

    Science.gov (United States)

    Overend, Karen; Lewis, Helen; Bailey, Della; Bosanquet, Kate; Chew-Graham, Carolyn; Ekers, David; Gascoyne, Samantha; Hems, Deborah; Holmes, John; Keding, Ada; McMillan, Dean; Meer, Shaista; Meredith, Jodi; Mitchell, Natasha; Nutbrown, Sarah; Parrott, Steve; Richards, David; Traviss, Gemma; Trépel, Dominic; Woodhouse, Rebecca; Gilbody, Simon

    2014-11-19

    Depression accounts for the greatest disease burden of all mental health disorders, contributes heavily to healthcare costs, and by 2020 is set to become the second largest cause of global disability. Although 10% to 16% of people aged 65 years and over are likely to experience depressive symptoms, the condition is under-diagnosed and often inadequately treated in primary care. Later-life depression is associated with chronic illness and disability, cognitive impairment and social isolation. With a progressively ageing population it becomes increasingly important to refine strategies to identity and manage depression in older people. Currently, management may be limited to the prescription of antidepressants where there may be poor concordance; older people may lack awareness of psychosocial interventions and general practitioners may neglect to offer this treatment option. CASPER Plus is a multi-centre, randomised controlled trial of a collaborative care intervention for individuals aged 65 years and over experiencing moderate to severe depression. Selected practices in the North of England identify potentially eligible patients and invite them to participate in the study. A diagnostic interview is carried out and participants with major depressive disorder are randomised to either collaborative care or usual care. The recruitment target is 450 participants. The intervention, behavioural activation and medication management in a collaborative care framework, has been adapted to meet the complex needs of older people. It is delivered over eight to 10 weekly sessions by a case manager liaising with general practitioners. The trial aims to evaluate the clinical and cost effectiveness of collaborative care in addition to usual GP care versus usual GP care alone. The primary clinical outcome, depression severity, will be measured with the Patient Health Questionnaire-9 (PHQ-9) at baseline, 4, 12 and 18 months. Cost effectiveness analysis will assess health-related quality of life using the SF-12 and EQ-5D and will examine cost-consequences of collaborative care. A qualitative process evaluation will be undertaken to explore acceptability, gauge the extent to which the intervention is implemented and to explore sustainability beyond the clinical trial. Results will add to existing evidence and a positive outcome may lead to the commissioning of this model of service in primary care. ISRCTN45842879 (24 July 2012).

  18. Altın Fiyatlarının Yapay Sinir Ağları ile Tahmini ve Bir Uygulama

    Directory of Open Access Journals (Sweden)

    Rıdvan YÜKSEL

    2016-03-01

    Full Text Available Bu çalışmada altın fiyatlarını yapay sinir ağları ile öngörmek amacıyla, altın fiyatlarını etkileyebileceği düşünülen değişkenler olan Gümüş fiyatları, Brent Petrol fiyatları, ABD doları/ EUR paritesi, EuroNext100 endeksi, Amerika Dow Jones Endeksi, 13 Hafta vadeli ABD bonosu faiz oranı ve ABD TÜFE endeksi kullanılarak modeller kurulmuştur. Yapay sinir ağları ile kurulan modellerden elde edilen tahmin sonuçları, gerçek değerler ile R2, RMSE, MAE ve MAPE (% gibi performans kriterleri hesaplanarak karşılaştırılmıştır. Elde edilen bulgular yapay sinir ağlarının altın fiyatlarının tahmininde başarı ile kullanılabileceğini göstermektedir. Yapılan duyarlılık analizinin sonuçları değerlendirildiğinde altın fiyatlarını etkileyen faktörlerin başında gümüş ve petrol fiyatlarının geldiği tespit edilmiştir.

  19. Irgıllı beldesi (Denizli yerleşim alanının jeolojik ve jeoteknik özellikleri

    Directory of Open Access Journals (Sweden)

    Suat TAŞDELEN

    2016-06-01

    Full Text Available Yerleşim yeri seçimi ve imar planlarında belirleyici olan jeolojik ve jeoteknik çalışmalar, modern kentleşmenin ilk ve en temel aşamalarından birisidir. İmar amaçlı mikrobölgeleme çalışmaları güvenli bir çevre ve sürdürülebilir bir kalkınma için önemlidir. Bu kapsamda Irgıllı Beldesi’nin (Denizli yerleşime uygunluğu araştırılmıştır. İnceleme alanı, Işıklı Gölü’nün güney kıyısındaki ovada alüvyonal birimler üzerinde bulunmaktadır. Ova, sismik bakımdan aktif kenar fayları ile çevrelenmiştir. İnceleme alanında çeşitli jeoteknik deneyler ile hidrojeolojik çalışmalar yapılmış, elde edilen veriler ışığında inceleme alanı yerleşime uygunluk özellikleri bakımından sınıflandırılmıştır. Elde edilen bulgular ışığında, inceleme alanı içinde kuzeyden güneye doğru daha uygun yerleşim alanı özellikleri belirlenmiştir.

  20. Eğirdir Gölü Mikrobiyoloji Kalitesinin Mevsimsel Değişimi

    Directory of Open Access Journals (Sweden)

    Cafer BULUT

    2016-04-01

    Full Text Available Bu çalışmada Türkiye’nin 2.büyük tatlısu gölü olan Eğirdir Gölü’nün mikrobiyolojik parametrelerinin mevsimsel değişiminin izlenmesi amaçlanmıştır. 2013 yılı içerisinde mevsimsel gerçekleştirilen çalışmada göl üzerinde belirlenen 9 istasyondan alınan su örneklerinde toplam koliform, fekal koliform, Escherichia coli (E. coli ve toplam bakteri analizleri gerçekleştirilmiştir. Çalışma sonucunda göl suyu toplam koliform sayısı 0 ile 34 arasında değişim göstermiştir. Elde edilen değerler limit değerlerin (70 EMS/100 mL altında olduğu belirlenmiştir. Fekal koliformlar yaz döneminde sadece 4.istasyonda,  sonbahar döneminde ise 7. ve 9. istasyonda tespit edilmiştir. Toplam E. coli ise bütün istasyonlarda tespit edilmemiştir. Toplam bakteri sayısı 0 ile 172 kob/100 mL arasında değişim göstermiştir. Elde edilen sonuçlar Yüzeysel Su Kalitesi Yönetimi Yönetmeliği Kıta içi Su Kaynakları Kalite Kriterleri yönüyle değerlendirildiğinde kabul edilebilir değerlerin altında olduğu belirlenmiştir.

  1. THE EFFECT OF WINDOW FUNCTIONS ON THE ARMA MODEL PARAMETERS ESTIMATED BY PORLA METHOD

    Directory of Open Access Journals (Sweden)

    Şaban ÖZER

    2002-02-01

    Full Text Available PORLA metodu ile tahmin edilen ARMA model parametreleri üzerinde pencere fonksiyonlarının etkisi, sunulmuştur. PORLA metotu, izleme ve modelleme problemlerinin bağımsız alt-algoritmalar olarak düşünüldüğü bir algoritma yapısına sahiptir. Bu metotda, ilk olarak durağan olmayan veri izlemesi, giriş/çıkış veri kovaryans blok matrisinin zaman ardışımlı hesaplanması ile gerçekleştirilir. İkinci olarak, modelleme problemi, ARMA modelleme probleminin içerildiği iki-kanallı PORLA metodu ile çözülür. Zamanla hata yayılımı, PORLA metodunda oluşamaz. İsteğe bağlı pencereleme teknikleri, izleme kapasitesini ve hızlıbaşlamayı kontrol etmek için kolayca dahil edilebilir. PORLA metodu ile tahmin edilen ARMA model parametreleri üzerinde pencere fonksiyonlarının etkisini göstermek için, dikdörtgen, üçgen, Bartlett, Hanning, Hamming, üstel, değiştirilmiş Barnwell, Blackman ve Kaiser gibi farklı pencere fonksiyonları kullanılarak elde edilen benzetim sonuçları verilmiştir.

  2. Seyitömer Uçucu Külünün Betonun Basınç Dayanımına Etkisi Üzerine Bulanık Mantık Yaklaşımı

    OpenAIRE

    Tayfun UYGUNOĞLU; Osman ÜNAL

    2005-01-01

    Bu çalışmada uçucu külün betonun basınç dayanımı üzerindeki etkisi bulanık mantık ile modellenmesi araştırılmıştır. Bu yöntem diğer sektörlerde olduğu gibi inşaat sektöründe de son yıllarda önem kazanmaya başlamıştır. Modelleme için Matlab paket programlama dili kullanılmıştır. Bulanık mantık ile modelleme yaklaşımında uçucu kül ikameli betonun 1, 3, 7, 28 ve 56 günlük yaşı, çimento ile ikame edilen 0 (kontrol), 10, 15, 20 ve 25 kg/m3 uçucu kül miktarı ve bunlara göre elde edilen beton numune...

  3. Maceration Carbonique Yöntemiyle Üretilen Kırmızı Şarapların Fenol Bileşikleri Nicelikleri Üzerinde Maserasyon Sıcaklığı ve Süresinin Etkileri

    Directory of Open Access Journals (Sweden)

    Ufuk Yücel

    2015-02-01

    Full Text Available Bu araştırmada salkım halindeki üzümlerin maserasyonu esnasında uygulanan sıcaklık ve süre paremetrelerinin elde edilen şarap­ların fenol bileşikleri nicelikleri üzerine etkileri incelenmiştir. Denemelerde üzümlerin maserasyon süreleri 5 ve 10 gün olarak iki grupta plan­lanmış ve sözü edilen bu iki maserasyon süresinde 1. grup denemelerde 25-30°C'de 2. grup denemelerde ise 20-35°C'de sıcaklık uygulama­ları yapılmıştır. Maserasyon sürelerinin 5 ve 10 gün olarak iki grupta uygulanması şaraplardaki polifenol bileşiklerinin niceliklerinde farklılıkla­ra neden olmuştur. Maserasyon süresinin 5 günden 10 güne çıkması sonucu şaraplardaki toplam polifenol, tanen ve antosiyan nicelikleri art­mıştır. Bu bileşiklerin niceliklerinin artışında 35 °C'de gerçekleştirilen maserasyoniar daha etkili olmuştur.

  4. Altıntop Suyundaki Acılığın Naringinaz Enzimi ile Giderilmesi

    Directory of Open Access Journals (Sweden)

    Zuhal Çeviker

    2015-02-01

    Full Text Available Bu çalışmada MarshSeedless ve Rio Red çeşiti altıntoplardan elde edilen meyve sularındaki acılığın giderilmesi araştırılmıştır. Acılık giderme işlemi farklı naringinaz konsantrasyonlarında (0.25, 0.50, 0.75 ve 1.00 g/L ve farklı sıcaklıklarda (25, 35 ve 40oC gerçekleştirilmiştir. Naringin giderimi, naringinaz miktarı ve sıcaklıktaki artışa paralel olarak artmıştır. Her iki çeşitte de en yüksek naringin giderimi 1 g/L naringinaz konsantrasyonunda 40oC’de ve 6 saatlik inkübasyon sonunda elde edilmiştir. Duyusal değerlendirmede panelistler kontrol örneklerini enzimle muamele edilmiş örneklerden ayırt edebilmişlerdir.

  5. Yoğurt Peyniri Üretiminde Kullanılan Yoğurt Miktarının Peynirin Bazı Özelliklerine Etkisi

    OpenAIRE

    ÖZBEK, Çağla; GÜZELER, Nuray

    2017-01-01

    Yoğurt peyniri kaynayan süte yoğurt ilavesiyle sütün pıhtılaştırılması, pıhtının süzülmesi ve baskılanmasıyla elde edilen geleneksel bir peynir çeşididir. Tarsus ve Hatay’da birbirinden farklı yöntemlerle üretimi gerçekleştirilmektedir. Bu araştırmada süte %20, %30, %40 ve %50 yoğurt ilave edilerek sütün pıhtılaştırılması ile Tarsus’ta kullanılan yöntemle Yoğurt peynirleri elde edilmiştir. Farklı oranlarda yoğurt kullanımının Yoğurt peynirlerinin depolamanın 1. günündeki randıman, pH, titrasy...

  6. Albino Farelerde Bisfenol A Tarafından Teşvik Edilen Genotoksisiteye Karşı Yeşil Kahvenin Koruyucu Rolünün Araştırılması

    Directory of Open Access Journals (Sweden)

    Burhan İŞTAR

    2016-09-01

    Full Text Available Özet. Bu çalışmada gıda ve içecek ambalajlama materyallerinde sıkça kullanılan kimyasal maddelerden biri olan Bisfenol A (BFA’nın Swiss albino farelerde muhtemel fizyolojik ve genotoksik etkileri ile bu etkilere karşı yeşil kahvenin koruyucu rolü araştırılmıştır. Fizyolojik etkiler; canlı ağırlık ve karaciğer-böbrek organ ağırlıklarının ölçümü ile genotoksik etkiler ise; eritrosit ve yanak mukoza epitelyum hücrelerindeki mikronukleus (MN sıklığının, kemik iliği hücrelerinde ise kromozomal hasar oluşumunun tespitiyle değerlendirilmiştir. Fareler her grupta altı (6 hayvan olacak şekilde toplam altı (6 gruba ayrılmış, kontrol grubundaki fareler çeşme suyu, uygulama grubundaki fareler ise yeşil kahvenin 100 mg/kg c.a ve 400 mg/kg c.a dozlarıyla ve BFA’nın 50 mg/kg c.a dozuyla beslenmişlerdir. Sonuçta BFA uygulaması canlı ağırlıklarda ve organ ağırlıklarında istatistiksel açıdan önemli bir azalmaya neden olurken, MN ve kromozomal anormallik sıklığında ise önemli bir artışa neden olmuştur. Yeşil kahve uygulaması ise BFA’nın söz konusu olumsuz etkilerini iyileştirerek, tüm parametrelerde doza bağlı bir iyileşme göstermiştir. BFA’nın belli bir doz eşiğinden sonra toksisiteye sebep olduğu, yeşil kahvenin ise bu toksisiteyi azaltmada etkili bir antioksidant ürün olduğu anlaşılmıştır.Anahtar Kelimeler: Bisfenol A, Fizyoloji, Genotoksisite, Kromozomal Anormallikler, Mikronukleus, Yeşil Kahve Abstract. This study researches into the potential physiologic and genotoxic effects of Bisphenol A, which is one of the most frequent chemical substance used in food and beverage packaging materials, on Swiss Albino mice and the protective role of green coffee against these effects. The study analyzes the physiologic effects by measuring the live weight, liver and kidney weight, whilst determining the genotoxic effects by frequency of micronucles (MN on erythrocyte and buccal mucosal epithelium cells and determining the chromosomal damage on bone marrow cells. Mice used in this research were divided into six groups in total comprising of 6 mice in each group, while the mice in control group were fed with tap water, the mice in treatment group were fed with 100 mg/kg b.w. and 400 mg/kg b.w. doses of green coffee and 50 mg/kg b.w. dose of Bisphenol A. As a result, while application of the Paraben led to an significant statistical decrease in live and organ weights, caused to a significant increase in MN and chromosomal abnormalities frequency. Application of green coffee healed the potential negative effects of Bisphenol A and revealed an important recovery in all parameters depending on doses. It was determined that Bisphenol A induced toxicity after certain dose threshold and green coffee is an effective antioxidant in reducing the toxicity.Keywords: Bisphenol A, Physiology, Genotoxicity, Chromosomal abnormalities, Micronucleus, Green coffee.

  7. E14 fare embriyosundan izole edilen serebellar ve kortikal nörosferler üzerine etanol\\'ün nörotoksik etkisinin değerlendirilmesi

    OpenAIRE

    Mitra, Nilesh Kumar; Krishnan, Kanakeswary; Hiong, Chong Chung; Ding, Yen Nee; Eddie, Hsiao Lung; Sikarwar, Archana

    2012-01-01

    Objectives: Ethanol exposure during pregnancy has toxic effects on the neural stem cells of the developing brain. Differential effects of the alcohol on the neural precursor cells from different regions of the brain have not been established. This study was planned to find out the difference in the morphology of the neurosphere (NS) from the embryonic mouse cortex and cerebellum when exposed to ethanol. The dose of ethanol was comparable to blood alcohol concentration in binge drinking. Ma...

  8. Manyeto-reolojik malzemelere ferromanyetik toz ilavesinin mekanik özelliklere etkisinin deneysel olarak incelenmesi

    Directory of Open Access Journals (Sweden)

    Uğur Mazlum

    2017-08-01

    Full Text Available Ferromanyetik toz partikülleri, manyetik alana duyarlılıklarından dolayı günümüzde pek çok alanda kullanılmaktadır. Bu tozların matris malzemeleri ile birleşimlerinden elde edilen kompozit MRE malzemeler bir tür akıllı (smart malzeme olarak sınıflandırılmaktadır. Bu çalışmada, RTV (room temperature vulcanization silikon kauçuğuna dört farklı manyetik toz ilave edilmesi ile elde edilen kompozit MRE malzemelerinin bası yüklemesi altındaki mekanik özelliklerinin incelenmesi amaçlanmıştır. Matris malzemesi olarak mühendislik açıdan kullanımı yaygın olan Vario 40 silikon kauçuk malzemesi kullanılmıştır. Kompozit MRE malzemelerde toz oranı hacimce %30 oranında tutulmuştur. Ayrıca, tozların yönlenmesinin etkisini incelemek için, üretim esnasında bazı numunelere dış manyetik alan uygulanmıştır. Bu numuneler anizotropik olarak adlandırılırken diğerleri izotropik numunelere olarak adlandırılmıştır. Sonuçlar göstermiştir ki; anizotrop MRE numuneler izotrop numunelere göre çok daha yüksek gerilme değerlerine sahip olmaktadır ve en büyük gerilme artışı BASF CN tozu ilave edilen anizotrop MRE malzemeler için elde edilmiştir. Ayrıca, numuneler MR etki açısından da değerlendirildi ve izotropik versiyonlarına göre %201 gibi bir artış değeri ile en büyük MR etki SQ-I tozu içeren anizotrop numunelerde gözlemlendi. Sonuç olarak, gerçekleştirilen çalışma ile MRE malzemelerin mekanik ve MR özellikleri, ilave edilen tozun cinsi ve manyetiklik özelliklerine ciddi bir şekilde bağlı olduğu belirlenmiştir.

  9. Kültür Koşullarında Levrek (Dicentrarchus labrax L., 1758 Larvalarında Ağız Bölgesinin Osteolojik Gelişimi.

    Directory of Open Access Journals (Sweden)

    Deniz Çoban

    2015-12-01

    Full Text Available Levrek larvalarında 0-42. günler arasında yoğun yetiştiricilik koşulları altında ağız boşluğunda çeneye ait elementlerin kıkırdak ve kemik gelişimleri incelenmiştir. Örnekler çalışma boyunca üç günde bir olacak şekilde elde edilmiş ve çalışma canlı yeminkesilmesi ile sonlanmıştır. Elde edilen örnekler formalinde sabitlendikten sonra alcian mavisi ve alizarin kırmızısı ile boyandı. Yumurtadan çıkan larvada ağza ait bir osteolojik oluşum tespit edilmemiştir. İlk oluşan element 3,8 mm total boyda (TB Meckel’s kıkırdağıdır. Bu oluşumu 4,6 mm TB’da trabecular bar, palato-quadrate ve hyosymplectic takip eder. 5,4 mm TB’da basibranchial, hyoid bar, maksillary ve branchial sepet oral boşluğun altında meydana gelmiştir. 7,9 mm TB’da dişe ait yapıların ilk işareti olan premaksillary oluşumu gözlenmiştir. 11,4 mm TB’da premaksillary ve dentary kıkırdak yapıda olup henüz kemikleşme başlamamış olup her ikisinde de bir sıra diş tespit edilmiştir. 15,8 mm TB’da premaksillary ve dentarynin uç bölgelerinde kemikleşme başlamıştır. Bu çalışmadan elde edilen sonuçlar diğer teleostlar ile karşılaştırılmış ve benzer bulgulara rastlanmıştır

  10. Görüntü İşleme Tekniği ile Beton Basınç Dayanımının Tahmin Edilmesi

    Directory of Open Access Journals (Sweden)

    Celalettin BAŞYİĞİT

    2014-07-01

    Full Text Available Bu çalışmanın amacı, beton sınıflarının görüntü işleme tekniği kullanılarak tahmin edilmesidir. Bu amaçla 0,69, 0,54 ve 0,42 olmak üzere 3 farklı S/Ç oranı kullanılarak farklı dayanım sınıfında betonlar üretildi. Elde edilen numuneler üzerinde, özgül ağırlık, su emme ve boşluk oranı, ultrases geçiş hızı, basınç dayanımı deneyleri gerçekleştirildi. Ayrıca görüntü işleme teknikleri kullanılarak çözümlemeler yapıldı. Görüntü işleme yöntemi kullanarak elde edilen sonuçlar ile üretilen betonların basınç dayanımları arasındaki ilişkiler irdelendi. Sonuç olarak kullanılan görüntü işleme tekniği ile beton içerisindeki agrega ve çimento matrisi yüzdelerinin elde edilebildiği ve bu değerler kullanılarak beton basınç dayanımlarının R²=0,9845 düzeyinde yüksek bir ilişkililik ile tahmin edilebildiği sonucuna varıldı. Bu çalışma, betonların görüntü işleme tekniği kullanılarak basınç dayanımlarının tahmin edilmesinde yardımcı olacaktır.

  11. Pedikül vidasının yerleşim konumuna göre yorulma davranışının sonlu elemanlar yöntemiyle incelenmesi

    Directory of Open Access Journals (Sweden)

    Levent Uğur

    2016-08-01

    Full Text Available İnsan vücudunda en sık ağrı genellikle sırt bölgesinde yaşanır. Yapılan istatistikler birçok insanların yaşamının bir noktasında sırt ağrısı yaşadıklarını göstermektedir. Şiddetli bel ve sırt ağrısı tedavisinde yaşanan ağrıyı azaltmak ve omurganın doğal hareket aralığın geri yüklemek için cerrahi tedavi gerekebilir. Pedikül vidalar yaygın olarak omurgada çeşitli fiziksel bozuklukların tedavisinde kullanılmaktadır. Ancak, vidanın omurganın karmaşıklığı nedeniyle yanlış açılarda konumlandırılması vidaya daha fazla yük gelmesine sebep olmakta ve malzeme yorulması nedeniyle vidalarda hasar meydana gelmektedir. Bu çalışmada, sonlu eleman analizi ile pedikül vidasının omurga cerrahisi sırasında optimal konum ve açıda takılması için vidalarda meydana gelen yorulma olaylarını belirlemek amaçlanmıştır. Bilgisayarlı tomografi (BT görüntülerinden elde edilen ham datalar işlenerek üç boyutlu vertebra modeli elde edilmiştir. Vertebra modelinde sagittal eksene göre 27° ve 40° açılarda pedikül vidaları yerleştirilmiştir. Pedikül vidası üç boyutlu katı modelleri, üretici firma kataloglarından elde edilen parametrik değerler kullanılarak Solidworks programında çizilmiş ve üç boyutlu pedikül vidası ve vertebra modelleri, 2 farklı açı ile Solidworks programında montajı yapılmıştır. Elde edilen model, sonlu elemanlar tabanlı ANSYS programına aktarılarak, normal duruş pozisyonunda vertebra yüzeyine gelen yükler uygulanmıştır. İmplant malzemesi olarak literatürden elde edilen Ti-6AL-4V titanyum özellikleri ve S-N grafiği ANSYS programına girilmiştir. Pedikül vidasının vertebra içindeki konumlarına göre ortalama gerilme ve yorulma davranışı karşılaştırılmıştır. Sonlu elemanlar analizleri sonucunda pedikül vidasının konumu vertebranın orta eksenine yakın kortical rim bölgede ortalama gerilme sırasıyla 554

  12. Farklı Eğim Açılarındaki Fotovoltaik Panellerin Elektriksel Ölçümlerinin Raspberry Pi ile İzlenmesi

    Directory of Open Access Journals (Sweden)

    Harun ÖZBAY

    2016-03-01

    Full Text Available Güneş enerjisinden elektrik enerjisi elde etmek için fotovoltaik (FV paneller kullanılmaktadır. FV panellerden elde edilen enerji, panellerin kurulduğu coğrafi konuma, mevsimsel değişimlere ve çevre koşullarına göre sürekli olarak değişiklik göstermektedir. Dolayısıyla FV panellerden maksimum güç elde edilmesi amacıyla panellerin optimum eğim açısının aylık, mevsimsel ve yıllık olarak değiştirilmesi gerekir. Bu çalışmada, farklı açılarda yerleştirilen FV paneller ile Bilecik ilinde güneş enerjisinden elde edilecek maksimum gücün hangi eğim açılarında gerçekleştiğinin tespiti için verilerin toplanması, kayıt altına alınması ve analiz çalışmaları Raspberry Pi (RPi üzerine kurulu web sunucu aracılığı ile gerçekleştirilmiştir. Bu amaç doğrultusunda FV panellerin gerilimleri gün boyunca ölçülmektedir. Ölçülen veriler analog-dijital dönüştürücü (mikrodenetleyici ile sayısal bilgiye çevrilmektedir. RPi ile sayısal bilgilerin her 10 dakikada bir ortalaması alınarak kendi hafıza ortamında saklama işlemi gerçekleştirilmektedir. Aynı zamanda RPi’ye kurulan Linux temelli Raspbian işletim sisteminde oluşturulan betik yardımıyla ve web ara yüzünden aynalama işlemi yapılarak verilerin bilgisayar ortamına kaydedilmesi ile yedekleme işlemi gerçekleştirilmektedir. Farklı eğim açılarındaki FV panellerden elde edilen elektriksel ölçümler RPi üzerine kurulu web sunucu aracılığıyla günün her saatinde canlı olarak izlenebilmektedir. Ayrıca elektriksel veriler aylık ve yıllık olarak tarih ve zaman bilgileri ile kayıt altına alınmaktadır. Geliştirilen sistemin kullanıcı ara yüzüne http://solar.bilecik.edu.tr adresinden ulaşılabilmektedir.

  13. Dicty_cDB: VFB160 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VAAKISDSDKSTIESETESVLK WLESNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVD ELD*rnfseenisik*is*ki***inkll...VAAKISDSDKSTIESETESVLK WLESNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVD ELD*rnfseenisik*is*ki***inkll

  14. YÖNETİCİLERİN DEMOGRAFİK ÖZELLİKLERİ İLE LİDERLİK TARZLARI ARASINDAKİ İLİŞKİ: İSTANBUL’DAKİ BEŞ YILDIZLI OTELLER ÜZERİNDE BİR ARAŞTIRMA

    Directory of Open Access Journals (Sweden)

    Derman KÜÇÜKALTAN

    2014-01-01

    Full Text Available ÖzetEtkili liderlik, yoğun rekabet ortamı içerisinde faaliyet gösteren otel işletmelerinin de ihtiyaç duydukları bir kavramdır. Liderliği etkileyen faktörlerden bir tanesi de demografik özelliklerdir. Bu bağlamda çalışmanın amacı; yöneticilerin demografik özellikleri ile benimsenen liderlik tarzları arasındaki ilişkiyi ortaya koymaktır.Bu amaçla oluşturulan anket, İstanbul’daki beş yıldızlı otel işletmelerinin genel müdürleri ile departman müdürleri üzerinde uygulanmıştır. Elde edilen veriler SPSS paket programı kullanılarak değerlendirilmiştir. Anket içerisindeki Likert ölçekli sorularda alt boyutların belirlenmesi için faktör analizi yapılmıştır. Elde edilen alt boyutların, yöneticilerin demografik özelliklerine göre bir farklılık gösterip göstermedikleri Mann-Whitney U ve Kruskal- Wallis testleri ile sınanmıştır. Farklılık gözüken maddelerde farkın nereden kaynaklandığını bulmak amacıyla Tukey testi uygulanmış ve elde edilen sonuçlar üzerinde yorumlar yapılmıştır. Üç liderlik tarzını birden etkileyen herhangi bir demografik özellik bulunmamakla birlikte, bazı değişkenlerin liderlik tarzları ile anlamlı bir ilişki içerisinde olduğu görülmüştür.AbstractEffective leadership has become a notion that is needed by the hotel enterprises which function in a competition-intensive sector. Demographic characteristics are one of the factors which affect leadership most. In this context; the purpose of this study is to display the relationshipbetween the managers’ demographic characteristics and adopted leadership styles. The questionnaire that has been developed for this purpose, has been implemented on the general managers and departmental managers of the five star hotels in Istanbul. The gained data has been evaluated by SPSS. Factor analysis has been done to determine the sub-dimensions in Likert scale questions. The sub-dimensions have been

  15. The Relationship between Spatial Skill and Spatial Anxiety: A Research on Pre-Service Primary-School Teachers [Uzamsal Beceri ve Uzamsal Kaygı Arasındaki İlişki: Sınıf Öğretmeni Adayları Üzerine Bir Araştırma

    Directory of Open Access Journals (Sweden)

    Mehmet Hayri Sarı

    2016-12-01

    Full Text Available The aim of this study was to investigate the relationship between the spatial skills and anxiety levels of pre-service primary-school teachers. Gender that was considered as an important variable on spatial ability and spatial anxiety was also taken into account in the study. Totally 267 pre-service primary-school teachers studying at the third grades of totally four universities including two in the province and two in the district area participated into the research. “Spatial Visualization Test” and “Spatial Anxiety Scale” were used for collecting the data from pre-service teachers. It was determined as result of the study that pre-service male teachers were more successful rather than the female pre-service teachers in terms of spatial skills. Furthermore, female pre-service teachers were noticed to have higher spatial anxiety rather than the male pre-service teachers. Also it was found a significant negative correlation between the spatial anxiety and spatial skill. Some suggestions were offered within the framework of obtained findings. [Bu çalışmada, sınıf öğretmeni adaylarının uzamsal becerileri ile uzamsal kaygı düzeyleri arasındaki ilişkinin araştırılması amaçlanmıştır. Uzamsal beceri ve uzamsal kaygı üzerinde önemli bir değişken olduğu düşünülen cinsiyet faktörü de bu araştırmada dikkate alınmıştır. Araştırmaya merkezde iki ve taşrada iki olmak üzere toplam dört üniversitenin üçüncü sınıflarında öğrenim görmekte olan 267 sınıf öğretmeni adayı katılmıştır. Öğretmen adaylarından elde edilen verilerin toplanmasında "Uzamsal Görselleştirme Testi" ile "Uzamsal Kaygı Ölçeği" kullanılmıştır. Araştırmadan elde edilen veriler sonucunda, uzamsal beceriler açısından erkek öğretmen adaylarının kız öğretmen adaylarına göre daha başarılı olduğu bulunmuştur. Ayrıca kız öğretmen adaylarının erkek öğretmen adaylarına göre daha y

  16. Orta Ölçekli Bir İşletmenin Enerji İzleme Sisteminin Tasarlanması

    Directory of Open Access Journals (Sweden)

    Erdal Irmak

    2012-02-01

    Full Text Available Bu uygulamada, orta ölçekli bir işletmenin gerçek zamanlı ve geçmişe yönelik enerji takibinin bilgisayar ara yüzünden izlenmesi gerçekleştirilmiştir. Enerjinin ölçülmesi için akım ve gerilim bilgilerini Programlanabilir Lojik Kontrolörün ( PLC algılayacağı seviyeye getiren bir kart tasarlanmıştır. Bu karttan alınan akım ve gerilim bilgileri, PLC'nin analog kanalları ile okunmaktadır. Sistemin güç katsayısının algılanması için, bir sıfır geçiş detektörü tasarlanmıştır. Sıfır geçiş detektöründen elde edilen sinyaller arasındaki zaman farkı FM 350-1 sayıcı modül kullanılarak ölçülmüştür. Alınan bilgiler, PLC tarafından RS485/RS232 dönüştürme protokolü kullanarak, bilgisayarın seri iletişim kanalı aracılığı ile veritabanına aktarılmaktadır. Elde edilen veriler, C# programlama dili kullanılarak tasarlanan bir arayüz ile anlık takip edilebilmektedir. Elde edilen veriler sürekli olarak kaydedilerek geçmişe yönelik enerji analizleri yapma olanağı sağlanmıştır. Böylece, istenildiğinde belirlenen zaman aralığında kullanılan aktif, reaktif ve görünür güçler gözlemlenebilmektedir. Geçmişe yönelik enerji izleme sistemi kullanılarak işletmelerin fazla enerji harcadığı zamanlar tespit edilebilmektedir. Böylece, yoğun çalışma saatleri enerjinin ucuz olduğu zamanlara kaydırılarak kullanılan enerjinin işletmeye olan maliyetinin azaltılması gibi olanaklar sağlanmaktadır.

  17. Çiftçilerin Bürokratik Bilgi ve Becerilerine Etki Eden Faktörler; Tokat İli Örneği

    Directory of Open Access Journals (Sweden)

    Gungor Karakas

    2017-03-01

    Full Text Available Bu çalışmanın amacı, kırsal alanda yaşayan üreticilerin bürokratik bilgi ve becerilerinin gelişmesini etkileyen bazı faktörlerin belirlemesidir. Bu amaca ulaşmak için kırsal alanda yaşayan 110 çiftçi ile yüz yüze anket yapılmıştır. Anketler 2013 yılında Tokat ili merkez köylerinde gerçekleştirilmiştir. Bürokratik süreçler konusundaki bilgi ve becerilerinin gelişmesinde etkili olan faktörlerin belirlenmesi amacıyla, sırasıyla açımlayıcı faktör analizi ve doğrulayıcı faktör analizi kullanılmıştır. Yapılan açımlayıcı faktör analizi sonucunda 4 faktörlü ve 10 değişkenli bir yapı ortaya çıkmıştır. Toplam varyansın % 76,063’ünü açıklayan bu faktörler ve güvenilirlik katsayıları; Örgütlenme Eğilimi (0,803, Bürokratik İşlem Deneyimi (0,701, Desteklerden Yararlanma Yoğunluğu (0,900 ve Yakın Çevre İletişimi (0,601 olarak belirlenmiştir. Yapılan doğrulayıcı faktör analizi sonuçlarına göre uyum endeks değerleri; GFİ: 0,938, CFİ; 0,934 ve NFİ; 0,913 olarak hesaplanmıştır. Ayrıca elde edilen RMSEA ve CMİN/DF katsayılarının da uygun ve anlamlı olması elde edilen sonuçların teoriye uygun olduğuna işaret etmektedir. Elde edilen bu katsayıların istenen uyum indeks değerlerinin anlamlı olması sonuçların teoriye uygun olduğuna işaret etmektedir. Sonuç olarak Tokat ili kırsal alanda yaşayan çiftçilerin bürokratik bilgi ve becerilerinde etkili faktörler; tarımsal örgütlenmelerin içinde yer almak, kamu dairelerinde yapılan resmi işlem deneyimi, tarımsal desteklerden faydalanma girişimleri ve yakın çevre iletişimi olarak belirlenmiştir.

  18. YÖNETİCİLERİN DEMOGRAFİK ÖZELLİKLERİ İLE LİDERLİK TARZLARI ARASINDAKİ İLİŞKİ: İSTANBUL’DAKİ BEŞ YILDIZLI OTELLER ÜZERİNDE BİR ARAŞTIRMA

    Directory of Open Access Journals (Sweden)

    Derman KÜÇÜKALTAN

    2014-03-01

    Full Text Available ÖzetEtkili liderlik, yoğun rekabet ortamı içerisinde faaliyet gösteren otel işletmelerinin de ihtiyaç duydukları bir kavramdır. Liderliği etkileyen faktörlerden bir tanesi de demografik özelliklerdir. Bu bağlamda çalışmanın amacı; yöneticilerin demografik özellikleri ile benimsenen liderlik tarzları arasındaki ilişkiyi ortaya koymaktır.Bu amaçla oluşturulan anket, İstanbul’daki beş yıldızlı otel işletmelerinin genel müdürleri ile departman müdürleri üzerinde uygulanmıştır. Elde edilen veriler SPSS paket programı kullanılarak değerlendirilmiştir. Anket içerisindeki Likert ölçekli sorularda alt boyutların belirlenmesi için faktör analizi yapılmıştır. Elde edilen alt boyutların, yöneticilerin demografik özelliklerine göre bir farklılık gösterip göstermedikleri Mann-Whitney U ve Kruskal- Wallis testleri ile sınanmıştır. Farklılık gözüken maddelerde farkın nereden kaynaklandığını bulmak amacıyla Tukey testi uygulanmış ve elde edilen sonuçlar üzerinde yorumlar yapılmıştır. Üç liderlik tarzını birden etkileyen herhangi bir demografik özellik bulunmamakla birlikte, bazı değişkenlerin liderlik tarzları ile anlamlı bir ilişki içerisinde olduğu görülmüştür.AbstractEffective leadership has become a notion that is needed by the hotel enterprises which function in a competition-intensive sector. Demographic characteristics are one of the factors which affect leadership most. In this context; the purpose of this study is to display the relationshipbetween the managers’ demographic characteristics and adopted leadership styles. The questionnaire that has been developed for this purpose, has been implemented on the general managers and departmental managers of the five star hotels in Istanbul. The gained data has been evaluated by SPSS. Factor analysis has been done to determine the sub-dimensions in Likert scale questions. The sub-dimensions have been

  19. AKTİFLEŞTİRİLMİŞ LİNYİT KÖMÜRLERİ İLE SULU ÇÖZELTİLERİNDEN FENOL'ÜN ADSORBSİYONU

    Directory of Open Access Journals (Sweden)

    Mehmet MAHRAMANLIOĞLU

    1998-01-01

    Full Text Available Bu çalışmada, fenol'ün sulu çözeltilerinden adsorbsiyon yolu ile uzaklaştırılması ve böylece geri kazanılması hedeflendi. Adsorbent olarak İstanbul ili, Yeniköy kömür sahalarından üretilen ağaçlı linyit kömürleri seçildi. Sözü edilen linyit kömürlerinden alınan bir örnek bu amaçla önce aktifleştirildi. Aktifleştirme, sülfat asidiyle ısıtma ve destilasyon metodları ile gerçekleştirildi. Adsorbsiyon çalışmalarında çeşitli molar konsantrasyonlarda sulu fenol çözeltileri kullanıldı. Elde edilen adsorbsiyon sonuçlarının Langmuir izotermine uyduğu görüldü. Çalışmaların sonucunda, bugüne kadar sadece yakıt olarak kullanılagelen bu kömürlerin adsorblayıcı olarak da değerlendirilebileceği, daha ileri çalışmalarla da, bazı atık sulardan fenol'ün uzaklaştırılabileceği ve hatta geri kazanılmasının mümkün olabileceği anlaşıldı.

  20. Mermer Kesme İşleminde Spesifik Enerji Faktörünün ANFIS ve YSA Yöntemleri ile Tahmini

    Directory of Open Access Journals (Sweden)

    MURAT CANER

    2009-02-01

    Full Text Available Bu çalışmada, mermer kesme parametrelerinin enerji tüketimine etkisi, Yapay Sinir Ağları ve ANFIS kullanılarak tahmin edilmiştir. Tahmin metotlarında giriş olarak mermerin sertliği, testere dönüş hızı ve kesme hızı parametreleri kullanılmış ve birim hacim başına harcanan kesme enerjisinin bir ifadesi olan spesifik enerji faktörü çıkış olarak alınmıştır. Ağların eğitimi için kullanılan veriler, Afyon Kocatepe Üniversitesi laboratuarlarında bulunan, mermer kesilebilirlik analizleri için geliştirilmiş, bilgisayar tabanlı, dairesel testereli blok kesme (S/T makinesinde yapılan bir deneysel çalışmadan alınmıştır. Bu veriler Denizli Traverteni ve Bilecik Bej tipi mermerlere ait kesim parametreleridir. Bu verilerin bir kısmı eğitimde kullanılmış ve tüm veriler daha sonra eğitilen ağlarda test edilmiştir. Tahmin edilen sonuçlar elde edilmiş deney sonuçlarıyla karşılaştırılmıştır. Sonuç olarak tahmin edilen verilerin deneysel verilere oldukça yakın olduğu görülmüştür.

  1. Batı Akdeniz Sahil Kuşağından Toplanan Yonca (Medicago sativa L. Populasyonlarının Moleküler Karakterizasyonu

    Directory of Open Access Journals (Sweden)

    Mehmet ÖTEN

    2016-06-01

    Full Text Available Medicago tür ve populasyonlarında moleküler markırlar kullanılarak genotipik varyasyon seviyesini belirlemek yaygın olarak kullanılmaktadır. Bu çalışmada; Batı Akdeniz sahil kuşağında yer alan, Antalya iline ait 13 ilçede, 26 farklı lokasyonda, doğal vejetasyondan toplanan üstün yonca genotipleri klon yöntemi ile çoğaltılmıştır. Elde edilen 26 genotip ve 2 standart çeşidin aralarındaki benzerlikler, Basit Tekrarlı Sekanslar (SSR moleküler analiz tekniğiyle, 15 adet primer kullanılarak belirlenmiştir. SSR primerlerinin % 99,7’si polimorfik bant vermiştir. Araştırma sonucunda; kümeleme analizi sonucu oluşan dendograma göre yonca genotipleri 2 ana ve 4 alt gruba ayrılmıştır. Birinci ana grup % 60, ikinci ana grup ise % 65 seviyesinde kendi içerisinde iki alt gruba ayrılmıştır. Benzerlik katsayıları 0.58-0.88 değerleri arasında değişim göstermiştir. En yakın genetik benzerlik Kaş-2 ve Çeşit-1 arasında bulunurken, en uzak ise Gazipaşa-1-Kumluca-2 genotipleri arasında bulunmuştur. Elde edilen bu sonuca göre Batı Akdeniz sahil kuşağından toplanan yonca genotipleri arasında genetik olarak önemli bir varyasyonun olduğu tespit edilmiştir.

  2. Atık Alüminyum Polietilen (Tetrapak ve Pirinç Sapı Kullanılarak Üretilen Ahşap Polimer Kompozitlerin Mekanik Davranışlarının Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Alperen KAYMAKCI

    2012-12-01

    Full Text Available ÖzetBu çalışmada pirinç sapı unu ile güçlendirilmiş alüminyum polietilen esaslı polimer kompozitlerin bazı mekanik özellikleri araştırılmıştır. Bu amaç doğrultusunda pirinç sapı unu, alüminyum polietilen ve uyum sağlayıcı ajan (MAPE ikiz vidalı bir ekstruder içerisinde karıştırılarak pellet elde edilmiştir. Elde edilen pelletler enjeksiyon kalıplama makinesi kullanılarak mekanik özellikleri belirlemek için gerekli olan numunelerin üretimi sağlanmıştır. Pirinç sapı unu miktarının artmasıyla üretilen alüminyum polietilen esaslı polimer kompozitlerin eğilme ve çekme modüllerinde artış olduğu belirlenmiştir ancak eğilme ve çekme direnci değerlerinde bir miktar azalma tespit edilmiştir. Alüminyum polietilen esaslı polimer kompozit üretiminde kullanılan maleik anhidrit polietilen uyum sağlayıcı ajanın mekanik özellikleri üzerine olumlu etki yaptığı belirlenmiştir. Bu çalışmayla maleik anhidrit polietilen ile muamele edilen alüminyum esaslı polietilen kompozitlerin kabul edilebilir mekanik özellikleri dolayısıyla taban döşeme malzemesi olarak kullanılabileceği belirtilmiştir.AbstractIn this study, we evaluated some mechanical properties of aluminum polyethylene (Tetra Pak composites reinforced with rice husk flour. To meet this objective, rice husk flour was compounded with aluminum polyethylene with coupling agent (MAPE in a twin screw co-rotating extruder and then was manufactured by injection molding process. The modulus in the flexural and tensile improved with increasing rice husk flour content while the tensile and flexural strengths of the samples decreased. The use of maleic anhydride polyethylene had a positive effect on the mechanical properties of the aluminum polyethylene composites reinforced with rice husk flour. This work showed that the composites treated with maleated polyethylene could be efficiently used as decking products, due to satisfactory

  3. Geri Dönüşüm Lifler İçeren Süprem Kumaşların Isıl Konfor Özelliklerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Gizem CELEP

    2016-01-01

    Full Text Available Bu çalışmada orijinal (ORJ ve geri dönüşüm (GD pamuk lifleri kullanılarak, %100 ORJ, %100 GD ve 50/50 ORJ/GD pamuk lifleri içeren iplikler üretilmiş ve bu iplikler ile üretilen süprem kumaşların ısıl konfor özellikleri incelenmiştir. Bu amaçla konfeksiyonda açığa çıkan kumaş kırpıntılarından elde edilen geri dönüşüm pamuk lifleri ve orijinal pamuk lifleri open-end rotor iplik eğirme sisteminde eğrilmiş ve bu ipliklerden süprem kumaşlar üretilmiştir. Geri dönüşüm ve orijinal pamuk ipliklerinden elde edilen bu kumaşların ısıl konfor özelliklerini karşılaştırmak amacıyla; ısıl iletkenlik, ısıl direnç, ısıl soğurganlık ve hava geçirgenlik özellikleri ölçülmüştür. Kumaşlarda geri dönüşüm pamuk liflerinin kullanımının kumaşların ısıl direnç değerlerini arttırdığı; ısıl iletkenlik, hava geçirgenliği ve ısıl soğurganlık değerlerini düşürdüğü gözlenmiştir. Geri dönüşüm liflerinden örülmüş süprem kumaşların ısıl direnç değerlerinin yüksek olmasının ve ilk temasta daha sıcak bir his vermesinin orijinal liflerden üretilen kumaşlara göre kullanım alanına bağlı olarak üstünlük sağladığı düşünülmektedir.

  4. Katalaz Temelli PANI Biyosensörü ile Deltametrinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Hatice PALÜZAR

    2017-02-01

    Full Text Available Pestisitler, tarım alanı başta olmak üzere ürünlerde istenmeyen organizmaların yok edilmesinde yüzyıllardan beri kullanılan kimyasallardır. Özellikle tarım sektöründeki kullanım artışından dolayı, pestisitler en önemli çevresel kirleticiler arasında yer almaktadır. Pestisitlerin dünyada yaygınlaşan kullanımları, bu maddelerin çevresel analizlerine gösterilen ilgiyi arttırmaktadır. Pestisit analizleri genellikle GC ve HPLC gibi yöntemler ile gerçekleştirilmektedir. Ancak bu metodlar genellikle bir takım ön işlemleri gerektirmektedir ve yerinde analizler için kullanımları uygun değildir. Enzim inhibisyonlarını temel alan biyosensör sistemleri ise bu amaca yönelik oldukça kullanışlı sistemlerdir. Bu nedenle bu çalışmada polianilin (PANI iletken polimer kullanılarak deltametrin tayini için katalaz (CAT inhibisyonu esaslı bir biyosensör geliştirildi. Geliştirilen biyosensörün optimizasyonu ve karakterizasyonuna ilişkin parametreler incelenerek, deltametrin varlığında lineer inhibisyon aralığı belirlendi. Deltametrin için biyosensörün standart sapma ve varyasyon katsayıları sırasıyla ± 0,0353 ve % 2,33 olarak hesaplandı. Geliştirilen biyosensörün deltametrin tayin sınırı 0,5-2,5 µM olarak belirlendi. Çalışmanın son kısmında, CAT temelli PANI biyosensörü ile atık su örneklerinde deltametrin tayini gerçekleştirilerek, elde edilen sonuçlar spektrofotometre ile elde edilen verilerle kıyaslandı.

  5. Böcek Mikroflorasından α-Endosülfanı Parçalayabilen Bakterilerin İzolasyonu ve Tanısı

    Directory of Open Access Journals (Sweden)

    Özlem Gür Özdal

    2016-04-01

    Full Text Available Nüfusun ve sanayileşmenin artması sonucu, çevrede birçok kimyasal madde birikmektedir. Özellikle sentetik ve toksik kimyasalların yaygın kullanımı, çevreden bu kimyasal kirleticilerin azaltılması ya da yok edilmesi için yeni teknolojileri geliştirmeye yöneltmektedir. Geniş tarım alanlarında toksik maddelerin biyodegradasyonu için kullanılan kimyasal yöntemler pahalı, zaman alıcı ve zordur. Ayrıca bu yöntemler yeni kimyasal kirleticilerin ortaya çıkmasına da neden olur. Son yıllarda alternatif bir yöntem olarak, bu toksik kimyasalların biyodegradasyonu için mikroorganizmalar kullanılmaktadır. Bu yöntem etkili, daha az zararlı, ekonomik, çok yönlü ve çevre dostudur. Bu çalışmada insektisitlere dirençli böceklerin florasından elde edilen potansiyel yeni bakteriyel izolatların insektisitlerin biyodegradasyonu için kullanılabileceği düşünülmüştür. Orthoptera, Dermaptera, Mantodea ve Hymenoptera takımlarına ait böcek türlerinden, bir insektisit olan α-endosülfanı parçalayabilen toplam 24 bakteriyal izolat elde edilmiştir. Morfolojik, fizyolojik ve biyokimyasal özellikler ile total yağ asidi profillerine göre izole edilen; Stenotrophomonas, Pseudomonas, Acinetobacter, Bacillus, Brevibacillus, Flavimonas ve Rhodococcus cinslerine ait bakteriler teşhis edilmiştir. Sonuç olarak, bu bakteriler farklı çevrelerde α-endosülfan kalıntılarının arıtımında kullanılabilir.

  6. Dokuma Karbon Elyaf Takviyeli Karbon Nano Tüp-Epoksi Kompozit Malzemelerin Mekanik ve Termal Karakterizasyonu

    Directory of Open Access Journals (Sweden)

    Nazife KORKMAZ

    2016-06-01

    Full Text Available Bu çalışmada karbon elyaf takviyeli-karbon nano tüp ile modifiye edilmiş epoksi kompozit malzemelerin üretilmesi ve üretilen kompozit malzemelerin mekanik, termal ve kırılma yüzeylerinin karakterizasyonu hedeflenmiştir. Bu hedef doğrultusunda matris elemanı olarak çok katmanlı karbon nano tüp içeren epoksi nano kompozit, dokuma karbon kumaş ise 4/4 dimi takiveye elemanı olarak kompozit malzeme üretiminde kullanılmıştır. Çalışma kapsamında ayrıca, karbon nano tüp ile matris modifikasyonu işleminin etkisini belirlemek için saf epoksi reçine sisteminin matris malzemesi olarak kullanıldığı kompozit numuneleri de üretilmiştir. Üretilen kompozitlerde karbon nano tüp ile matris modifikasyonu işleminin mekanik performans özellikleri üzerindeki etkisi çekme, eğilme ve düzlem içi kayma testleri ile değerlendirilmiştir. Kompozit malzemlerin termal karakterizasyonu ise simültane termal analiz ünitesinde (TG-DTG/TG-DSC/TG, diferansiyel termal gravimetre (TG-DTG ve diferansiyel taramalı kalorimetre (DSC analizleri ile yapılmıştır. Çekme testi sonucu kırılmış veya hasarlı parçalardan optik mikroskop ve taramalı elektron mikroskobu (SEM cihazı ile alınan yüzey görüntüleri incelenerek kompozit malzemelerde hasar ilerleme mekanizmaları tespit edilmiştir. Elde edilen sonuçlar, epoksi reçine sistemine karbon nano tüp dispersiyonu ile karbon elyaf takviyeli polimerik kompozit malzemelerin mekanik ve termal özelliklerinde iyileşmeler sağlandığını göstermektedir. Ayrıca, SEM ve optik mikroskop görüntüleri de mekanik karakterizasyon aşamasında elde edilen kompozit malzeme performans iyileşmesini desteklemektedir.

  7. Tüketicilerin Coğrafi İşaretli Ürün Algısı ve Daha Fazla Fiyat Ödeme İsteği: Yapısal Eşitlik Modellemesi Yaklaşımı(Consumers' Perception of Product with Geographical Indication and Willingness to Pay More: A Structural Equation Modeling Approach

    Directory of Open Access Journals (Sweden)

    İsmail Tamer TOKLU

    2016-04-01

    Full Text Available Bir fikri ve sınai mülkiyet hakkı olarak coğrafi işaret, belirli bir nitelik, ün veya diğer özellikleriyle kökeninin bulunduğu bir yöre, alan, bölge veya ülke ile özdeşleşmiş bir ürünü gösteren işaretlerdir. Bu çalışmanın amacı tüketicilerin coğrafi işaretli ürünlere olan algılarını ve bu ürünlere daha fazla ödeme eğilimlerini ölçmektir. Bu amaç için oluşturulan modelin verileri kolayda örnekleme yöntemiyle, tüketicilerle yüz yüze yapılan anket çalışmasından elde edilmiştir. Elde edilen veriler En Küçük Kısmi Kareler (PLS yöntemi ile analiz edilmiştir. Araştırmadan elde edilen bulgulara göre; kültür ve gelenek, kalite ve güvenilirlik coğrafi işaretli ürün algısını etkilerken, coğrafi işaretli ürün algısı da daha fazla fiyat ödeme eğilimini etkilemektedir. Diğer taraftan, ekonomik desteğin coğrafi işaretli ürün algısını etkilemediği bulunmuştur. Bu çalışmanın sonuçları rekabet avantajı elde etmek isteyen yerel üreticiler için etkili bir pazarlama stratejisine karar vermeleri açısından değerli ve önemli bilgiler sunmaktadır. As an intellectual property right, geographical indications are signs showing an exclusive quality, celebrity or other attributes specified with a territory, area, region or country of its origin. This study aims to evaluate consumers' perceptions toward products with geographical indication and their willingness to pay a premium price for these types of products. The data of the model proposed for this aim were collected by convenience sampling method with face to face questionnaire. PLS (Partial Least Squares Method was used to analyze the data. The main findings of the study are as follows, 'culture and tradition' and 'quality and safety' affect the consumers' perceptions towards geographical indication. This perception also affects the willingness to pay more for products with geographical indication. On the other

  8. CollAborative care and active surveillance for Screen-Positive EldeRs with subthreshold depression (CASPER): a multicentred randomised controlled trial of clinical effectiveness and cost-effectiveness.

    Science.gov (United States)

    Lewis, Helen; Adamson, Joy; Atherton, Katie; Bailey, Della; Birtwistle, Jacqueline; Bosanquet, Katharine; Clare, Emily; Delgadillo, Jaime; Ekers, David; Foster, Deborah; Gabe, Rhian; Gascoyne, Samantha; Haley, Lesley; Hargate, Rebecca; Hewitt, Catherine; Holmes, John; Keding, Ada; Lilley-Kelly, Amanda; Maya, Jahnese; McMillan, Dean; Meer, Shaista; Meredith, Jodi; Mitchell, Natasha; Nutbrown, Sarah; Overend, Karen; Pasterfield, Madeline; Richards, David; Spilsbury, Karen; Torgerson, David; Traviss-Turner, Gemma; Trépel, Dominic; Woodhouse, Rebecca; Ziegler, Friederike; Gilbody, Simon

    2017-02-01

    Efforts to reduce the burden of illness and personal suffering associated with depression in older adults have focused on those with more severe depressive syndromes. Less attention has been paid to those with mild disorders/subthreshold depression, but these patients also suffer significant impairments in their quality of life and level of functioning. There is currently no clear evidence-based guidance regarding treatment for this patient group. To establish the clinical effectiveness and cost-effectiveness of a low-intensity intervention of collaborative care for primary care older adults who screened positive for subthreshold depression. A pragmatic, multicentred, two-arm, parallel, individually randomised controlled trial with a qualitative study embedded within the pilot. Randomisation occurred after informed consent and baseline measures were collected. Thirty-two general practitioner (GP) practices in the north of England. A total of 705 participants aged ≥ 75 years during the pilot phase and ≥ 65 years during the main trial with subthreshold depression. Participants in the intervention group received a low-intensity intervention of collaborative care, which included behavioural activation delivered by a case manager for an average of six sessions over 7-8 weeks, alongside usual GP care. Control-arm participants received only usual GP care. The primary outcome measure was a self-reported measure of depression severity, the Patient Health Questionnaire-9 items PHQ-9 score at 4 months post randomisation. Secondary outcome measures included the European Quality of Life-5 Dimensions, Short Form questionnaire-12 items, Patient Health Questionnaire-15 items, Generalised Anxiety Disorder seven-item scale, Connor-Davidson Resilience Scale two-item version, a medication questionnaire and objective data. Participants were followed up for 12 months. In total, 705 participants were randomised (collaborative care n = 344, usual care n = 361), with 586 participants (83%; collaborative care 76%, usual care 90%) followed up at 4 months and 519 participants (74%; collaborative care 68%, usual care 79%) followed up at 12 months. Attrition was markedly greater in the collaborative care arm. Model estimates at the primary end point of 4 months revealed a statistically significant effect in favour of collaborative care compared with usual care [mean difference 1.31 score points, 95% confidence interval (CI) 0.67 to 1.95 score points; p managing multimorbidities in people with subthreshold depression. Current Controlled Trials ISRCTN02202951. This project was funded by the National Institute for Health Research (NIHR) Health Technology Assessment programme and will be published in full in Health Technology Assessment; Vol. 21, No. 8. See the NIHR Journals Library website for further project information.

  9. A randomised evaluation of CollAborative care and active surveillance for Screen-Positive EldeRs with sub-threshold depression (CASPER: study protocol for a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Richards David

    2011-10-01

    Full Text Available Abstract Background Depression accounts for the greatest burden of disease among all mental health problems, and is expected to become the second-highest amongst all general health problems by 2020. By the age of 75, 1 in 7 older people meet formal diagnostic criteria for depression. Efforts to ameliorate the burden of illness and personal suffering associated with depression in older people have focussed on those with more severe depressive syndromes. Less attention has been paid to those with mild disorders/sub-threshold depressive syndromes but these patients also suffer impairments in their quality of life and level of functioning. Methods/Design The CASPER study has been designed to assemble an epidemiological cohort of people over 75 years of age (the CASPER cohort, from which we will identify those eligible to participate in a trial of collaborative care for sub-threshold depression (the CASPER trial. We aim to undertake a pragmatic randomised controlled multi-centre trial evaluating the effectiveness and cost-effectiveness of collaborative care; a low intensity psychological intervention in addition to usual general practitioner care versus usual general practitioner care alone. General practitioners from practices based in the North of England will be asked to identify potentially eligible patients over the age of 75 years. Patients will be sent a letter inviting them to participate in the study. We aim to recruit approximately 540 participants for the CASPER trial. A diagnostic interview will be carried out to ascertain trial eligibility with the major depressive episode module of the Mini International Neuropsychiatric Interview (M.I.N.I., eligible participants randomised to either the intervention or usual care. The primary outcome will be measured with the Patient Health Questionnaire-9 (PHQ-9 and additional quality of life measures will be collected. Data will be collected at baseline, 4 and 12 months for both trial and cohort participants. Trial Registration ISRCTN: ISRCTN02202951

  10. Reflection on the efficiency criteria for a long duration disposal with respect to temporary abandonment situations; Reflexion sur les criteres de performance d'un entreposage de longue duree (ELD) vis-a-vis des situations de delaissement temporaire

    Energy Technology Data Exchange (ETDEWEB)

    Heriard-Dubreuil, G.; Gadbois, S. [Mutadis, 75 - Paris (France); Chieber, C.; Schneider, Th. [Centre d' Etude sur l' Evaluation de la Protection dans le Domaine Nucleaire, 92 - Fontenay aux Roses (France)

    2002-08-15

    A study carried out by Mutadis and CEPN, on request of the CEA, aimed at supplying some elements allowing to elaborate some performance criteria for a long-term management system in front of situations of temporary abandonment of radioactive waste disposal facilities. The first part of the study has been the identification of case studies illustrating situations of loss of maintenance or temporary abandonment. The second phase has been the selection and analysis of 4 case studies (the ancient underground cavities in Ile-de-France, the regulation relative to new underground quarries, the abandoned mines in Loraine basin, and Unesco's approach for the protection of mankind world patrimony). These cases have been analysed with respect to various aspects: actors involved, construction management and memory preservation, liabilities in time and space, prevention means, scheduling, and resumption strategies. The concepts of abandonment, scheduling and resumption have been precised and analysed in a third part according to the case studies. Three goals - avoiding abandonment, encouraging scheduling and resumption - and eight characteristics are drawn from this analysis, which are indicators of the robustness of the system implemented to fulfill these 3 goals. These characteristics appear as strongly interdependent. (J.S.)

  11. Ortotropik değişken kalınlıklı disk problemlerinin analitik çözümleri

    Directory of Open Access Journals (Sweden)

    Ahmet N. ERASLAN

    2016-02-01

    Full Text Available Bu çalışmada eş ısıl olmayan, ortotropik, değişken kesitli disklerin, farklı sınır koşulları altında mekanik davranışlarını tahmin edebilmek için analitik bir model geliştirilmiştir. Disk geometrisi için temel mekanik denklemleri, ortotropik malzeme denklemleri ile birleştirilerek elastik denklem elde edilmiştir. Bu denklem uygun bir dönüşüm tekniği ile standart hipergeometrik diferansiyel denkleme dönüştürülmüş ve bunun analitik çözümü hipergeometrik fonksiyonlar cinsinden bulunmuştur. Çözümü tamamlayan sınır koşulları, iki ucu serbest dönen, iç veya dış yüzeyden basınçlandırılmış durağan değişken kesitli disklerin benzetişimini sağlayacak şekilde seçilmiştir. Elde edilen sonuçlar grafiksel olarak sunulmuştur. Sonuçlar göstermiştir ki makalede incelenen her üç problem için de elastik ortotropi parametresi diskin elastik davranışını etkileyen en önemli parametre olarak ortaya çıkmıştır.Anahtar Kelimeler: Ortotropik diskler, Değişken kesit, Termo elastisite, Hipergeometrik denklem

  12. BİLEZİKLİ ASENKRON MAKİNELERDE ANLIK YÜKSEK MOMENT VE HIZ DENETİMİ İÇİN ROTOR DEVRESİNE BULANIK MANTIK TABANLI GÜÇ ENJEKSİYONU

    Directory of Open Access Journals (Sweden)

    Selami KESLER

    2009-01-01

    Full Text Available Büyük güç gerektiren uygulamalarda yüksek moment üretimi ve rüzgâr santrallerinde sabit frekanslı sabit güç üretimi için kullanılan bilezikli asenkron makinelerde rotor devresi güç akışı farklı yöntemlerle denetlenir. Denetimli yüksek moment üretmek, en uygun güç katsayısı elde etmek ve hız denetimi için rotor devresine bilezikler üzerinden kayma frekanslı gerilim uygulanabilir. Bu çalışmada, öncelikle bilezikli bir asenkron makinede rotor sargılarına bilezikler üzerinden gerilim uygulanmasının dinamik etkileri araştırılmış ve yöntemin sakıncalı yönleri uygulama desteğiyle ortaya konulmuştur. Daha sonra bu dinamik etkileri iyileştirmek üzere, makinenin anlık zorlanmalarda yüksek moment üretimini denetlemek ve hızını ayarlamak için rotor tarafında bulanık mantık denetleyicili bir evirici modeli önerilmiştir. Sürekli çalışma durumunda stator sargıları doğrudan şebekeye bağlı olan sistemin benzetim modeli için C/C++ programı geliştirilmiş ve farklı yük şartları için elde edilen sonuçlar tartışılmıştır.

  13. Granüler Yol Malzemeleri için Düsük Maliyetli Dinamik Üç Eksenli Test Cihazı Geliştirilmesi

    Directory of Open Access Journals (Sweden)

    Altan YILMAZ

    2009-04-01

    Full Text Available Dinamik üç eksenli deneyleri ile yol malzemelerinin trafik yükleri altındaki mekanik özellikleri belirlenebilmektedir. Laboratuar deneyleri ile belirlenen bu malzeme parametreleri genellikle üstyapı tasarımında kullanılmaktadır. Bu çalısma kapsamında, granüler yol malzemelerinin mekanik özelliklerinin (Esneklik modülü, Poisson oranı belirlenebilmesi için, düsük maliyetli dinamik bir üç eksenli test cihazı gelistirilmistir. Cihaz bilgisayar kontrollü olup deneyi süren program da bu makalenin yazarları tarafından hazırlanmıstır, dolayısıyla program üzerinde degisiklik yapmak, yeni veriler eklemek mümkündür. Deney cihazında yük kontrolü yük hücresi aracılıgı ile yüklemeler ise elektro-pnömatik valf sistemi ile yapılmaktadır. Bu cihaz ile 100x200mm ve 150x300mm ebatlarındaki silindir numuneler test edilebilmektedir. Gelistirilen deney cihazının maliyeti ithal fiyatının yaklasık 1/5'i civarındadır. Gelistirilen bu dinamik deney düzenegi ile gerçeklestirilen üç eksenli deneylerinden elde edilen veriler benzer çalısmalarla karsılastırıldıgında basarılı sonuçların elde edildigi görülmüstür.

  14. Havuçların Soyulmasının Matematiksel Analizi (İngilizce)

    OpenAIRE

    Aydın, Özlem; Bayındırlı, Levent; Artık, Nevzat

    2015-01-01

    Bu çalışmada, Beypazarı havuçlarının kabukları, kimyasal yöntem ve buharla soyma yöntemleriyle soyulmuştur. NaOH çözeltisinin konsantrasyonu, sıcaklığı ve daldırma süresinin etkileri araştırılmıştır. Kimyasal yöntemle kabuk soymada optimum süre-sıcaklık-konsantrasyon ilişkileri matematiksel olarak analiz edilmiştir. Deneyler, NaOH konsantrasyonu olarak 2.5, 5.0, 7.5 ve 10.0 g NaOH/kg, sıcaklık olarak 57, 67, 77 ve 87 °C’lerde, %98’den daha fazla soyulma elde edilene kadar uygulanmıştır. 57 °C...

  15. Açıklıklı Kutuların Analizinde Etkin Bir Hibrid MoM/FEM Yöntemi

    Directory of Open Access Journals (Sweden)

    SİBEL YENİKAYA

    2011-03-01

    Full Text Available Bu makalede, açıklığa sahip bir kutunun içerisindeki alan dağılımını bulmak için frekans domeninde moment metodu (MoM ile kenar tabanlı vektörel sonlu elemanlar metodunu (FEM birleştiren hibrit bir formülasyon sunuldu. Açıklıktaki sınır koşulundan elde edilen integral denklemin çözümü için moment metodu kullanılırken, kutunun içerisindeki elektromanyetik alanların çözümü için sonlu elemanlar metodu kullanıldı. Açıklığa sahip kutunun ekranlama etkinliği ve depolanan elektriksel enerji hibrit yöntem ile hesaplandı ve literatürdeki sonuçlar ile karşılaştırılarak doğrulandı. Daha sonra bu yöntem farklı açıklık boyutlarına sahip farklı kutulara uygulandı.

  16. GERUNDS MADE FROM THE SUFFIX -GAn IN UZBEK TURKISH THROUGH SAID AHMAD’S NOVEL CALLED “UFQ” SAİD AHMAD’IN “UFQ” ROMANI ESASINDA ÖZBEK TÜRKÇESİNDE -GAn EKİYLE YAPILAN ZARF-FİİLLER

    Directory of Open Access Journals (Sweden)

    Esra YAVUZ

    2010-07-01

    Full Text Available In this article, it is examined gerunds made from suffix –GAn in Uzbek Turkish through Said Ahmad’s novel called “Ufq”, which is a Turkic language of southeastern branch, and is approached in details historical development, structure and utilization of suffixes. Additionaly, it is emphasized functions of gerund-making by using case ending, noun derivational affix, particle and word of the suffix -GAn, and to understand this issue, utilizations of these suffixes have supported the examinations obtained from “Ufq” novel. Bu makalede, Said Ahmad’ın “Ufq” romanı esasında Özbek Türkçesinde -GAn ekiyle yapılan zarf-fiiller konusu incelenmiş ve eklerin tarihi gelişimi, yapısı ve kullanımları ayrıntılı bir şekilde ele alınmıştır.Ayrıca, –GAn ekinin, isim çekim eki, isim yapma eki, edat ve kelime kullanarak zarf-fiil yapma işlevleri üzerinde durulmuş ve konunun anlaşılması için bu zarf-fiil eklerinin kullanımları “Ufq” romanından elde edilen örneklerle desteklenmiştir.

  17. Invesitgation of Drilling Parameters on Thrust Force on AZ91 Magnesium Alloy by Genetic Expression Programming

    Directory of Open Access Journals (Sweden)

    Kemal ALDAŞ

    2014-09-01

    Full Text Available Bu çalışmada AZ91 magnezyum alaşımının farklı parametreler altında işlenmesi ile oluşan kesme kuvvetlerinin deneysel tabanlı teorik bir model ile tahmin edilmesi sunulmuştur. Modelleme için gerekli deneyler kuru işleme ortamında ve işleme devri ilerleme hızı ve 4 farklı matkap ucunun tam faktöriyel deney tasarımı kullanarak gerçekleştirilmiştir. Deneyler sonucunca elde edilen veriler Genetic Expression yazılımı ile modellenerek kesme kuvveti tahmini için formulasyon oluşturulmuştur. Bu formulasyon kullanılarak deneyde kullanılan parametrelerin kesme kuvveti üzerindeki etkileri detaylı olarak analiz edilmiştir

  18. Ascidianlar ve Akdeniz Havzasındaki Dağılımları.

    Directory of Open Access Journals (Sweden)

    Herdem Aslan

    2015-12-01

    Full Text Available Bu çalışma Ege Denizi’nin kuzeydoğusunda bulunan Bozcaada kıyılarının Ascidian faunası ve bazı ekolojik özelliklerini ortaya çıkarmak için yapılmıştır. Dünya denizlerinde 2500’den fazla tür ile temsil edilen Ascidian türleri infralittoral zondan hadal zona kadar geniş bir alanda sessil olarak yaşarlar. Ülkemiz sularında dağılımları hakkında çok az bilgiye sahip olduğumuz Ascidianların Doğu Akdeniz’den 86, Batı Akdeniz’den 165 türü bilinmektedir. Bu çalışmada ise 2000-2001 yıllarında Bozcaada’nın ifralittoralinde beam trol, drej ve spatula kullanılarak altı Ascidian türü (Aplidium conicum (Olivi, 1792, Didemnum maculosum (Milne-Edwards,1841, Ascidiella aspersa (Müller, 1776, Ascidia mentula Müller, 1776, Styela plicata (Lesueur, 1823, Molgula manhattensis (De Kay, 1841 elde edilmiştir

  19. Ziraat Fakültesi Öğrencilerinin Öğrenim Başarısını Etkileyen Faktörler : Kahramanmaraş Sütçü İmam Üniversitesi Örneği

    OpenAIRE

    AĞIR, Hasan Burak; Akbay, Cuma; YILMAZ, Halil İbrahim

    2016-01-01

    Son yıllarda öğrencilerin akademik başarılarını araştırmaya yönelik çalışmalar yapılması önem kazanmıştır. Bu çalışma, Kahramanmaraş Sütçü İmam Üniversitesi Ziraat Fakültesi öğrencilerinin öğrenim başarısını etkileyen faktörlerin belirlenmesi amacıyla yapılmıştır. Araştırmanın ana materyalini, 2013-2014 eğitim öğretim yılında toplam 306 Ziraat Fakültesi öğrencisiyle yapılan anket çalışmasından elde edilen veriler oluşturmaktadır. Araştırmada öğrencilerin öğrenim başarısını etkileyen faktörler...

  20. YENİ GRAFİK UYGULAMA GELİŞTİRME ARAYÜZLERİNİN KARŞILAŞTIRILMASI

    Directory of Open Access Journals (Sweden)

    Mustafa TÜRKSEVER

    2003-01-01

    Full Text Available Bu makalede grafik yazılımları geliştirmede kullanılan uygulama geliştirme arayüzleri sınıflandırılarak kısaca tanıtılmıştır. İki boyutlu ve üç boyutlu uygulama geliştirme arayüzlerinin özellikleri belirtilmiştir. Çalışma kapsamında geliştirilen aynı işleve sahip iki yazılım (Kup3B Java2D sürümü, Kup3B Java3D sürümü kaynak kod satır sayılarına göre karşılaştırılmışlardır. Elde edilen değerler grafiklere dönüştürülmüş ve yorumlanmıştır.

  1. Tedrici Azalan Sıcaklığın Pimpla turionellae (Hymenoptera: Ichneumonidae’ nın Ömür Uzunluğuna ve Yumurta Verimine Etkileri

    Directory of Open Access Journals (Sweden)

    Rahile ÖZTÜRK

    2017-06-01

    Full Text Available Bu çalışmada, laboratuvar şartlarında Galleria mellonella L. (Lepidoptera: Pyralidae puplarında yetiştirilen endoparazitoid Pimpla turionellae L. (Hymenoptera: Ichneumonidae’ nın larval evresine, konak içinde uygulanan tedrici azalan sıcaklığın etkileri araştırılmıştır. Parazitlenen konak pupları sırasıyla 25, 20, 15 ve 10°C’ lerde 3’ er gün, 4°C’ de 2, 3, 4 ve 5’ er gün bekletilmiştir. Uygulamalar sonucunda çıkan bireylerin ergin ömür uzunlukları ve dişilerin yumurta verimi araştırılmıştır. Elde edilen sonuçlara göre, 4°C’ de bekletme süresinin artması ile ömür uzunluğu ve yumurta verimi azalmıştır.

  2. ELLIOTT DALGA PRENSİBİ VE ALTIN PİYASASI ÜZERİNE BİR UYGULAMA

    Directory of Open Access Journals (Sweden)

    Ayten ÇETİN

    2016-02-01

    Full Text Available Elliott Dalga Prensibi, kolektif yatırımcı psikolojisini içsel değişken kabul ederek fiyatın hareket dinamiklerini açıklamaya çalışan bir teknik analiz yöntemidir. Prensip, kitlesel ruh halinin birbirine zıt duygular arasında, tanımlanabilir ve tutarlı şablonları takip ederek hareket ettiğini savunmaktadır. Dalga Prensibinin birincil amacı piyasanın davranışlarını tanımlamaktır. Fiyatın takip ettiği hareket kalıbının tespit edilmesi, geleceğe dair tahmin yapmayı mümkün kılmaktadır. Çalışmada, altın piyasasındaki fiyat hareketleri Elliott Dalga Prensibi yardımıyla incelenmiştir. Yapı- lan analizlerde elde edilen sonuçlar, Elliott Dalga Prensibinde belirtilen döngüsel kalıpların, altın piya- sasındaki fiyat hareketlerinde var olduğunu göstermiş ve böylece altın fiyat hareketlerinin Elliott Dalga Prensibi ile analiz edilebileceği hipotezini desteklemiştir.

  3. Yoğurdun Fizikokimyasal Özelliklerine Kurutulmuş Goji Berry Meyvesinin (Lycium barbarum) Etkisi

    OpenAIRE

    TARAKÇI, Zekai; DEMİRKOL, Melike

    2018-01-01

    Bu çalışmada, goji berry meyvesi (Lycium barbarum) fanlı kurutma kabini ile kurutulupöğütülerek toz forma getirilmiş ve bu yöntemle elde edilen toz meyve ilezenginleştirilen yoğurtların 21 günlük (1, 10 ve 21. gün) depolama süresince bazıfizikokimyasal özellikleri araştırılmıştır. Bu çalışma doğrultusunda kurutulup öğütülenmeyveler yapılan ön denemelerle belirlenmiş olan % 0 (kontrol), 2, 3 ve 4 (w/v)oranlarında yoğurt üretiminde kullanılmıştır. Depolama süresince (4 °C, 21 gün)yoğurtların pH...

  4. FATİH Projesi Kapsamında Kullanılan LCD Panelli Etkileşimli Tahtaların Kullanılabilirlik Problemlerinin Tespiti

    Directory of Open Access Journals (Sweden)

    Meva BAYRAK

    2014-05-01

    Full Text Available Bu araştırmanın amacı, FATİH Projesi kapsamında ortaöğretim düzeyindeki okullarda kullanılmaya başlanan etkileşimli tahtaların donanımsal, yazılımsal ve fiziksel ortamdan kaynaklanan kullanılabilirlik problemlerini öğretmenlerin görüşlerine dayalı olarak belirlemektir. Veriler, Erzurum ili merkezinde bulunan 5 ortaöğretim kurumunda görev yapan 15 öğretmen ve bir ilçe eğitici formatör öğretmeninden görüşme yoluyla toplanarak analiz edilmiş ve elde edilen bulgular kullanılabilirlik kavramının temel bileşenleri olan etkililik, verimlilik ve memnuniyet kavramları esas alınarak yorumlanmıştır. Öğretmenler etkileşimli tahta kullanırken karşılaştıkları donanımsal, yazılımsal ve fiziksel ortamdan kaynaklanan kullanılabilirlik problemlerini ifade etmişlerdir. Çalışma sonunda ortaya çıkan kullanılabilirlik problemlerine yönelik önerilerde bulunulmuştur.

  5. TESTING EXCHANGE RATE DETERMINATION MODEL FOR YTL/US$: EVIDENCE FROM HIGH FREQUENCY DATA

    OpenAIRE

    Saatcioğlu, Cem; KORAP, H. Levent

    2008-01-01

    Bu çalışmada, YTL/US$ döviz kuru belirlenme mekanizması aylık gözlem aralığı kullanılarak 1986M01-2007M08 dönemi için incelenmektedir. Parasal model döviz kuru belirlenme mekanizmasına dayalı olarak oluşturulan kuramsal bir yaklaşım doğrultusunda, çağdaş çok değişkenli eş-bütünleşim yöntemi kullanılarak elde edilen tahmin sonuçları YTL/US$ parasal döviz kurunun iktisat kuramı tarafından önerilen temellerle eş-bütünleşik bir ilişki içerisinde olduğunu göstermektedir. Tahmin bulguları parasal d...

  6. Türkçe Pop Şarkılarda Popülarite ve Müzikalite Kavramları Üzerine Bir Değerlendirme

    OpenAIRE

    AYHAN, Ali

    2016-01-01

    Buçalışmada Türkçe pop şarkılarda popülarite ve müzikalite kavramları üzerine birdeğerlendirme yapılmıştır. Araştırmada örneklem gruplarına uygulanan anketsorularından elde edilen veriler doğrultusunda Türkçe pop müzik türününülkemizde toplumsal yapı içerisinde nasıl bir yeri olduğuna dair bilgilerinortaya çıkarılması; Türkçe pop müziğin toplum kültürünü yansıtabilme açısındangüçlü ve zayıf yönleri ile ilgili bir durum tespiti yapılmıştır. Çalışmanınörneklem gruplarına uygulanmak üzere bir an...

  7. AKRİLİK LİF ÜRETİMİNDE KOAGÜLASYON BANYOSUNUN ÖNEMİ

    Directory of Open Access Journals (Sweden)

    İsmail TİYEK

    2005-03-01

    Full Text Available Akrilik liflerinin yaş çekim yöntemiyle üretiminde lif oluşumu koagülasyon banyosu sayesinde meydana gelmektedir. Dolayısı ile yaş çekim yöntemiyle elde edilen liflerin fiziksel özellikleri büyük oranda koagülasyon banyosu şartları tarafından etkilenmektedir. Bu yüzden koagülasyon banyo parametrelerinin çok iyi bir şekilde kontrol edilmesi gerekmektedir. Bu makalede hem koagülasyon banyosunda meydana gelen difüzyon ve faz değişimi gibi bazı fiziksel olaylar ve hem de bu olayların meydana gelmesinde etkili olan bazı koagülasyon banyo parametreler özetlenmiştir. Ayrıca bunların liflerin fiziksel özellikleri üzerindeki etkisi belirtilmeye çalışılmıştır.

  8. Psiko-Sosyal Açıdan İnönü Dönemi Dinî Hayatla İlgili Bazı Değerlendirmeler

    OpenAIRE

    Zeynep ÖZCAN

    2014-01-01

    Öz Bu çalışmanın amacı “Millî Şef” ya da “İnönü Dönemi” olarak da bilinen 1938-1950 yılları arasında yaşanan dinî hayatı temel dinamikleriyle ortaya koymak ve günümüze yansımalarını psiko-sosyal açıdan değerlendirmektir. Bu kapsamda öncelikle dinî hayatın içinde yaşandığı ortam hakkında bilgi verilmiş daha sonra bu ortamın şekillendirdiği dinî hayatın portresi çizilerek günümüz dindarlığına yansımaları ele alınmıştır. Önemli bir değişim ve dönüşümün yaşandığı bu yıllarla ilgili elde edilen...

  9. BSD FREZE TEZGAHLARINDA İKİNCİ DERECEDEN BİR YÜZEY İMALATININ ARAŞTIRILMASI

    Directory of Open Access Journals (Sweden)

    Cihan ÖZEL

    2001-03-01

    Full Text Available Bu çalışmada, ikinci dereceden bir yüzey olan ve A.X B.Y C.Z 0 2 2 2 + - = genel denklemi ile verilen eliptik koni şeklindeki bir parçanın, Bilgisayarlı Sayısal Denetimli (BSD freze tezgahlarında imalatının yapılması açıklanmıştır. İmalat için gerekli olan Bilgisayar Destekli İmalat (BDİ programının, Fanuc sistemli makrolarla nasıl hazırlanacağı gösterilmiş ve Dyna 2900 Myte tipi dik işlem merkezli BSD freze tezgahında da bir parça üzerinde uygulaması gösterilerek elde edilen sonuçlar değerlendirilmiştir.

  10. Farklı Sulama Yöntemlerinde M9 Anacı Üzerine Aşılı “Williams Pride” ve “Jersey Mac” Elma Çeşitlerinin Su Tüketimi

    OpenAIRE

    ŞENYİĞİT, Ulaş; KADAYIFÇI, Abdullah

    2007-01-01

    Bu çalışma, 2006 ve 2007 yıllarında Süleyman Demirel Üniversitesi, Ziraat Fakültesi Araştırma ve Uygulama Çiftliğindeki elma bahçesinde yürütülmüştür. Denemede, M9 anaçları üzerine aşılı Jersey Mac ve Williams Pride elma çeşitleri, damla, toprak altı damla, yüzey ve ağaç altı mikro yağmurlama sulama yöntemleri ile sulanmış, beş günlük periyotlar için bitki su tüketimleri ölçülmüş, alanın tamamının ıslatıldığı yüzey sulama yöntemi konusundan elde edilen su tüketimi değerleri ile bazı kıyas bit...

  11. GELİŞİM SÜREÇLERİNDE ÇOCUK RESMİNİN YERİ

    OpenAIRE

    KUTLUER, Görkem

    2015-01-01

    Yirminci yüzyılın başlarında, çocuğun iç sesini dinlemenin, o sesi tercüme etmenin en doğru çocuk yetiştirme yöntemini ortaya çıkaracağı anlaşılmış, resim yaptırma gibi projektif teknikler önem kazanmıştır. Bu teknikler çocuk gelişimi alanının bir parçası olarak günümüze kadar gelmiştir. Çocuk resimlerinin analizinden elde edilen bulgular, sanatsal gelişim evreleri gibi teorilerin oluşturulmasında kullanılmıştır. Çocukların resimlerinde sıkça kullandıkları simgeler, bu araştırmalardan h...

  12. Measurement Of The Spectroscopic Properties Of Oxalic Acid-Solvent Systems By Uv-Spectrophotometry

    OpenAIRE

    Tekin, Nalan; Cebe, Mustafa

    2003-01-01

     Bu çalışmada, dissosiasyon ortamında okzalik asit çözeltilerinin · sıcaklık ve konsantrasyon ile dissosiasyon özelliklerinin değişimi UV-VIS Spektrofotometrik yöntem ile incelenmiştir. Her çözelti sistemi için, farklı sıcaklıklarda konsantrasyon, c, ve absorbans, A, arasındaki ilişkiler belirlenmiştir. Elde edilen sonuçlar, etil alkol, n-propil alkol, iso-propil alkol and N,N-dimetilformamid çözücüleriyle hazırlanan çözeltiler için Lambert-Beer yasasının sırasıyla l.00xl0"2M ile 6.25xl0...

  13. Kullanıcıların Facebook Reklamlarına Tepkilerini Belirleyen Reklam Özellikleri

    OpenAIRE

    Çakır, Vesile; Tam, Mehmet Sinan

    2014-01-01

    Facebook halihazırda en popüler sosyal medyadır ve bu özelliği ile cazip bir reklam medyasıdır. Bu araştırma facebook reklamlarının beğenilmesi, tıklanması ve paylaşılmasında yordayıcı olan reklam özelliklerini araştırmaktadır. Facebook kullanıcıları üzerinde gerçekleştirilen bir saha araştırmasından elde edilen veriler, kullanıcıların ilgilendikleri bir ürün kategorisine ait, tıklanma oranının yüksek, bilim kurgu tarzı, değişik renk ve yazılı bağlantılara sahip ödemeli reklamlara daha çok tı...

  14. Stress Level of University Students

    OpenAIRE

    SAYINER, Banu

    2006-01-01

    Bu araştırmanın ana amacı, üniversite öğrencilerinin stres seviyelerinin çeşitli değişkenlere göre incelenmesidir. Katılımcılar, İstanbul Ticaret Üniversitesi’ne devam eden farklı bölüm ve sınıflardan öğrencilerdir. Ölçeğin ilk bölümünde; cinsiyet, yaş, mezun olunan lise, fakülte, bölüm ve kalınan yerden oluşan “Kişisel Bilgi Formu” bulunmaktadır. Ölçeğin ikinci bölümünde, Baltaş ve Baltaş (2000) tarafından geliştirilen “Stres Ölçeği” yer almaktadır. Elde edilen verilerin analizinde, frekans,...

  15. Şarap Fabrikası Atıklarının Bitkisel Yağ Kaynağı Olarak Değerlendirilmesi

    OpenAIRE

    PEKER, İbrahim

    2014-01-01

    Şarap üretim atığı olan üzüm çekirdeğinden yağın kazanılması için çalışılmıştır. Elde edilen bu yağın sanayide kullanımı ve yenilebilir olmasına yönelik fiziksel ve kimyasal tayinler yapılmıştır. Sokselet ekstraktörü kullanılarak üzüm çekirdeğinden kazanılan yağ yaklaşık %13 olarak bulunmuştur. Üzüm çekirdeği yağının ham yağ olarak sanayide kullanılabileceği, rafine edildikten sonra da yenilebilir olduğu belirlenmiştir.  

  16. Estimations of Radiation Yields for Electrons in Various Absorbing Materials

    Directory of Open Access Journals (Sweden)

    Serkan AKKOYUN

    2016-11-01

    Full Text Available Abstract. In this paper radiation yields for electrons in various absorbing material water, Carbon, Aluminum, Copper, Lead and Uranium in the initial electron energy range between 10 keV to 1 GeV have been estimated. For this purpose artificial neural network method has been used. It has been seen that the results are in good agreement with the available theoretical values. The root mean square error values have been found between 0.00031 and 0.0071 MeV.Keywords: Radiation yield, atomic number, artificial neural networks Özet. Bu makalede, su, Karbon, Aluminyum, Bakır, Kurşun ve Uranyum soğurucu malzemelerinde, 10 keV ile 1 GeV enerji aralığında elektronların radyasyon verimleri kestirildi. Bu kestirim için, yapay sinir ağları metodu kullanıldı. Çalışmada elde edilen sonuçların, mevcut teorik değerler ile uyumlu olduğu görüldü. Kare ortalama karekök hata değeri, 0,00031 ile 0,0071 MeV aralığında bulundu. Anahtar Kelimeler: Radyasyon verimi, atom numarası, yapay sinir ağları

  17. Öğretmen algılarına göre ilk ve ortaokul yöneticilerinin demokratik tutumları ile okul kültürü arasındaki ilişki [The relationship between democratic attitudes of primary and secondary school managers and school culture as measured by teachers’ perceptions

    Directory of Open Access Journals (Sweden)

    Durdağı AKAN

    2014-10-01

    Full Text Available Bu araştırmanın amacı, öğretmen algılarına göre ilk ve ortaokul yöneticilerinin demokratik tutumları ile okul kültürü arasındaki ilişkiyi belirlemektir. Çalışma ilişkisel tarama modelinde tasarlanmıştır. Araştırmada bulundukları okulda en az üç yıl görev yapan 180 ilk ve ortaokul öğretmenine yanıtlamaları için Demokratik Tutum Ölçeği ve Örgüt Kültürü Ölçeği yöneltilmiştir. Elde edilen verilerin analizinde Aritmetik Ortalama, Standart Sapma, Pearson Momentler Çarpımı Korelasyonu ve Basit Doğrusal Regresyon Analizinden yararlanılmıştır. Bulgular, öğretmenlerin algıladıkları okul yöneticilerinin demokratik tutumları ile okul kültürü arasında istatistiksel olarak pozitif yönde anlamlı bir ilişkinin bulunduğunu göstermektedir.

  18. Antalya İlinde Kesme Çiçek Seralarında Bulunan Zararlı Böcek ve Akar Türleri

    Directory of Open Access Journals (Sweden)

    Zeliha TIRAŞ

    2016-09-01

    Full Text Available Antalya ili ve ilçelerinde 2014-2015 yıllarında yürütülen bu çalışmada 28 serada 13 kesme çiçek türünde Insecta sınıfına ait 64 tür ve Arachnida sınıfına ait bir tür saptanmıştır. Elde edilen 16 türün kesme çiçeklerde ekonomik düzeyde zararlı, beş türün ise ana zararlı olduğu belirlenmiştir. Önem sırasına göre bu türler; Tetranychus urticae Koch, Frankliniella occidentalis Pergande, Bemisia tabaci Gennadius, Helicoverpa armigera Hübner ve Spodoptera littoralis Boisduval’dir. T. urticae ve F. occidentalis çalışma yapılan tüm ilçelerdeki kesme çiçek seralarında saptanmıştır. F. occidentalis dokuz, H. armigera yedi, T. urticae üç, B.tabaci iki ve S. littoralis iki farklı kesme çiçek türü üzerinde saptanmıştır.

  19. Çok Etmenli Sistemlerde NetLogo İle Karınca Kolonisi Optimizasyonu

    Directory of Open Access Journals (Sweden)

    Mustafa Tüker

    2013-02-01

    Full Text Available Çok etmenli sistemler (ÇES, karmaşık optimizasyon problemlerinin modellenmesi ve çözülmesi için etkin bir yol sunarlar. Bu çalışmada, Gezgin Satıcı Problemi (GSP'ni çözmek için ÇES ve karınca kolonileri birlikte kullanılmıştır. Sistem benzetimi, etmen tabanlı bir programlama ortamı olan NetLogo ile gerçekleştirilmiştir. Problemin modellenmesi ve benzetimi için NetLogo'nun nasıl kullanılacağı kodlarla ayrıntılı olarak açıklanmıştır. Algoritma farklı düğüm sayıları için denenmiş ve elde edilen sonuçlar tartışılmıştır.

  20. Dijital Koruma (Arşivleme Stratejileri ve Bazı Uygulama Örnekleri

    Directory of Open Access Journals (Sweden)

    Mehmet Emin Küçük

    2003-12-01

    Dijital kaynakların korunması çalışmalarına katkıda bulunmak ve standart­lar, rehberler geliştirmek üzere üniversitelerden ulusal kütüphanelere, uluslara­rası kuruluşlardan derneklere kadar pek kuruluş araştırmalara başlamıştır. Bazı pilot uygulamalar, test çalışmaları gerçekleştirilmiştir. Bu çalışmada, dijital ko­rumaya yönelik bazı araştırma projeleri hakkında bilgi verilmektedir. Kuşkusuz tüm projeleri bir makale kapsamında incelemek olanaklı olmayıp, bunlar arasın­da önemli ve standartlaşma çalışmalarına zemin oluşturacağına inanılan proje­ler, uygulama açısından ele alınmıştır. İlaveten, ilgili projelerin özellikleri ve he­deflenen uygulamalarda elde edilen sonuçlar da makalenin ana temasını oluştur­muştur.

  1. The assesment of modern leadership styles in relation with demographic factors

    OpenAIRE

    Bozkurt, Oznur; Goral, Murat

    2014-01-01

       Liderlik  tarzlarının  demografik  özellikler  açısından  değerlendirildiği  bu  çalışmada,   modern   liderlik   tarzlarından   karizmatik,   işlemsel   ve  dönüşümcü   liderlik   tarzları   üzerinde   durulmuştur.   Nicel   araştırma  yönteminin   kullanıldığı   bu   araştırmada   veriler   anket   tekniği   ile  Ankara’daki  4  ve  5  yıldızlı  otel  işletmelerinin  sahip  ve  yöneticilerinden  toplanmıştır.  Elde  edilen  veriler  SPSS  18  programı  ile  analiz  edilmiştir.  Liderlik ...

  2. Parcacik fizigi en kücügü kesfetme macerasi

    CERN Document Server

    Sekmen, Sezen

    2015-01-01

    Elinizdeki bu kitap biraz yukarı kuark, biraz aşağı kuark ve bir miktar da elektron namlı leptondan yapılmıştır. Bunlara ulaşmak için kitap çok büyük bir teknolojiyle çok küçük parçlara ayrıştırılabilir. Dahası, elde edilen kuark ve leptonlar farklı şekillerde bir araya getirilip kitap çilekli dondurmaya, fötr şapkaya ya da uzay gemisi motoruna da çevrilebilir. Çünkü kuarklar, leptonlar ve bir kısım diğerleri temel parçacıklardır yani evrendeki herşeyin nihai yapıtaşları. Öte yandan eğer kitabı daha faydalı ve ilginç şeylere dönüştürmek yerine okumak tercih edilirse içeriğinde evrenimizi doğumundan bugüne şenlendiren temel parçacıkların ve onları yakalamak için sürekli uğraşan meraklı fizikçilerin heyecanlı hikayesi bulunabilir.

  3. WIN32 API FONKSİYONLARINI KULLANARAK VISUAL BASIC 4 PROGRAMLAMA DİLİNİN 32 BİT VERSİYONUNDA TASARLANAN BİR GÖRÜNTÜ İYİLEŞTİRME ORTAMI

    Directory of Open Access Journals (Sweden)

    Aydın KIZILKAYA

    2000-01-01

    Full Text Available Bu çalışmada, Win32 API (Uygulama programlama arabirimi fonksiyonları ve Windows sisteminin temel prensibi olan MDI (Çok dokümanlı arabirim programlama tekniğini kullanarak Visual Basic 4 programlama dilinin 32-bit versiyonunda tasarlanan bir görüntü iyileştirme ortamı incelenmektedir. Bu ortamda görüntü iyileştirme algoritmaları kolaylıkla uygulanabilmekte ve elde edilen her bir sonuç aynı ortamda ayrı ayrı çerçeveler içerisinde gösterilebilmektedir. Bu ortamda kullanılan görüntü iyileştirme teknikleri; kontrast germe, histogram eşitleme, eşikleme, negatif görüntüleme, alçak geçiren filtreleme, yüksek geçiren filtreleme ve medyan filtrelemedir. Bu ortamda, görüntülerin filtrelenmesi işleminde konvolüsyon (katlama tekniğinden yararlanılmaktadır.

  4. Sarı prenses çiklit (Labidochromis caeruleus Fryer, 1956) balığında embriyolojik ve larval gelişim: morfometrik ve histolojik inceleme

    OpenAIRE

    QARANJIKI , Abdolsaleh

    2017-01-01

    Bu tez ile Afrika çikliti sarı prenses (Labidochromis caeruleus Fryer, 1956) balığının embriyonik ve larval gelişimi incelenmiştir. 27±1 ºC su sıcaklığında havalandırmalı koşullarda tutulan 5 adet dişi damızlıktan (TB:7,46±0,68, K: 1,73±0,16, Toplam yumurta sayısı 140 adet, yumurta verimi: 28,0±13,13 adet/dişi) elde edilen yumurtaların kısa eksen boyu (YKEB) 2,84±0,06 mm (R2=0,53) ve uzun eksen boyu (YUEB) 3,86±0,04 mm (R2=0,24) olarak belirlenmiştir. Döllenmeden sonra ilk bölünme 1,...

  5. MANYETiK DENETiMLi BOBiN iLE ELEKTRONiK BALAST GÜÇ DENETiMi

    Directory of Open Access Journals (Sweden)

    Selim BÖREKCİ

    2008-03-01

    Full Text Available Elektronik balastlar manyetik balastlara kıyasla, daha yüksek etkinlik faktörüne, daha iyi ısık kalitesine, daha uzun lamba ömrüne ve daha küçük hacme sahiptir. Bu çalısmada, lamba gücü, balast empedansını ve rezonans frekansını degistiren manyetik kontrollü bobin tarafından yapılmaktadır ve bu yöntem kendinden tetiklemeli akim beslemeli push pull tipi elektronik balastlarda gerçeklestirilmistir. Burada sunulan güç kontrolü yönteminde, sıfır voltaj anahtarlaması gerçeklestirilmistir. Elde edilen sonuçları karsılastırmak için, sunulan yöntemin aynı zamanda simulasyonuda yapılmıstır. Deneysel ve simulayon sonuçları uyum göstermektedir.

  6. ÖĞRENCİ YURDU KATI ATIKLARININ GERİ KAZANIMININ EKONOMİK AÇIDAN ARAŞTIRILMASI

    Directory of Open Access Journals (Sweden)

    Nilüfer (NACAR KOÇER

    2005-03-01

    Full Text Available Katı atıkların etkin ve verimli bir şekilde toplanması, taşınması, değerlendirilmesi ve uygun bir yöntemle zararsızlaştırılması yerel yönetimler için temel çevresel sorunlardan birisidir. Günümüz şartlarında katı atıkların çevre ve ekonomi açısından en etkin değerlendirilme şekli kaynakta geri kazanımdır. Bu çalışmada; yurtlarda oluşan ve ekonomik değeri bulunan katı atıkların bertaraf yöntemlerinden atık geri kazanma sisteminin Elazığ'da uygulanabilme imkanı araştırılmıştır. Yapılan çalışmadan elde edilen sonuçlar değerlendirilerek, Elazığ öğrenci yurdunda 'kaynakta geri kazanma' sisteminin uygulanmasının yararları ortaya konmuş ve geri kazanılan maddelere ait maliyet analizi yapılmıştır.

  7. HAVA ŞARJLI KÜÇÜK GÜÇLÜ BİR STİRLİNG MOTORUNUN DENEYSEL OLARAK İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Can ÇINAR

    2004-01-01

    Full Text Available Bu çalışmada, imal edilen hava şarjlı, küçük güçlü ? tipi bir Stirling motoru deneysel olarak incelenmiştir. Motor 800, 900 ve 1000 °C olmak üzere 3 farklı sıcak kaynak sıcaklığında, 1, 1.5, 2, 2.5, 3 ve 3.5 bar şarj basınçlarda test edilmiştir. Deneylerde motor gücünün, motor devri, şarj basıncı ve sıcak kaynak sıcaklığı ile değişimi iki farklı ısı transferi yüzey alanı için incelenmiştir. Maksimum çıkış gücü 1000 °C sıcak kaynak sıcaklığında, 3 bar şarj basıncında 441 dev./dak ve 58 W olarak elde edilmiştir. Yüksüz motor devri 846 1/min olarak ölçülmüştür.

  8. Üç Macar Fiği (Vicia pannonica Crantz.) Çeşidinde Farklı Dozlarda Gama Işını Uygulamasının M2 generasyonunda Bazı Bitkisel Özellikleri Üzerine Etkileri

    OpenAIRE

    BAĞCI, Muhittin; Mutlu, Hüseyin

    2015-01-01

    Bu çalışma, “Macar fiği (Vicia pannonica Crantz.) Bitkisinde Gama Işını Uygulaması ile Mutasyon Islahı” projesinin M2 generasyonunu kapsamaktadır. Araştırma, üç Macar fiği çeşidinde, gama ışını dozlarının M2 generasyonunda, bazı bitkisel özellikler üzerine etkilerini belirlemek ve kontrol doz (0 Gy) uygulaması ile karşılaştırmak amacıyla yürütülmüştür. Araştırmada, üç Macar fiği çeşidinin (Tarmbeyazı-98, Anadolupembesi-2002 ve Oğuz-2002) M1 bitkilerinin tohumları ekilmiştir. Elde edilen M2 bi...

  9. Milföy Hamurunun Isıl Yayınım Katsayısının Sıcaklıkla Değişiminin Belirlenmesi

    OpenAIRE

    Kumcuoğlu, Seher; Tavman, Şebnem

    2006-01-01

     Bu çalışmada milföy hamurunun ısıl yayınım katsayısı modifiye edilmiş Dickerson metodu kullanılarak -35 °C ile +10 °C sıcaklık aralığında deneysel olarak ölçülmüştür. Örneğin donmuş durumdaki ısıl yayınım katsayısının donmamış durumuna ait ısıl yayınım katsayısından daha yüksek olduğu ve sıcaklığın artmasıyla azaldığı tespit edilmiştir. Donmuş durum için elde edilen ölçüm sonuçlarına regresyon analizi uygulanarak milföy hamurunun ısıl yayınım katsayısının sıcaklıkla değişimini veren empirik ...

  10. Veri Madenciliği Teknikleri Kullanılarak Ortaokul Öğrencilerinin Sosyal Ağ Kullanım Analizi: Kocaeli İli Örneği

    Directory of Open Access Journals (Sweden)

    Meltem KURT PEHLİVANOĞLU

    2015-04-01

    Full Text Available Günümüzde sosyal ağ kullanımı oldukça artmıştır. Bu çalışmada Kocaeli İlinde yer alan Ulusal Egemenlik Ortaokulu öğrencileri üzerinde anket uygulaması gerçekleştirilmiş, toplanan anket sonuçları veri madenciliği teknikleri kullanılarak analiz edilmiştir. 28 sorudan oluşan anket, öğrencilerin temel özellikleriyle (cinsiyet, uyku durumu, başarı durumu vb. sosyal ağlar (Facebook, Instagram ve Twitter üzerindeki faaliyet durumları (gün içinde ortalama internet kullanımı, hangi ağları kullandığı vb. arasındaki ilişkiyi tespit etmeyi amaçlamıştır. Elde edilen veriler WEKA ya uygun formata dönüştürülüp, Apriori algoritmasıyla öğrencilerin sosyal medyayı niçin kullandığı ve bu kullanımın öğrenciler üzerinde ne gibi etkiler yarattığına dair kurallar çıkarılmıştır.

  11. Cis-2,6-bis(2-klorofenil-3,3-dimetilpiperidin-4-one bileşiği üzerine yapısal, spektroskopik, elektronik ve doğrusal olmayan optiksel araştırmalar

    Directory of Open Access Journals (Sweden)

    Ömer Tamer

    2016-12-01

    Full Text Available Piperidin, heterosiklik moleküller arasında en iyi bilinen yapılardan biridir. Güncel çalışmalar bu tür bileşiklerin yapı-doğrusal olmayan optiksel performans ilişkisine odaklanmaktadır. Doğrusal olmayan optik malzemelerin fiber optik iletişim ve optik sinyal işlemlerinde hayati öneme sahip oldukları bilinmektedir. Bu çalışmada, bir piperidin türevi olan cis-2,6-bis(2-klorofenil-3,3-dimetilpiperidin-4-one (2C3DMPO bileşiğinin yapısal, spektroskopik, elektronik ve doğrusal olmayan optik özellikleri analiz edilmiştir. 2C3DMPO için elde edilen teorik sonuçlar deneysel değerler ile iyi bir uyum içindedirler. NMR spektrumunda, elektronegatif O atomundan dolayı, C4 atomu aşağı alanda sinyal vermiştir. HOMO ve LUMO arasındaki küçük enerji aralığı, bağ ve antibağ yörüngeleri arasındaki yoğun etkileşmeler yüksek doğrusal olmayan optik özelliklerin göstergesidir.

  12. The Larval Development of Penaeus semisulcatus (de Hann, 1850 (Decapoda: Penaeidae.

    Directory of Open Access Journals (Sweden)

    Gürel Türkmen

    2015-12-01

    Full Text Available Penaeus semisulcatus (de Hann, 1850 (Decapoda: Penaeidae’un larval gelişimi. Penaeus semisulcatus’un yapay üretimi üzerine olan çalışma Haziran, 2001 tarihinde Çeşme-İzmir’de bulunan Pınar Deniz Ürünleri (Balık Çiftliği’nde gerçekleştirilmiştir. Çalışmada yumurta almak amacıyla kullanılan olgun dişi bireyler Antalya’dan getirilmiştir. Elde edilen yumurtalar laboratuar koşullarında post larval aşamaya kadar yetiştirilmiştir. Laboratuarda yetiştirilen bireylerin larval aşamaları tanımlanmış ve fotoğraflanmıştır. Larval dönemlerde Isochrysis sp. ve Artemia nauplii yem olarak kullanılmıştır. Altı naupliar, üç protozoeal, üç mysis ve ilk postlarval dönem ana hatlarıyla tanımlanmıştır. P. semisulcatus’un larval morfolojisi diğer Penaeus türleri ve bu tür ile ilgili önceki çalışmalarla karşılaştırılmıştır

  13. Türkiye’de Kayıtdışı Ekonominin Boyutunun Tahmini

    Directory of Open Access Journals (Sweden)

    Asiye TÜTÜNCÜ

    2016-07-01

    Full Text Available Bu çalışmada amaç, Türkiye’de kayıtdışı ekonominin boyutunu tahmin etmektir. 2005:4-2013:4 dönemini kapsayan İstihdam Yaklaşımına göre, kayıtdışı istihdamın kurumsal olmayan nüfusa oranı, ortalama %5 olarak tahmin edilmiştir. 2005:4-2015:2 dönemi kullanılarak Basit Parasal Oran Yaklaşımı ile hesaplanan kayıtdışı ekonominin GSYİH'ya oranı ortalama %8 olarak bulunmuştur. Ayrıca elde edilen bulgular, kayıtdışı ekonomi faaliyetlerinin, ekonomik kriz döneminde artış eğilimine sahip olduğunu göstermektedir.

  14. AISI 304 ÖSTENİTİK PASLANMAZ ÇELİKLERİN TİTANYUM KARBÜR KAPLAMALI KESİCİ TAKIM İLE TORNALAMA İŞLEMİNDE KESME KUVVETLERİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Özgür TEKASLAN

    2007-02-01

    Full Text Available Bu araştırmada, AISI 304 östenitik paslanmaz çeliklerin titaniyum karbür kaplı kesici takımlarla tornalama işleminde oluşan kesme kuvvetleri deneysel olarak incelenmiş ve elde edilen sonuçlar teorik sonuçlarla karşılaştırılmıştır. Deneysel çalışmada, farklı kesme hızları, ilerleme değerleri ve kesme derinlikleri dikkate alınmıştır. Kesme kuvvetleri üç boyutlu kistler dinanometre ile ölçülmüştür. Teorik çalışmada ise; Kienzle formülasyonuna göre kesme kuvvetleri belirlenmiştir. Çalışma sonucunda teorik olarak hesaplanan kesme kuvvetlerinin çeşitli etkenler nedeni ile tam sonucu vermediği, deneysel sonuçlara göre; ortalama % 25'lik fark olduğu tespit edilmiştir. Bu nedenle kesme kuvvetlerinin belirlenmesinde deneysel yöntemin daha kesin sonuçlar verdiği değerlendirilmektedir.

  15. Fosfat Kayasının İzotermal Olmayan Bozunma Kinetiği

    Directory of Open Access Journals (Sweden)

    Hatice Bayrakçeken

    2014-07-01

    Full Text Available Mazıdağı fosfat kayasının inert ( N2 ortamda ısıl bozunma kinetiği 2, 5, 10 ve 20 K dak-1 ısıtma hızlarında termal analiz teknikleri (TG/DTG ile incelendi. TG ve DTG ölçümlerinde 873-1173 K sıcaklık aralığında fosfat kayasının ısıl bozunmasının tek basamaklı bozunma olduğu görüldü. TG ve DTG eğrilerinden elde edilen verilere eş dönüşüm metotları Kissinger–Akahira–Sunose (KAS ve Flynn-Wall-Ozawa (FWOuygulanarak aktivasyon enerjileri sırasıyla 170 ve 187 kJmol-1 olarak bulundu. Fosfat kayasının ısıl bozunmasının çekirdeklenme ve büyüme (-ln(1-α2/3 mekanizmasına göre meydana geldiği belirlendi. Ön üssel faktör (ln A ise 20.47 olarak tespit edildi.

  16. Kadın İstihdamının Ekonomik Büyümeye Etkisi: OECD Ülkeleri İçin Panel Veri Analizi

    OpenAIRE

    Dücan, Engin; Atay Polat, Melike

    2017-01-01

    Kalkınma sürecinde sosyal yapıdaki değişimlerin birini temsil eden kadın işgücüne katılım oranı; ekonomik kalkınmanın sağlanması, eğitim düzeyinin yükselmesi, refah düzeyindeki artışlar ve teknolojik gelişmeler neticesinde hızla artmaya başlamıştır. Bu çalışmada, OECD ülkelerinde, kadın iş gücüne katılımının GSYİH üzerindeki etkisi panel veri analizi ile araştırılmıştır. Elde edilen bulgulara göre, OECD ülkelerinde kadın/erkek işgücüne katılım oranındaki artış GSYIH artışı üzerinde negatif et...

  17. Ekmeklik Buğdayların Kalitelerinin Belirlenmesinde Miksograf Kullanımı Üzerine Araştırmalar

    Directory of Open Access Journals (Sweden)

    Ayhan Atlı

    2015-02-01

    Full Text Available Bu araştırmanın amacı miksograf cihazından elde edilen bulguların diğer kalite kriterleri ile ilişkisini saptamak ve miksografın kalite değerlendirmesinde ne derecede etkili olduğunu belirlemektir. Araştırmada miksograf bulgularının zayıf ve kuvvetli kalitedeki çeşitleri birbirinden ayıracak özellikte olduğu ve çeşitli kalite kriterleri ile önemli düzeyde korelasyon gösterdiği belirlenmiştir. Araştırma sonuçlarına göre, miksograf ile kalite belirlemede en etkili kriterlerin kurve yüksekliği, maksimum konsistens ve alan değerleri olduğu saptanmıştır.

  18. İlköğretim 4. Ve 5. Sınıf Öğrencilerinin Matematik Etkinliklerine Yönelik Tutum Ölçeği Geliştirme

    OpenAIRE

    OCAK, Gürbüz; Dönmez, Sümbül

    2010-01-01

    Bu çalışmada, İlköğretim 4. ve 5. sınıf öğrencilerinin matematik etkinliklerini uygulamaya yönelik tutumlarını ölçmek amacıyla bir ölçek geliştirilmesi amaçlanmıştır. Matematik etkinlikleri tutum ölçeği, 4 ve 5. Sınıf öğrencilerinin görüşleri doğrultusunda geliştirilmiştir. Ölçek 40 maddeden oluşan likert tipi bir ölçektir. Ölçeğin geçerlik ve güvenirliği ilköğretim 4. ve 5. sınıf öğrencileri arasından tesadüfî örnekleme yöntemiyle seçilen 200öğrenciden elde edilen veriler üzerinde yapılmıştı...

  19. Aerobik kapasitenin belirlenmesinde kullanılan saha ve laboratuvar testlerinin karşılaştırması

    OpenAIRE

    Alemdaroğlu, Utku

    2008-01-01

    Bu araştırma, maksimal oksijen tüketimini belirlemek için kullanılan Bruce, Mekik ve Yo-yo testlerinden formüller yardımıyla elde edilen indirekt VO2maks-tahmin değerleriyle, bu testlerde oksijen analizörü kullanılarak belirlenen direkt VO2maks-ölçüm değerinin karşılaştırılması amacıyla yapılmıştır. Araştırmaya Denizli ili 1. amatör kümesinde farklı takımlar da futbol oynayan, yaş ortalamaları 21.92 ± 2.58 yıl, boy ortalamaları 176.14 ± 8.55 cm ve vücut ağırlıkları 72.28 ± 6.82 kg olan 14 spo...

  20. Mahmudiye-Alpu (Eskişehir) arasının jeotermal enerji potansiyeli’nin belirlenmesi

    OpenAIRE

    Taşkıran, Lütfi

    2015-01-01

    Bu tez çalışması kapsamında, Mahmudiye-Alpu (Eskişehir) ilçeleri arasındaki belirlenen çalışma alanının jeolojik, hidrojeolojik ve hidrojeokimyasal inceleme ve araştırması yapılarak, elde edilen bulgular ışığında çalışma alanının jeotermal enerji potansiyelini ortaya koymaya yönelik değerlendirmeler yapılmıştır. Çalışma alanı, Eskişehir İl merkezine 45 km uzaklıkta olup, yaklaşık olarak 400 kilometrekare’lik bir alanı kapsamaktadır. Çalışma alanının yer aldığı bölgede temelde Triyas yaşlı ...

  1. Taze ve İşlenmiş Gümüş Balığının (Atherina boyeri Risso, 1810 Mikrobiyolojik Kalitesi.

    Directory of Open Access Journals (Sweden)

    Fatma Arık Çolakoğlu

    2015-12-01

    Full Text Available Bu çalışmada, bir tatlı su balığı olan ve yoğun olarak ihracatı yapılan gümüş balığının (Atherina boyeri Risso,1810 mikrobiyolojik kalitesi incelenmiştir. Taze, donmuş ve panelenerek dondurulmuş üç ürüne ait numunelerde, hijyenik kalite adına toplam aerobik bakteri sayısı, Koliform grubu ve fekal Streptococcus bakterileri araştırılmıştır. Elde edilen sonuçlarda, ürünler arasında Koliform grubu ve fekal Streptococcus bakteri içeriğinde farklılıklar tespit edilmiş, toplam aerobik bakteri sayısında ise ürünler arasında bariz bir farklılığa rastlanmamıştır. Taze, donmuş ve panelenerek dondurulmuş gümüş balığı ürünlerinde toplam aerobik bakteri sayısı 4,1x104 – 9,8x104 kob/g arasında tespit edilmiştir. Koliform grubu bakteri içeriği donmuş ürünlerde

  2. Tek Tesirli Yapıştırma Bağlantılarında İlerlemeli Hasar Analizi

    Directory of Open Access Journals (Sweden)

    Kadir TURAN

    2010-03-01

    Full Text Available Bu çalışmada, iki kompozit levhayı birleştirmek için yapıştırıcı kullanılarak elde edilmiş olan tek tesirli yapıştırma bağlantısının hasar analizi deneysel ve sayısal metotlar kullanılarak araştırılmıştır. Bağlantı yapılırken yapıştırıcı olarak epoksi reçine ve yapışan olarak ta karbon fiber takviyeli epoksi reçine matriksli dört tabakadan oluşan kompozit levhalar kullanılmıştır. Sayısal çalışma sonlu elemanlar metodunu kullanarak çözüm yapan ANSYS programında yapılmıştır. Sayısal hasar yüklerini elde etmek için ilerlemeli hasar analizi metodu malzeme indirgeme kuralları ile birlikte kullanılmıştır. Hasar analizinde kompozit levhalar için Hashin Hasar Teorisi kullanılırken yapıştırıcı için Maksimum Asal Gerilme Hasar Teorisi kullanılmıştır. Bağlantı mukavemeti üzerine yapıştırıcı kalınlığı, bindirme uzunluğu ve plaka genişliğinin etkisi sayısal olarak araştırılmıştır. Sonuç olarak yapışma yüzey alanının değişiminin hasar yükleri üzerinde etkili olduğu görülmüştür. Elde edilen sonuçlar tablolar ve grafikler halinde sunulmuştur.

  3. SERBEST UCUNDAN TEKİL BİR YÜKE MARUZ POLİMER MATRİKSLİ KOMPOZİT ANKASTRE BİR KİRİŞ İÇİN ELASTO-PLASTİK GERİLME ANALİZİ

    Directory of Open Access Journals (Sweden)

    Ayla TEKİN

    2004-03-01

    Full Text Available Bu çalışmada, serbest ucundan P yüküne maruz tek yönlü fiberlerle takviye edilmiş polimer matriksli kompozit ankastre bir kiriş için anizotrop elastisite teorisi kullanılarak elasto-plastik gerilme analizi yapılmıştır. 0°, 30° 45°, 60° ve 90° oryantasyon açıları için akma noktaları hesaplanarak ?x kalıntı gerilme bileşenleri elde edilmiştir. Akma, 0° ve 90° oryantasyon açıları için kirişin en alt ve en üst yüzeylerinde aynı anda başlamaktadır. 30°, 45°ve 60° oryantasyon açıları için ise kirişin en üst yüzeyinde akmanın daha önce başladığı görülmüştür. Kirişin en alt ve en üst yüzeylerinde ?x kalıntı gerilme bileşeni maksimumdur. Bu çalışmanın sonucunda tek yönlü fiberlerle takviye edilmiş polimer matriksli kompozit kiriş için elde edilen ?x kalıntı gerilme bileşenleri, daha önceki alışmalarda örgü fiberlerle takviye edilmiş termoplastik matriksli kompozit kiriş için elde edilmiş olan ?x kalıntı gerilme bileşenleri ile karşılaştırılmıştır.

  4. Coğrafya Konuların Öğretiminde Materyal Kullanımının Öğrenci Başarısına Etkisi: Bir Meta Analiz Çalışması / The Effect of the Usage of Instructional Materials on Student Achievement in Teaching Geography: A Meta-analytic Study

    Directory of Open Access Journals (Sweden)

    Yusuf İnel

    2017-06-01

    Full Text Available Abstract This study aims to combine the results of independent studies in order to reveal the impact of the usage of instructional materials in teaching geography subjects on students’ achievement. We have tried to answer the question “Do the instructional materials in teaching geography subjects impact on students’ achievement?”. The study is performed via meta-analysis. The total sampling size obtained from 31 studies included in analysis. The data were analyzed using STATA 13. and CMA 3 programs. When analyzing the data, the values of standard deviation, arithmetic average and sampling size of postest measures of control and experimental groups in each study were used. The results of this study indicate that the usage of instructional materials in the teaching geography subjects impacts positively on students’ achievementat at wider effect size. They also show that there is no any statistically difference among effect size by sampling stage (high school, the material type used, research type, and publication years of studies.  Öz Bu çalışmada, coğrafya konuların öğretilmesinde kullanılan materyallerin öğrenci başarısı üzerindeki etkisinin tespit edilmesine yönelik yapılmış birbirinden bağımsız çalışmalardan elde edilen sonuçların birleştirilmesi amaçlanmıştır. Bu amaç dâhilinde, “Coğrafya Konuların Öğretiminde Kullanılan Materyaller, öğrencilerin akademik başarılarını etkilemekte midir?” sorusuna cevap aranmıştır. Çalışma, meta analiz yöntemiyle gerçekleştirilmiştir. Analize dahil edilen 31 çalışmadan elde edilen toplam örneklem büyüklüğü 2138 dir. Verilerin analizinde STATA 13 ve CMA 3 programları kullanılmıştır. Verileri analiz ederken her bir çalışmanın kontrol ve deney grubunun sontest ölçümlerinden standart sapma, aritmetik ve örneklem büyüklüğü değerleri kullanılmıştır. Çalışma sonucunda, coğrafya konuların öğretiminde kullan

  5. Sağlık ve Eğitim Vakfı (SEV / Amerikan Bord Heyeti (ABH Okulları Öğrenci ve Öğretmenlerinin Okul Kütüphaneleri Hakkındaki Görüşleri Üzerine Bir Araştırma

    Directory of Open Access Journals (Sweden)

    Atakan Aydın

    2012-03-01

    Full Text Available Bu rapor “Okul Kütüphanelerinin Öğrencilerin Öğrenimlerine Yaptığı Katkıyı Gösteren Kanıtlar Nelerdir?” sorusunu, 2009 ilkbahar ve sonbahar döneminde altı özel okulda (İstanbul, İzmir ve Tarsus ’ta faaliyet gösteren üç ilköğretim okulu ve üç lise 6-12. sınıf seviyesinden 1593 öğrenci ve 340 öğretmenin (anaokulu, il­köğretim ve lisede görevli katılımıyla gerçekleştirilmiş “Kütüphane Anketi”nden elde edilen istatistiksel ve niteliksel kanıtlar ışığında yanıtlar. Bu anket, araştır­manın yapıldığı okulların yönetiminden sorumlu Sağlık ve Eğitim Vakfı’na, kü­tüphanelerin başarısını ortaya koyan istatistiksel göstergeler sunmak amacıyla gerçekleştirilmiştir. Bu anketle konuya ilişkin hem istatistiksel hem de açık uçlu veriler elde edilmiştir. İstatistiksel veriler için öğrenci ve öğretmenlerden kütüp­haneden aldıkları yardıma ilişkin 27 soruyu yanıtlamaları istenmiştir. Soruların çoğu 2002 tarihinde Ohio Eğitimsel Kütüphane ve Medya Derneği (OELMA ta­rafından gerçekleştirilen kütüphane anketinden alınmış ve Türkçeye çevrilmiştir. Kütüphaneden elde edilen yardıma ilişkin 27 soru 7 ana grup altında bölümlere ayrılmış ve ortalamaları alınmıştır. Niteliksel veri için öğrencilerden kütüphane­den aldıkları yardıma ve bu yardım sayesinde ne yapabildiklerine ilişkin bilgi vermeleri ve “Kütüphane nasıl olsaydı daha iyi olurdu?” sorusunu yanıtlamaları istenmiştir.

  6. Effect of Different Cooling Rates on Embryo Survivability and Pregnancy Rates in Freezing Sheep Embryos

    Directory of Open Access Journals (Sweden)

    Elif KARAMAN ÖZTÜRK

    2016-07-01

    Full Text Available Çalışmanın ilk bölümünde, mezbahadan sağlanan ovaryumlardan kazanılan oositler (n=2990 olgunlaştırma medyumu içerisinde 24 saat süreyle olgunlaştırıldı. Ardından, 20 saat süreyle İn Vitro Fertilizasyona (İVF bırakıldılar. Yarıklanma gösteren embriyolar (n=1305, Sentetik Ovidukt Fluid (SOF medyumu içerisine alınarak altı gün süresince İn Vitro Kültüre (İVK bırakıldılar. İVK sonrası elde edilen morula-blastosist aşamasındaki embriyolar rastlantısal şekilde üç farklı dondurma hızı grubuna eşit olarak ayrıldılar (Grup I: 0,5 °C /dk, Grup II: 0,8 °C /dk, Grup III: 1 °C /dk. Her bir gruptaki embriyolar (n=50, 1,5 M etilen glikol bulunan dondurma medyumu içerisinde farklı soğutma hızlarında donduruldu. Sonuçta 0,5 °C/dk soğutma hızının en başarılı grup olduğu belirlendi (P<0,05. Çalışmanın ikinci bölümünde, verici koyunlardan elde edilen in vivo embriyolar (Morula-Blastosist çalışmanın birinci bölümünde bulunan en başarılı soğutma hızı (0,5 °C/dk ile soğutularak donduruldu. Dondurulan 19 adet embriyo hormonel olarak hazırlanmış 17 alıcı koyuna transfer edildi. Transfer sonrası 60. günde yapılan ultrason muayenesinde üç adet koyunda gebeliklere ait embriyonik keseler gözlendi ve bu koyunlardan birinde de ikiz gebelik saptandı. Gebe koyunlardan bir tanesinde doğum gerçekleşti; diğer iki koyunda ise ileriki dönemde yapılan ultrason muayenesinde gebeliklerin sonlandığı gözlendi. Çalışma sonucunda, koyun embriyolarının dondurulması sırasında 0,5°C/dk soğutma hızının en başarılı hız olduğu ve bu yöntemle dondurulan embriyoların transferinden de gebelik elde edilebildiği saptandı.

  7. Dicty_cDB: CHI127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VAAKISDSDKSTIESETESVLK WLESNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVD ELD*rnfseenisik*is*kiis**nq*sxliyst...VAAKISDSDKSTIESETESVLK WLESNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVD ELD*rnfseenisik*is*kiis**nq*sxliyst

  8. Effect of CNG manifold Injection on the Performance, Combustion and Emission characteristics of a CNG -Biodiesel Dual Fuel Operation/Bir manifolda enjekte edilen CNG-Biyodizel Çift Yakıt Çalışmasının Perf.,Yanma ve Emisyon Karakteristikleri Üzerine Etkisi

    OpenAIRE

    Banapurmath, Nagaraj Ramalingayya; Y., Basavarajappa H.

    2016-01-01

    Energy demand at a global level is increasing day by day and fossil fuel resources are on the verge of becoming extinct. The drastic increase of the oil prices in the global oil market and the increased pollution levels created an interest to find renewable, sustainable and alternative fuels. Natural gas (NG) is considered as a most prominent alternative fuel due to its many advantages including its ready availability and its low emission levels. A diesel engine was converted to operate in du...

  9. Barış Harekâtı Sonrasında Türkiye’den Kıbrıs’a Yapılan Göçler Ve Tatbik Edilen İskân Politikası Immigration From Turkey To Cyprus After Peace Operation And Following Settlement Policy

    Directory of Open Access Journals (Sweden)

    İsmail ŞAHİN

    2013-09-01

    Full Text Available In order to close the gap in the population of Northern Cyprusthat occurred after Cyprus Peace Operation, it was organized theresettlement from Turkey to island. In this context, among people whocame to the island, three groups can be defined. There were soldiersand their families who were involved in Peace Operation of 1974,agricultural labor force, and people who migrated of their own accord.The properties remained after Greek Cypriots were distributed amongnewcomers after they have been admitted to the citizenship. Called as“Turkish immigrants”, this group played a significant role in the rapiddevelopment of Northern Cyprus. However, because of absence ofplanned settlement policy, long term economic development fell intostagnation what, by-turn, caused social problems. Social problemsbetween Turkish Cypriots and Turkish immigrants have beenincreasingly deepened by already existed religious, social, and culturaldifference between these groups. Social problems provoked byimmigrants, differences between these two groups, and introduced inthe political frameworks wrong policies interrupted the socialintegration of Northern Cyprus.This paper aims to study the reasons of migration to Cyprus after1974, the resettlements to the island, and the problems faced bymigrants there. In this regard, the legal status and the opportunitiesoffered to Turkish immigrants, the way how migrants encounter withthe Turkish Cypriots, problems they have experienced, and theirrelations with Greek Cypriots living in the north of the island arediscussed. In this study, legal regulations, eye-witness interviews,newspaper reports, and official documents are used to research theissue. Kıbrıs Barış Harekâtı sonrasında Adanın kuzeyinde ortaya çıkan nüfus boşluğunu kapatmak üzere Türkiye’den Adaya nüfus nakli yapılmıştır. Bu kapsamda; 1974 Barış Harekâtı’nda görev alan askerler ve yakınları, tarım işgücü ve kendi başına gelenler olmak üzere üç grup insan Adaya gelmiştir. Gelen bu insanlar, önce vatandaş yapılmış ardından yapılan yasal düzenlemelerle, onlara Rumlardan kalan mülkler dağıtılmıştır. ‘Türkiyeli göçmenler’ olarak adlandırılan bu grup kısa zamanda Kuzey Kıbrıs’ın kalkınmasında önemli rol oynamıştır. Ancak iskân politikasının, planlanan düzeyde olmaması nedeniyle uzun vadede ekonomik kalkınma sekteye uğramış ve Adanın kuzeyinde toplumsal huzursuzluklar baş göstermiştir. Türkiyeli göçmenler ile Kıbrıslı Türkler arasında ortaya çıkan toplumsal huzursuzluklar, zamanla iki grup arasında var olan dini, siyasi, sosyal ve kültürel farklılardan dolayı da artarak derinleşmiştir. Bir taraftan göçmen olmanın yaratmış olduğu sosyolojik sorunlar, diğer taraftan da iki grup arasındaki farklılıklar toplumsal bütünleşmeyi geciktirdiği gibi, siyasi çevrelerin tatbik ettiği yanlış politikalar da Kuzey Kıbrıs’ta toplumsal bir birlikteliğin oluşmasını kesintiye uğratmıştır.Bu çalışma, 1974 sonrası Kıbrıs’a göç eden insanların göç nedenlerini, Adaya iskânlarını ve orada karşılaştıkları sorunları araştırmayı amaçlamaktadır. Bu bağlamda, Türkiyeli göçmenlere verilen yasal statü ve sunulan imkânlar, göçmenlerin Kıbrıslı Türklerle karşılaşmaları, yaşadıkları problemler ve göçmenler ile Adanın kuzeyinde kalan Rumların ilişkileri ele alınmıştır. Çalışmamızda, yasal düzenlemelere, görgü tanıklarına, gazete haberlerine, resmi belgelere ve konu üzerine yapılan araştırmalara yer verilmiştir.

  10. Yetişkin Çalgı Öğretmeni Özellikleri Qualifications of Adult Musical Instrument Teachers

    Directory of Open Access Journals (Sweden)

    Şebnem YILDIRIM ORHAN

    2012-12-01

    amatör çalgı eğitimi alan 33 yetişkine çalgı öğretmeninin hangi karakteristik özelliklere ve mesleki becerilere sahip olması ile ilgili sorular sorulmuştur. Araştırmada kuramsal veriler alan araştırması/belgesel kaynak tarama yoluyla, nicel veriler ise uzman görüşüne dayalı oluşturulan anket ve görüşme ile elde edilmiştir.Anket aracılığıyla elde edilen nicel veriler; frekans (f ve yüzde (% dağılımı ile tablolaştırılmıştır. Ankette yer alan açık uçlu sorular ve görüşme yoluyla elde edilen cevaplardaki benzer ifadeler bir araya getirilerek bulgularda tablolaştırılmıştır. Tablolar yetişkinlerin kendi ifadelerine göre oluşturulmuştur.Anket ve görüşmelerden elde edilen sonuçlara göre; yetişkin çalgı öğretmeninin karakteristik özellikleri konusunda %90 oranında güler yüzlü, hoşgörülü, dostça davranan, sabırlı, empati kurabilen, sevecen, idealist, esnek ve geçimli olması ile mesleki beceriler konusunda öncelikle öğretmeninin çalgısını en üst düzeyde öğretebilme becerisine sahip olmasını, ankete katılan yetişkinlerin %76’sının derse çalışamadan gittiklerinde öğretmenin tavrının olumlu olması, %24’ünün ise olumsuz olması görüşünde oldukları, çalgı öğretmeninin çalgıyı sevdirebilmesini, sonra çalgısını iyi düzeyde çalması ile deneyimli olmasını önemsedikleri sonuçlarına ulaşılmıştır.

  11. Matruşka Göç İstismar Eğitim Eksikliği Negatif Ailesel Faktörler ve Çocuk Suçluluğu

    Directory of Open Access Journals (Sweden)

    Akın Tütüncüler

    2008-12-01

    Full Text Available Göç etme ve istismara maruz kalma ile ilgili geçmiş yaşantıların çocuk suçluluğu üzerindeki olumsuz etkisi bilinmektedir. Ani-plansız ve özellikle ekonomik nedenlerle yapılan göç, aile içerisinde öfke ve saldırganlığa yol açarak çocuğun diğer aile bireyleri tarafından istismar edilmesine neden olabilmektedir. Bu çalışmada; Ocak 1994-Aralık 2004 tarihleri arasında Antalya Adli Tıp Şube Müdürlüğü’ne muayene için gönderilen ve haklarında herhangi bir suç işleme ya da suça iştirak etme iddiası bulunan 1163 çocuğa birebir anket uygulanmıştır. Katılımcılara yaş, cinsiyet, işlediği iddia edilen suçlar, göç öyküsü olup olmadığı ve göç öyküsü varsa nereden göç ettiği, fiziksel istismara uğrayıp uğramadığı, uğruyorsa kimler tarafından istismar uygulandığı, çocuğun ve anne-babasının eğitim düzeyi, aile nüfusu, kardeş sayısı, aynı odada uyuduğu kişi sayısı, çalışıyorsa işi, eski suç öyküsü, konularında sorular yöneltilmiştir. Elde edilen bulgular ilgili kaynakların ışığında değerlendirilmiştir. Anahtar kelimeler: Göç, çocuk suçluluğu, çocuk istismarı

  12. Labraunda’nın Yeni Bilmecesi: Su Kompleksi Kazıları 2013-2015 Kazı Sezonu Değerlendirmesi / The Mistery of Labraunda: Water Complex Excavations between 2013-2015

    Directory of Open Access Journals (Sweden)

    Ömür Dünya Çakmaklı

    2016-10-01

    2013-2015 Kazı Sezonu Değerlendirmesi  Öz Milas’ın 13 km. kuzeydoğusunda yer alan ve Karia Bölgesinin en görkemli, en iyi korunmuş alanlarından olan Zeus Labraundos Kutsal alanı, Karia tarihini aydınlatmada anahtar konumdadır. Halen devam eden kazı çalışmaları, alana ait bu tarihin detaylandırılmasına ilişkin oldukça önemli bilimsel verileri günümüze ulaştırmıştır. Bununla birlikte alana ayrıcalıklı bir önem kazandıran; Karia Bölgesinin ve esas olarak Labraunda’nın içinde yer aldığı Milas Bölgesi ve İç Karia’nın günümüzde dahi önemini koruyan “su” kaynakları ve bu kaynaklarla ilintili yapıları henüz hak ettiği odağa tam olarak kavuşamamıştır. 2013 yılında, temenosun çevresinde yoğunlaşan düzenleme çalışmaları esnasında beklenmedik bir şekilde tespit edilen “Su Kompleksi” yapısı, kutsallık özelliğini su’dan alan Labraunda’da geliştirilen su sistemi mekanizmasını çözümlemede oldukça faydalı olacaktır. Bu makalede 2013-2015 kazı sezonunda elde edilen bilgi ve bulgular paylaşılmıştır.

  13. ALIŞVERİŞ MERKEZLERİNİN MARKA KİŞİLİKLERİNİN KARŞILAŞTIRILMASI, İSTANBUL İLİNDE BİR UYGULAMA-COMPARISION on BRAND PERSONALITY of SHOPPINGCENTERS, A PRACTISE in ISTANBUL CITY

    Directory of Open Access Journals (Sweden)

    Şakir ERDEM

    2012-06-01

    Full Text Available Perakendecilik sektöründe yer alan Galleria ve Akmerkez alışveriş merkezleri marka kişiliklerinin karşılaştırılmasını yapmak ve tüketicilerin alışveriş merkezi tercihlerinde alışveriş merkezlerine atfettiği kişilik boyutlarını ve özelliklerini ortaya çıkarılabilmek amacıyla J. Aaker’ın 1997’de geliştirdiği beş ana marka kişiliği boyutu ve bu boyutların altında toplanan kişilik özellikleri temel alınmıştır. Marka kişiliğine ilişkin literatür taraması yapılmış; araştırma yöntemi olarak nitel araştırma ve nicel araştırma yöntemlerinin birleşmesinden meydana gelen karma araştırma yaklaşımı benimsenmiştir. Nitel veri toplanma araçlarından olan odak grup görüşmesinden faydalanılarak, nicel araştırmanın anketlerinin oluşturulmasında yararlı olabilecek bilgiler ve nicel araştırma örneklem yapısı ve yöntemine ışık tutan bilgiler elde edilmesi sağlanmıştır.  Nicel araştırmada veri toplama aracı olarak anket yöntemi uygulanmış, analiz yapılmaya uygun 272 adet anket elde edilmiştir. Anket sonuçları SPSS programı yardımıyla kodlanmış, verilerin frekans ve yüzde dağılımları verilerek faktör analizleri, güvenirlik analizleri ve T-testi yapılmıştır.  Araştırma sonucunda, alışveriş merkezi sektöründe marka kişiliğine dair dört boyut elde edilebilmiş; elde edilen dört boyut Galeria ve Akmerkez alışveriş merkezleri arasında karşılaştırılmıştır.- The present research aims to compare brand personalities of Galeria and Akmerkez shopping centers and to examine the brand personality traits and dimensions that consumers refer on shopping centers preferences. Research based on J. Aaker’s five dimensions of brand personality and the traits. We looked over the literature of brand personality. This research included pluralistic methodology: First, focus groups method was used to take qualitative research’s survey, sampling

  14. ALIŞVERİŞ MERKEZLERİNİN MARKA KİŞİLİKLERİNİN KARŞILAŞTIRILMASI, İSTANBUL İLİNDE BİR UYGULAMA-COMPARISION on BRAND PERSONALITY of SHOPPINGCENTERS, A PRACTISE in ISTANBUL CITY

    Directory of Open Access Journals (Sweden)

    Şakir ERDEM

    2010-01-01

    Full Text Available Perakendecilik sektöründe yer alan Galleria ve Akmerkez alışveriş merkezleri marka kişiliklerinin karşılaştırılmasını yapmak ve tüketicilerin alışveriş merkezi tercihlerinde alışveriş merkezlerine atfettiği kişilik boyutlarını ve özelliklerini ortaya çıkarılabilmek amacıyla J. Aaker’ın 1997’de geliştirdiği beş ana marka kişiliği boyutu ve bu boyutların altında toplanan kişilik özellikleri temel alınmıştır. Marka kişiliğine ilişkin literatür taraması yapılmış; araştırma yöntemi olarak nitel araştırma ve nicel araştırma yöntemlerinin birleşmesinden meydana gelen karma araştırma yaklaşımı benimsenmiştir. Nitel veri toplanma araçlarından olan odak grup görüşmesinden faydalanılarak, nicel araştırmanın anketlerinin oluşturulmasında yararlı olabilecek bilgiler ve nicel araştırma örneklem yapısı ve yöntemine ışık tutan bilgiler elde edilmesi sağlanmıştır. Nicel araştırmada veri toplama aracı olarak anket yöntemi uygulanmış, analiz yapılmaya uygun 272 adet anket elde edilmiştir. Anket sonuçları SPSS programı yardımıyla kodlanmış, verilerin frekans ve yüzde dağılımları verilerek faktör analizleri, güvenirlik analizleri ve T-testi yapılmıştır. Araştırma sonucunda, alışveriş merkezi sektöründe marka kişiliğine dair dört boyut elde edilebilmiş; elde edilen dört boyut Galeria ve Akmerkez alışveriş merkezleri arasında karşılaştırılmıştır.- The present research aims to compare brand personalities of Galeria and Akmerkez shopping centers and to examine the brand personality traits and dimensions that consumers refer on shopping centers preferences. Research based on J. Aaker’s five dimensions of brand personality and the traits. We looked over the literature of brand personality. This research included pluralistic methodology: First, focus groups method was used to take qualitative research’s survey, sampling and

  15. Variational method for objective analysis of scalar variable and its ...

    Indian Academy of Sciences (India)

    It has been found that objectively analysed scalar field obtained using standard method is superior to the scalar field derived by the triangle method,whereas the derivative fields produced by triangle method are superior to the derivative fields produced using standard method. A variational objective analysis scheme has ...

  16. Coupled dilaton and electromagnetic field in cylindrically symmetric ...

    Indian Academy of Sciences (India)

    An exact solution is obtained for coupled dilaton and electromagnetic field in a cylindrically symmetric spacetime where an axial magnetic field as well as a radial electric field both are present. Depending on the choice of the arbitrary constants our solution reduces either to dilatonic gravity with pure electric field or to that ...

  17. Samanlarda Biyolojik Muamelelerle Lignoselüloz Kompleksin Sindirilebilirliğinin Artırılması

    Directory of Open Access Journals (Sweden)

    Aydan Atalar

    2017-12-01

    Full Text Available Samanların hücre duvarında bulunan lignoselüloz kompleksin parçalanması ile selüloz ve hemiselüloz gibi rumen fermantasyonuyla sindirilebilir fraksiyonlar elde edilir. Rumende sindirilmeyen ligninin biyoteknolojik metotlarla parçalanarak samandan yararlanılabilirliğin artırılması son yıllarda hayvan beslemecilerin odak noktası olan alanlarından birisi olmuştur. Lignoselüloz kompleksin biyolojik metotlarla muamelesinde bakteriler, mantarlar ve bu mikroorganizmalardan elde edilen enzimler kullanılmaktadır. Bakteri muamelesinde Mycobacterium, Arthrobacter ve Flavobacterium türü bakterilerin lignini parçalayabilme özelliğinden yararlanılmaktadır. Enzim muamelesi etkili olmasına rağmen yüksek maliyet nedeniyle uygulamada yer bulamamıştır. Mantar muamelesinde beyaz, kahverengi ve yumuşak çürüme yapan 3 tür mantar kullanılmaktadır. Kahverengi çürükçül mantarlar tercihen selüloz ve hemiselüloza saldırır, ancak lignini parçalayamaz. Beyaz çürükçül mantarlar lignine saldırarak lignol bağları ve aromatik halkayı parçalarlar. Beyaz çürükçül mantarlar selülaz, ksilanaz gibi hidrolitik enzimlerle polisakkaritleri ve lignin peroksidaz ve lakkaz gibi oksidatif ligninolitik enzimlerle lignini parçalarlar. Lignoselülozik materyalleri en iyi parçalayabilen mikroorganizmaların mantarlar olması ve maliyetin düşük olması nedeniyle özellikle beyaz çürükçül mantarların uygulama potansiyeli bulunmaktadır. Bu bildiride biyoçeşitliliğin sağladığı avantajla biyolojik metotlarla samanların sindirilebilirliğinin artırılması tartışılacaktır.

  18. İŞYERİNDE MOBBİNG DAVRANIŞLARININ SPOR VE FİZİKSEL ETKİNLİK İŞLETMELERİ ÇALIŞANLARININ ÖRGÜTSEL VATANDAŞLIK DAVRANIŞINA ETKİSİ

    Directory of Open Access Journals (Sweden)

    Süleyman Murat YILDIZ

    2016-03-01

    Full Text Available ÖZ: Bu çalışmada spor ve fiziksel etkinlik hizmeti sunan işletmelerde, mobbingin örgütsel vatandaşlık davranışına etkisi incelenmiştir. Veriler ticari olarak faaliyet gösteren fitness merkezleri ve yüzme havuzu işletmelerinde görev yapan antrenörler ile Spor Genel Müdürlüğü taşra teşkilatı çalışanlarından elde edilmiştir. Veri toplama aracı olarak, mobbingi ölçmede Einarsen, Hoelb ve Notelaers’in (2009 geliştirdiği “Olumsuz Davranışlar Ölçeği”, örgütsel vatandaşlık davranışını ölçmede ise Bolat’ın (2008 geliştirdiği örgütsel vatandaşlık davranışı ölçeği kullanılmıştır. Araştırma hipotezlerini test etmek amacıyla korelasyon analizi ile hiyerarşik regresyon analizi uygulanmıştır. Elde edilen bulgular mobbingin örgütsel vatandaşlık davranışı üzerinde orta düzeyde, anlamlı ve negatif etkili olduğunu ortaya koymuştur. ABSTRACT: In this study, the effect of mobbing on organizational citizenship behavior in sports and physical activity organizations was investigated. The data were obtained from the trainers of swimming and fitness centers and the employees of Sports General Directorate. Negative Acts Questionnaire-Revised scale developed by Einarsen, Hoelb, and Notelaers (2009 was used to measure mobbing and organizational citizenship behavior scale developed by Bolat (2008 was used to organizational citizenship behavior. In order to test the hypothesis of this study, correlation analyzes and hierarchical regression analyzes were applied. The findings of the study demonstrated that mobbing significantly and inversely influenced organizational citizenship behavior of trainers and employees.

  19. 124-134Xe Izotopları için Triaxiall RMF Hesaplamaları

    Directory of Open Access Journals (Sweden)

    Tuncay BAYRAM

    2016-11-01

    Full Text Available Özet. Bu çalışmada çift-çift 124-134Xe çekirdekleri için Relativistik Ortalama Alan (RMF Modeli kullanılarak taban durum nükleer özellik hesaplamaları yapılmıştır. Bu çekirdekler için RMF+DDM2 etkileşmesi ile taban durum bağlanma enerjileri için deneysel değerlere çok yakın sonuçlar elde edilmiştir. Triaxiall simetriye dayalı hesaplamalar yapılarak 124-134Xe izotop zincirinde izotopların taban durum şekilleri üzerine bir analizde sunulmaktadır. Özellikle deneysel olarak 130Xe çekirdeğinin E(5 simetrisine sahip kritik nokta çekirdeği olduğu iddia edilmektedir. Bu bağlamda Xe izotopları için RMF modeli çerçevesinde elde edilen potansiyel enerji yüzeyleri (PES kullanılarak E(5 simetrili çekirdek taraması yapılmıştır. Çift-çift 124-134Xe izotopları için izotop zinciri boyunca şekil evrimi detaylıca tartışılmıştır.Anahtar kelimeler: RMF modeli, Bağlanma enerjisi, Xe izotopları, PES, E(5 simetrisi Abstract. In this study, ground-state nuclear properties of even-even 124-134Xe nuclei have been calculated by using Relativistic Mean Field (RMF model. By using RMF+DDM2 interaction the ground-state binding energies of these nuclei have been predicted as very close to experimental values. Also, an analizing on the ground-state shape of 124-134Xe isotopes is presented by using calculations based on triaxiall symmetry. In particular, 130Xe nuclei has been pointed out as possible critical point nuclei with E(5 symmetry from experimental studies. For this reason, by using potential energy surfaces (PES of 124-134Xe nuclei obtained from RMF model, scanning for E(5 symmetry in this isotopic chain has been done. For even-even 124-134Xe nuclei, shape evolution has been discussed in detail.Keywords: RMF model, Binding energy, Xe isotopes, PES, E(5 symmetry

  20. Türk Eğitim Sistemindeki FATİH Projesinin CIPP Modeline Göre İncelenmesi

    Directory of Open Access Journals (Sweden)

    Nermin KARABACAK

    2014-12-01

    Full Text Available Türkiye 2000’li yıllardan günümüze eşitlikçi bir sistem kurma alanında önemli kazanımlar elde ederek “FATİH Projesi”yle yenileşme sürecine girmiştir. Proje; teknoloji kullanımı yoluyla, eğitimde fırsat eşitliğinin her toplumsal katmanda sağlanmasına yönelik bir girişimdir. Bu araştırma, FATİH Projesi uygulamalarında görev alan öğretmen ve yöneticiler olmak üzere 200 katılımcıyla Projenin CIPP modeline göre incelenerek Türkiye şartlarına uygun olup olmadığının ortaya çıkarılması amacına yönelik olarak gerçekleştirilmiştir. Katılımcılardan, FATİH Projesinin çevre, girdi, ürün, süreç boyutuna yönelik elde edilen ham veriler, nitel veri çözümleme tekniğinden betimsel analiz kullanılarak analiz edilmiştir. Araştırmanın bulgularına göre, Projenin “çevre” ve “girdi” boyutlarındaki olumsuzluklar dikkat çekicidir. “Çevre” boyutunda; yazılım bileşeni, öğretim programlarında BİT kullanımı, eğitsel e-içerik, hizmetiçi eğitim ve bilinçli BİT kullanımında sorunlar yaşandığı, “girdi” boyutunda; e-içerikte kullanılacak öğretim stratejisi, yöntem ve tekniklerin belirlenmesi ve projenin Türkiye genelinde uygulanabilirliği planlamasının yapılmadığı söylenebilir.

  1. Güneş Bacası Tasarım Parametreleri ve Performansının Deneysel Olarak İncelenmesi

    Directory of Open Access Journals (Sweden)

    İbrahim ÜÇGÜL

    2010-03-01

    Full Text Available Bu çalışmada, Isparta ve yöresi iklim koşullarına uygun teorik bir güneş bacası sistemi tasarlanmıştır. Bu tasarıya dayalı olarak deneysel çalışma yapmak amacıyla Süleyman Demirel Üniversitesi-YEKARUM (Yenilenebilir Enerji Kaynakları Araştırma ve Uygulama Merkezi tarafından, üniversite yerleşim alanına bir prototip güneş bacası kurulmuştur. Ayrıca, deneysel çalışmaların ardından, bu tasarı esas alınarak sistem teorik olarak modellenmiştir. Daha sonra bu model, geliştirilen bilgisayar programına esas teşkil etmiş ve çıktı olarak, sisteme ait performans parametreleri elde edilmiştir. Elde edilen bulgular, yapılan modelleme çalışmasının, Isparta ve yöresi iklim şartlarına uygun güneş bacası tasarım ve performans parametrelerini belirlemekte yeterli olduğunu ortaya koymuştur. Sonuçlar, güneş bacası teknolojisi ile elektrik üretiminin Isparta ve yöresi ile güneş ışınımının yüksek ve güneşlenme süresi uzun olan benzer iklim şartlarına sahip bölgeler için de uygun olduğunu göstermiştir. Sonuçlar yorumlandığında, güneş bacası elektrik üretim gücünün direkt olarak bölge güneş verilerine, baca yüksekliğine ve toplayıcı sera alanının büyüklüğüne bağlı olduğu görülmüştür.

  2. KAFEİNİN SU VE BAZI ORGANİK ÇÖZÜCÜLER ARASINDAKİ DAĞILMA KATSAYILARININ SICAKLIĞA BAĞLI OLARAK DEĞİŞİMİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    İ. Metin HASDEMİR

    2000-03-01

    Full Text Available Bu çalışmanın amacı, ülkemizin önemli bir tarım ürünü olan çayın önemli bileşenlerinden biri olan kafeinin, su ve bazı organik çözücüler arasındaki dağılma katsayılarının sıcaklığa bağlı olarak değişiminin incelenmesidir. Çalışmada kullanılan organik çözücüler kloroform, etilasetat, n-butil asetat, karbon tetraklorür ve benzendir. Deneysel çalışmada hazırlanan % 1`lik (hacmen kafein çözeltisinden belirli miktar alınarak çözücü ile birlikte karıştırılmış ve yapılan analizler sonucunda kafein miktarı tespit edilmiştir. Bu işlem dört ayrı sıcaklıkta gerçekleştirilerek dağılma katsayılarının sıcaklığa ne şekilde bağlı oldukları incelenmiştir. Yapılan deneysel çalışmalar sonucunda en yüksek dağılma katsayısı kloroformla elde edilmiş ve kloroform ile elde edilen dağılma katsayılarının kullanılan diğer çözücülerin aksine sıcaklıkla azaldığı tespit edilmiştir.

  3. Kurumsal Bilgi Kaynağı Olarak E-posta Yönetim Sistemleri = E-mail Management Systems as an Enterprise Information Resource

    Directory of Open Access Journals (Sweden)

    Külcü, Özgür

    2012-01-01

    Full Text Available Çalışmada, e-posta kullanımı ve yönetimine ilişkin uluslararası koşullar incelenmekte, bu çerçevede Türkiye’de 28 kurum örneğinde gerçekleştirilen anket verileri değerlendirilmektedir. Betimleme yönteminin kullanıldığı çalışmada literatür incelemesi ve anket tekniklerine dayanarak gerekli veriler elde edilmiştir. Araştırmada e-posta kullanımına ilişkin elde edilen verilerin, ilgili alanda sistemler geliştirmeye çalışan araştırmacılara yardımcı olması beklenmektedir. Kurumsal e-posta yönetimine ilişkin temel sorunlar arasında mesajların üretimi, düzenlenmesi, ayıklanması ve uzun süre korunmasını içeren e-posta yönetim sistemlerinin geliştirilmesi yer almaktadır. Ayrıca insan kaynakları, mali ve idari konuların yönetimi ile belge ve arşiv yönetimi çalışmalarını kapsamına alan, içerisine e-posta yönetiminin de dâhil olduğu sistemlerin bütünleştirilmesi güncel araştırma konuları arasındadır. / This study examines the universal usage and management of e-mail communication and compares with the data, gathered from 28 Turkish institutions. This is a descriptive research in nature and the quantitative data were collected through surveys. It is expected that the results one-mail communication and its usage styles will shed a ligth into researcher who are working on system development. One of the basic problems of organizational e-mail management systems are lack of e-mail systems including message creation, maintenance, disposition, and long term preservation. Furthermore, the results indicate that integration of human resources management, financial and administrative management systems and archival management systems with e-mail managment system is another major problem.

  4. Basınç altında α -PbO2 fazındaki SnO2’nın yapısal ve dinamik özelliklerinin araştırılması

    Directory of Open Access Journals (Sweden)

    Tahsin Özer

    2017-06-01

    Full Text Available SnO2 birçok uygulamalar için çok yararlı malzeme yapan çeşitli özel ve özgün özellikleri vardır. Malzemenin elastik sabitleri mekanik, fiziksel ve kimyasal özellikleri ile ilişki kurduğu için çok önemlidir. SnO2’nın yapısal ve elastik sabitleri VASP yazılımı kullanılarak Yoğunluk Fonksiyonel Teorisi (DFT ile araştırılmıştır. Örgü parametreleri, atomik konumlar ve elastik sabitler 18 GPa’ya kadar değişik basınçlarda çalışıldı. Hesaplanan elastik sabitler göstermektedir ki SnO2 mekanik olarak kararlıdır. Bulk modül, Debye sıcaklığı, Poisson oranı, Young modülü, shear modülü, kristal anizotropisi gibi bazı fiziksel nicelikler hesaplanan verilerden türetilmiştir. CaCl2 tipinden α-PbO2 yapısına faz geçişi 12,13 GPa elde edildi. SnO2’nin Debye sıcaklığı elastik modüller ve ses hızlarından hesaplandı. Ortam basıncında x, y ve z yönlerinde α-PbO2’nin ortalama sıkıştırıla bilirliği 1,90 TPa-1 dır. Ayrıca, basınç kaynaklı örgü (elastik sabitleri diğer hesaplamalar ile elde edilen sonuçlarla doğrudan karşılaştırma yapmak amacıyla regresyon denklemine uyduruldu. Sonuçlar mevcut teorik ve deneysel verilerle kıyaslanmıştır.

  5. Behaviours Disturbing Secondary School Students on the Internet

    Directory of Open Access Journals (Sweden)

    Şemsettin Gündüz

    2015-07-01

    Full Text Available The purpose of this study is to determine the behaviors that secondary school students feel uncomfortable while using the internet. A total of 93 students including 51 boys and 42 girls studying at a secondary school in the Karatay district of Konya province were surveyed by taking their opinions in a written form. Students who were asked for their opinion were studying in the 6th, 7th and 8th grades and had been using the internet at least for a year. At the end of the research, the descriptive analysis technique was used in the analysis of the data obtained. As a result, most of the students reported opinions under the “Unintentional Notification and Pages" theme. Under this theme, students expressed opinion the most about "Bad Content Mail Receiving", "Unintentional Pop-up -Ad “and "Unintentional Request and Offers". In addition, students stated opinions a lot about the "Harmful Content and Advertising" theme. Obtained findings at the end the research were discussed and compared with the related literature.Keywords: Internet, secondary school students, internet ethic, disturbing behaviour on the internetÖzBu çalışmanın amacı, ortaokul öğrencilerinin internet kullanırken rahatsızlık duydukları davranışları belirlemektir Araştırma kapsamında Konya ili merkez Karatay ilçesinde 51’i erkek ve 42’si kız olmak üzere toplam 93 ortaokul öğrencisinden yazılı olarak görüşleri alınmıştır. Görüşleri alınan öğrenciler, 6, 7 ve 8. sınıflarda öğrenim görmekte ve en az bir yıldır internet kullanmaktadırlar. Araştırmanın sonucunda elde edilen verilerin çözümlenmesinde, betimsel analiz tekniği kullanılmıştır. Araştırmanın sonucunda öğrenciler en çok “İstemsiz Bildirim ve Sayfalar” teması altında görüş bildirmişlerdir. Bu tema altında da öğrenciler en çok “Kötü İçerikli Mail Alma”,  “İstemsiz Açılır Pencere-Reklam” ve “İstemsiz Talep ve Davetler” ile

  6. 5-6 Yaş Çocuklarının Değer Kazanım Süreçlerine Anne Değerler Eğitimi Programının Etkisi

    Directory of Open Access Journals (Sweden)

    Seviye NESLİTÜRK

    2015-08-01

    Full Text Available Bu araştırmanın amacı 5-6 yaş çocuklarının annelerine verilen Anne Değerler Eğitimi Programının (ADEP, çocukların sorumluluk, saygı, dürüstlük, işbirliği, paylaşma, dostluk/arkadaşlık değerleri üzerine etkisini incelemektir. Araştırmada karma yöntem kullanılmıştır. Araştırmanın çalışma grubunu çocuğu okul öncesi eğitim kurumuna devam eden anneler ile 5- 6 yaş grubundaki çocukları arasından seçilen 24 (12 deney, 12 kontrol anne ile çocuğu oluşturmaktadır. Deney grubundaki çocukların annelerine 21 oturum Anne Değerler Eğitimi Programı uygulanmıştır. Araştırmada veri toplama aracı olarak Okul öncesi Değerler Ölçeği Aile, Öğretmen ve Öğrenci Formu, araştırmacılar tarafından hazırlanan yarı yapılandırılmış görüşme formu ve Aile Bilgi Formu kullanılmıştır. Araştırmadan elde edilen nicel veriler SPSS 20.0 paket programıyla, nitel veriler ise NVİVO programında analiz edilmiştir. Nicel verilerin analizi sonucunda deney grubundaki çocukların sorumluluk, saygı, dürüstlük, işbirliği, paylaşma, dostluk/arkadaşlık değerler puan ortalamalarının kontrol grubu çocukların puan ortalamalarından anlamlı düzeyde yüksek olduğu bulunmuştur. Deney grubundaki çocukların ön test ve son test puanları arasında anlamlı bir farklılık bulunmuştur. Eğitim programının bitiminden 6 hafta sonra deney grubuna yapılan ölçüm sonucunda son test ve kalıcılık ölçüm puan ortalamaları arasında anlamlı bir farklılık tespit edilmemiştir. Nitel verilerinden elde edilen bulgulara göre, anneler programın kendileri, eşleri ve çocukları üzerinde olumlu etkisi olduğunu belirtmişlerdir.

  7. İyimserliğin Mutluluk ve Yaşam Doyumuna Etkisinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Fatma SAPMAZ

    2012-02-01

    Full Text Available Özet İyimserliğin Mutluluk ve Yaşam Doyumuna Etkisinin İncelenmesi İyimserlik ve mutluluk pozitif psikolojinin iki temel kavramı olarak değerlendirilmektedir. Bu çalışmada iyimserlik, mutluluk ve yaşam doyumu arasındaki ilişkilerin incelenmesi amaçlanmıştır. Araştırmanın katılımcılarını Sakarya Üniversitesinde öğrenim gören 206 (131 kadın/75 erkek üniversite öğrencisi oluşturmuştur. Çalışmada veri toplama araçları olarak Yaşam Yönelimi Testi, Oxford Mutluluk Ölçeği-Kısa Formu ve Yaşam Doyumu Ölçeği kullanılmıştır. Elde edilen bulgular iyimserliğin, mutluluk ve yaşam doyumu ile pozitif yönde ilişkili olduğunu ortaya koymuştur. Ayrıca iyimserliğin mutluluğa ilişkin varyansın % 59’unu, yaşam doyumuna ilişkin varyansın ise % 60’ını açıkladığı sonucuna ulaşılmıştır. Elde edilen bulgular alanyazın bağlamında ele alınıp tartışılmıştır. Anahtar Kelimeler: İyimserlik, mutluluk, yaşam Doyumu, öznel iyi oluş   Abstract Examination of the Effect of Optimism on Happiness and Life Satisfaction Optimism and happiness are evaluated as two basic concept of positive psychology. In this study, it was aimed to examine the relations between optimism, happiness and life satisfaction. The participants of this research consisted of 206 (131 female/75 male university students studying in Sakarya University. Life Orientation Test (LOT, Oxford Happiness Questionnaire -Short Form (OHQ-SF and the Satisfaction with Life Scale (SWLS, were used as data collection means in the study. The findings obtained proved that optimism is related with happiness and life satisfaction in a positive way. In addition, it was concluded that happiness explained the 59% of the variance of happiness and 60% of the variance of life satisfaction. The obtained findings are addressed and discussed within the context of the literature. Key Words: Optimism, happiness, life satisfaction, subjective well-being

  8. Pantograf-Katener Sistemler için Bulanık Mantık Tabanlı Belirlenen Pantograf Modeli Kullanılarak Ark Tespiti Yaklaşımı

    Directory of Open Access Journals (Sweden)

    Orhan Yaman

    2017-08-01

    Full Text Available Elektrikli trenler, günümüzde yaygın olarak kullanılan, önemli bir ulaşım türüdür. Diğer ulaşım türleri ile karşılaştırıldığında elektrikli trenlerin güç tüketimi ve çevre kirliliğine olan etkisi daha azdır. Ayrıca konfor ve güvenlik gibi birçok avantajı vardır. Elektrikli trenlerde kullanılan en önemli bileşenlerden biri pantograf katener sistemidir. Pantograf katener sistemi, demiryolu hattı boyunca bulunan katener sistemi ve lokomotif üzerinde bulunan pantograf sisteminden oluşmaktadır. Lokomotifin ihtiyaç duyduğu elektrik enerjisi pantograf üst bölgesi ile katener telinin teması sonucunda sağlanmaktadır. Temas sırasında birçok nedenden dolayı arklar oluşmaktadır. Oluşan arklar elektrik enerjisinin sağlıklı aktarılmasını engellemektedir. Lokomotifin sağlıklı bir şekilde çalışabilmesi için elektrik enerjisinin sürekli alınabilmesi gerekmektedir. Bu nedenle pantograf katener sistemi elektrikli trenler için oldukça kritik bileşenlerdir. Bu çalışmada, pantograf katener sistemi için model ve ark tespiti için yeni bir yöntem önerilmektedir. Görüntü işleme ve bulanık mantık tabanlı bu yöntemde, birçok farklı türde pantograf sisteminin görüntüsü kullanılmıştır. Kullanılan görüntüler üzerinde Canny kenar çıkarımı yapıldıktan sonra Hough dönüşümü ile doğrular elde edilmektedir. Elde edilen doğruların bazı özellikleri bulanık mantığın giriş verileri olarak kullanılmaktadır. Bulanık mantık sonucunda pantograf sisteminin modeli tespit edilmektedir. Tespit edilen pantograf modeli kullanılarak pantograf temas bölgesinde oluşan arklar tespit edilmektedir.

  9. Anasınıfı Çocuklarına Yönelik Erken Okuryazarlık Testi (EROT Geliştirme Çalışması

    Directory of Open Access Journals (Sweden)

    Tevhide Kargın

    2015-12-01

    Full Text Available Bu araştırma, Türk çocuklarının erken okuryazarlık becerilerini geçerli ve güvenilir bir şekilde ölçecek kapsamlı bir ölçme aracına duyulan gereksinimle planlanmıştır. Araştırmanın amacını, bu nedenle, 5 yaş çocuklarına yönelik standardizasyonu yapılmış bir erken okuryazarlık testinin-Erken Okuryazarlık Testi (EROT - geliştirilmesi ve geçerlik ve güvenirliğinin test edilmesi oluşturmuştur. Araştırmanın evrenini Ankara, örneklem grubunu ise Ankara ili kent merkezi sınırları içerisinde yer alan yedi merkez ilçede Milli Eğitim Bakanlığına bağlı bağımsız anaokulları ile ilkokulların bünyesinde 5 yaş çocuklarına eğitim veren sınıflarda öğrenim gören 403 çocuk oluşturmuştur. Çalışma içerisinde çocukların erken okuryazarlık becerileri EROT kapsamında geliştirilen 7 alt test (Alıcı Dil, İfade Edici Dil, Genel İsimlendirme, İşlev Bilgisi, Harf Bilgisi, Sesbilgisel Farkındalık ve Dinlediğini Anlama ile değerlendirilmiştir. Yapılan değerlendirmelerden elde edilen veriler ise EROT’un geçerlik ve güvenirlik hesaplamalarının yapılabilmesi için analiz edilmiştir. Analizlerden elde edilen bulgular, EROT’un 7 alt test ile erken okuryazarlık becerilerini geçerli ve güvenir şekilde ölçtüğünü göstermiştir. This study was planned due to the crucial need for a standardized measure of early literacy with demonstrated validity and reliability for Turkish children. Therefore, this study aimed to develop a standardized measure of early literacy-the Test of Early Literacy (TEL for kindergarten children and to test its validity and reliability. Participants were 403 kindergarten children selected from several schools located in neighborhoods of different socioeconomic statuses in Ankara. The early literacy skills of children were tested with seven sub-tests of TEL (Receptive Language, Expressive Language, Category Naming, Function Knowledge, Letter Knowledge

  10. Sosyal Paylaşım Ağlarında Gizlilik: Facebook İncelemesi = Privacy in Social Networks: An Analysis of Facebook

    Directory of Open Access Journals (Sweden)

    Özgür Külcü

    2014-12-01

    Full Text Available Dünyada ve Türkiye’de sosyal paylaşım siteleri arasında en yaygın kullanım oranına sahip Facebook üzerindeki risk ve tehditlerden uzak kalabilmenin tek yolu; bilinçli kullanım ile varsayılan ayarlar üzerinde değişiklik yapmak ya da Facebook hesabına sahip olmamaktır. Türkiye’de sosyal paylaşım sitelerinde açığa çıkan kişisel bilgilerin gizlilik açısından değerlendirildiği bir çalışma literatürde yer almamaktadır. Bu nedenle, çalışma sonunda elde edilen bulgular, kullanıcıları yeterince koruyan hukuksal düzenlemelerin bulunmadığı Türkiye’de, mevcut durumun ortaya konularak bu konudaki risklere dikkat çekilmesi açısından da önem taşımaktadır. Bu çalışmada, KUTUP-L üyesi bilgi profesyonellerinin Facebook gizliliği incelenerek; Türkiye’de bilgi profesyonellerinin gizlilik konusundaki hassasiyeti ve bilinçlenme düzeyinin belirlenmesi amaçlanmaktadır. Çalışmada, 400 KUTUP-L üyesi bilgi profesyonelinin Facebook kullanıcı profili, 32 farklı gizlilik ayarı dikkate alınarak incelenmiştir. Her kullanıcı için bir gizlilik puanı hesaplanmış ve ayrıca tüm gizlilik sonuçları arasındaki ilişkiler incelenmiştir. Çalışma sonunda elde edilen bulgular; Türkiye’deki bilgi profesyonellerinin gizliliğe önem verdiklerini ve büyük çoğunluğun kişisel verilerini korumak amacıyla varsayılan ayarlar üzerinde değişiklik yaptıklarını göstermektedir./The only way to beware of the risks and threads of Facebook, the most commonly used social networking site in the world and Turkey, is to be a conscious user changing the default settings or simply not to have a Facebook account. In Turkey, there is still not any study in which personal information shared though social networking sites has been evaluated in terms of privacy in the literature. For this reason, the findings obtained as a result of this study have a great importance in the sense of displaying the

  11. Teknokent’lerde Geliştirilen Yazılım Projelerinin Risk Analizi ve Başarı Düzeyleri

    Directory of Open Access Journals (Sweden)

    M.Hanefi CALP

    2014-08-01

    Full Text Available Günlük hayatın hemen her alanında ihtiyaç duyulan yazılım projeleri her geçen gün daha fazla büyümekte ve daha çok önem arz etmektedir. Bununla birlikte, büyüyen bu yazılımlar beraberinde daha karmaşık bir yapıyı doğurmaktadır. Bu bağlamda, sözkonusu yazılım projelerinin analiz ve kontrol süreci, ayrıca başarı düzeyleri merak edilmektedir. Dolayısıyla bu çalışmada, geliştirilen anket formlarında bulunan kontrol listeleri aracılığıyla, Teknokent’lerde geliştirilen yazılım projelerinde karşılaşılan risk faktörlerini belirlemek, analiz etmek ve bu projelerin başarı düzeylerini ortaya koymak amaçlanmıştır. Bu amaçla, gerekli olan veriler toplanmış, yazılım risk faktörleri belirlenmiş ve sözkonusu faktörler analiz edilmiştir. Araştırma kapsamında elde edilen verilerin analizi için betimsel analiz yönteminden yararlanılmış olup, Microsoft Excel 2010 ve IBM SPSS Statistics 21.0 programları kullanılmıştır. Ayrıca, çalışmada analiz sonuçlarına ve geliştirilen yazılımların başarı düzeylerine ayrıntılı bir şekilde yer verilmiştir. Elde edilen sonuçlar içerisinde özellikle; proje süresi, bütçesi, personel sayısı ve hedeflerdeki sapmalara rağmen Teknokent’lerde geliştirilen yazılım projelerinin yaklaşık %95’inin başarıyla sonuçlandırılmış ve müşteriye teslim edilmiş olması dikkat çekmektedir.Anahtar Kelimeler: Yazılım, Risk faktörleri, Risk analizi, Proje başarısı

  12. TÜRKİYE’DE PETROL TALEBİNİN FİYAT VE GELİR ESNEKLİKLERİ: ARDL SINIR TESTİ VE NEDENSELLİK ANALİZİ

    Directory of Open Access Journals (Sweden)

    Muhammed Şehid GÖRÜŞ

    2016-03-01

    Full Text Available ÖZ: Bu çalışmanın temel amacı, 1970-2013 dönemleri arasında Türkiye’nin petrol talebinin fiyat ve gelir esnekliklerini tahmin etmek ve petrol fiyatı, petrol talebi ve gelir düzeyi arasındaki nedensellik ilişkisinin yönünü tespit etmektir. Çalışmada tahmin yöntemleri olarak ARDL Sınır Testi yaklaşımı ve Toda-Yamamoto (1995 Granger Nedensellik Testi kullanılmıştır. Yapılan analiz sonucunda değişkenler arasında bir eşbütünleşme ilişkisinin mevcut olduğu gözlemlenmiştir Elde edilen sonuçlara göre, uzun dönemde petrol talebinin fiyat esnekliği -0,17; gelir esnekliği ise 0,51 olarak hesaplanmıştır. Diğer yandan, kısa dönemdeki fiyat esnekliği ise -0,08; gelir esnekliği ise 0,59 olarak tahmin edilmiştir. Elde edilen ampirik sonuçlara göre, petrol talebinin fiyat ve gelir esneklikleri hem uzun dönemde hem de kısa dönemde inelastiktir. Nedensellik Testi sonuçlarına göre ise petrol fiyatından petrol talebine doğru tek yönlü bir nedensellik ilişkisi tespit edilmiştir. Bu sonuçlardan Türkiye’de petrol fiyatı ve gelir düzeyinin petrol talebi üzerinde kısa ve uzun dönemde güçlü bir etkisinin olmadığı, bunun temel nedeninin ise petrolün zorunlu mallar arasında yer almasından kaynaklandığı söylenebilir. ABSTRACT: The primary objective of this paper is estimating price elasticity and income elasticity of oil demand, and causality relationship between variables with respect to Turkish economy for the period of 1970 and 2013. In the study, ARDL Bound Test approach and Toda-Yamamoto (1995 Granger Causality Test are employed as an estimation method. According to bound test analysis, a cointegration relationship is found between variables. Empirical findings show that long-run price and income elasticity of oil demand in Turkey is -0.17 and 0.51 respectively. On the other hand, short-run price and income elasticity of oil demand estimated as -0.08 and 0.59 respectively

  13. Türkiye ve Almanya’daki Coğrafya Öğretim Programlarının Karşılaştırılması / Comparisons of Geography Teaching Programs in Turkey and Germany

    Directory of Open Access Journals (Sweden)

    Mehmet Fatih KAYA

    2011-06-01

    Full Text Available Bu çalışmada; Türkiye’de 2005, Almanya’da ise 2004 yılından itibaren liselerde uygulanmaya başlanan Coğrafya Öğretim Programları karşılaştırılmıştır. Bu araştırma, lise Coğrafya Öğretim Programları’nın hedef, içerik, öğretme-öğrenme ve değerlendirme süreçlerini tespit etmeye yönelik bir araştırma şeklinde tasarlanmıştır. Araştırma nitel bir desene sahiptir. Araştırmanın evrenini Türkiye ve Almanya’da lise Coğrafya Öğretim Programları oluşturmaktadır. Örneklemini ise Türkiye’deki lise 9. sınıflar, Almanya’da ise nüfus miktarı ve yoğunluğu en fazla olan Nordhrhein-Westfalen eyaletindeki lise 9. sınıflar teşkil etmektedir. Coğrafya Öğretim Programları içerik analizine uygun olarak incelenmiş ve elde edilen bulgular doğrultusunda programlar; hedef, içerik, öğretme-öğrenme süreci ve değerlendirme süreci açısından karşılaştırılmıştır. Yaptığımız araştırmada şu sorulara cevap aranmıştır: Türkiye ve Almanya’daki Coğrafya Öğretim Programı’nın benzer ve farklılıkları nelerdir? Türkiye ve Almanya’daki Coğrafya Öğretim Programı’nın hedef, içerik, öğretme-öğrenme süreci ve değerlendirme süreci açısından olumlu ve olumsuz yönleri nelerdir? Her iki programın da benzerlik göstermekle birlikte birtakım farklılıkları da içerdiği tespit edilmiştir. Elde edilen bulgular ışığında araştırmacılara, öğretmenlere ve program geliştirme uzmanlarına bazı önerilerde bulunulmuştur.

  14. Otizmli Bireylerin Kullandığı Yeni Nesil Konuşma Üreten Cihazlara İlişkin Araştırmaların İncelenmesi

    Directory of Open Access Journals (Sweden)

    Derya Genç-Tosun

    2017-04-01

    Full Text Available Teknolojinin gelişmesiyle otizmli bireylerin eğitimlerinde kullanılan uygulamalar ve araç-gereçlerde gelişmeler kaydedilmektedir. Bu gelişmelerle birlikte tablet bilgisayarlar ve taşınabilir medya oynatıcılar da konuşma üreten cihaz olarak kullanılmaya başlanmıştır. Yeni nesil konuşma üreten cihazlar otizmli bireylerin iletişim becerilerini geliştirmek için kullanabilen alternatif ve destekleyici iletişim sistemlerinden biridir. Bu çalışmada; otizmli bireylerin yeni nesil konuşma üreten cihazlar kullandığı, hakemli dergilerde yayımlanan, 26 adet tek denekli araştırma makalesi incelenmiştir. Araştırmalara ERIC, Akademik Search Complete ve Google Scholar veri tabanlarında yapılan elektronik taramalar sonucu ulaşılmıştır. Toplam 81 katılımcının yer aldığı bu araştırmalarda; talep etme, eşleme, resimdeki nesnenin adını söyleme, kişisel bilgilere ilişkin sorulara yanıt verme, bağlama uygun iletişim becerisinin öğretimi ve problem davranışların azaltılmasına odaklanıldığı belirlenmiştir. Araştırma bulgularından elde edilen sonuçlar yeni nesil konuşma üreten cihazlarla yürütülen uygulamaların otizmli bireylere bu becerilerin öğretiminde oldukça etkili olduğunu göstermektedir. Bu çalışmada, incelenen araştırmalardan elde edilen bulgular yorumlanmış, uygulamacılara ve ileri araştırmalara yönelik önerilerde bulunulmuştur By the advancement of the technology, developments are recorded in intervention and materials used for education of individuals with autism. Touch-screen mobile device has been used as a device for generating speech with these advancements. New generation speech generating devices are one of the alternative and augmentative communication (AAC systems that can be used to improve the communication skills of individuals with autism. In this study; 26 single subject design research article in which, individuals with autism use new generation

  15. OPINIONS OF PRIMARY EDUCATION SEVENTH GRADE STUDENTS ABOUT TEACHING OF HISTORY TOPICS IN SOCIAL SCIENCES AND SIGNIFICANCE OF HISTORY İLKÖĞRETİM YEDİNCİ SINIF ÖĞRENCİLERİNİN SOSYAL BİLGİLER DERSLERİNDE TARİH KONULARININ İŞLENİŞİ VE TARİHİN DEĞERİ İLE İLGİLİ GÖRÜŞLERİ

    Directory of Open Access Journals (Sweden)

    Ramazan KAYA

    2012-06-01

    Full Text Available This study aims at determining primary education seventh grade students’ opinions on teaching of history topics in social science cources and significance of history in their lives. The population of the study comprises of 20 pieces seventh grade classes in 4 primary schools with medium socio-economic levels in the city center of Erzurum. As the sample of the study, a total of 200 students (10 students from each class were chosen via random sampling from seventh grade classes of these schools according to the appropriate sampling method. Required data for this qualitative research was acquired by a 4-item questionnaire comprising of open-ended questions. Content analysis method was adopted in analysis of the obtained data in this study. Findings shows that methods in line with constructivist approach remain limited in teaching of the topics; students like methods in which they are more active; such as drama and acting they like learning history, and, in general, they think that learning history makes a great contribution to their lives. Bu araştırmanın amacı, İlköğretim yedinci sınıf öğrencilerinin sosyal bilgiler dersinde tarih konularının işlenişi ve tarihin yaşamlarındaki değeri ile ilgili görüşlerini tespit edebilmektir.Araştırmanın evrenini, Erzurum merkezde sosyo-ekonomik bakımdan orta düzeyde 4 ilköğretim okulundaki toplam 20 tane yedinci sınıf şubesi oluşturmaktadır. Örneklem olarak uygun örnekleme yöntemine göre seçilen bu okulların yedinci sınıflarından tesadüfî örneklem yoluyla her sınıftan 10’ar öğrenci olmak üzere toplam 200 öğrenci seçilmiştir. Nitel araştırma yöntemi ile gerçekleştirilen bu araştırma için gerekli olan veriler, 4 adet açık uçlu sorudan oluşan bir anket vasıtasıyla edinilmiştir. Araştırma sonucunda elde edilen verilerin çözümlenmesinde içerik analizi yöntemi benimsenmiştir. Elde edilen bulgulara göre derslerin işlenişinde yap

  16. Mut Orman İşletmesinde Karaçam, Sedir ve Kızılçam Ağaç Türleri İçin Dip Çap–Göğüs Çapı İlişkileri

    Directory of Open Access Journals (Sweden)

    R Özçelik

    2009-04-01

    Full Text Available Bu araştırmada, Mut Orman İşletmesi Karaçam, Sedir ve Kızılçam meşcerelerinde dip kütük çapı (d0,30 ile göğüs yüksekliği çapı arasındaki ilişkinin belirlenmesi amaçlanmıştır. Her bir ağaç türü için, doğrusal, parabolik, logaritmik ve üssel olmak üzere dört değişik regresyon modeli denenmiş ve bu modellerden belirtme katsayısı (R2 ile tahminin standart hatası (Syx ölçütlerine göre en iyi sonucu veren model belirlenmiştir. Elde edilen sonuçlara göre; d0,30 – d1,30 ilişkisi için Karaçam ağaç türünde parabolik regresyon modelinin, Sedir ve Kızılçam ağaç türlerinde ise üssel regresyon modelinin en başarılı olduğu bulunmuştur. Pratik olması bakımından doğrusal modelin de güvenle kullanılabileceği sonucuna varılmıştır.

  17. Uşak İli Buğday Ekim Alanlarında Süne, [Eurygaster spp. (Hemiptera: Scutelleridae] Yumurtalarının Parazitlenme Oranları ile Buğday Tanelerindeki Emgi Oranları Arasındaki İlişkinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Erdal ZENGİN

    2017-06-01

    Full Text Available Bu çalışma, 2015-2016 yıllarında Uşak iline bağlı 10 köydeki Süne yumurtalarının parazitlenme oranlarının ve emgili tane sayılarının belirlenmesi ile bu oranlar arasındaki ilişkinin tespit edilmesi amacıyla yapılmıştır. Araştırma sonuçlarına göre, 2015 ve 2016 yıllarındaki en yüksek Süne yumurtası parazitlenme oranı ve emgili tane sayıları sırasıyla %95.4-%1.60, %90.7-%1.05 olarak bulunmuştur. Köylerde yapılan arazi çalışmaları sonucunda elde edilen oranlara çoklu karşılaştırma testi uygulanarak köyler arasındaki farklılıklar belirlenmiştir.  Parazitlenme oranı ile emgili tane sayısı arasında bir ilişkinin olup olmadığını belirlemek için her iki yıl verileri üzerinde yapılan regresyon analizi sonucunda, bu iki değişken arasında doğrusal bir ilişkinin olduğu tespit edilmiştir.

  18. İYONİK KANAL AKTİVASYON VE İNAKTİVASYON KAPILARININ DİNAMİK DAVRANIŞI İÇİN ALTERNATİF DENKLEMLER

    Directory of Open Access Journals (Sweden)

    Mahmut ÖZER

    2003-03-01

    Full Text Available Bu makalede, iyonik kanal aktivasyon ve inaktivasyon kapılarının dinamik davranışı için yol ihtimaliyet yöntemine dayalı olarak elde edilen alternatif denklemler sunulmaktadır. Gerilim-kapılı iyonik kanalın dinamik davranışı, geleneksel Hodgkin-Huxley (H-H matematiksel biçimciliği ile modellenmektedir. Bu modelde kanal iletkenliği, aktivasyon ve inaktivasyon kapılarına göre tanımlanmaktadır. Aktivasyon ve inaktivasyon kapılarının dinamiği, kapı değişkenine ve membran potansiyeline bağlı birinci dereceden diferansiyel denklemlerle modellenmektedir. Bu çalışmada sunulan yeni yaklaşımda, aktivasyon ve inaktivasyon kapısının dinamik davranışı, istatistik fizikte yaygın olarak kullanılan yol ihtimaliyet yöntemi kullanılarak iç enerji ve membran potansiyeline bağlı birinci dereceden diferansiyel denklemlerle modellenmektedir. Yeni model, H-H modelinde açıkça kullanılan zaman sabiti ve sürekli-hal değerlerini de gerektirmemektedir. Sayısal sonuçlar önerilen yöntemin geçerliliğini göstermektedir.

  19. Batı Karadeniz Bölgesindeki Bazı Göllerin Malacostraca (Crustacea Faunası.

    Directory of Open Access Journals (Sweden)

    Murat Özbek

    2015-12-01

    Full Text Available Batı Karadeniz Bölgesi ve Sakarya Nehri Havzası’nda yer alan 13 gölün [Poyrazlar, Küçük Akgöl, Taşkısığı, Büyük Akgöl, Acarlar, Melen, Abant, Gölcük (Bolu, Yeniçağa, Karamurat, Sülük, Çubuk ve Sünnet gölleri] Malacostraca faunasını belirlemek amacıyla, 12-16 Ağustos 2002 ve 23-27 Haziran 2003 tarihlerinde iki örnekleme çalışması yapılmıştır. Örneklemelerde 500 µm göz açıklığındaki el kepçeleri ve Ekman grab kullanılmıştır. Elde edilen materyal %4’lük formaldehit solüsyonunda fikse edilmiştir. Örnekleme yapılan lokalitelerin sıcaklık, pH, çözünmüş oksijen, oksijen doygunluğu, tuzluluk, iletkenlik ve berraklık değerleri arazide ölçülmüştür. Çalışma sonucunda Decapoda, Isopoda ve Mysidacea ordolarından 1’er, Amphipoda ordosundan 7 olmak üzere toplam 10 takson tespit edilmiştir

  20. Urinary tract infections in pregnants who were addmitted University Hospital Obstetric and Gyneacology Outpatient Clinics in Tokat TURKEY: Evaliuation of three years.

    Directory of Open Access Journals (Sweden)

    Asker Zeki OZSOY

    2016-06-01

    Full Text Available Amac: Bu calismada, Tokat ilinde Universite Hastanesi Kadin Hastaliklari ve Dogum klinigine basvuran gebelerde idrar yolu enfeksiyonu gorulme sikliginin incelenmesi ve idrar kulturunde ureme saptanan mikroorganizmalarin tespit edilmesi amaclanmistir. Gerec ve Yontemler: Tokat Gaziosmanpasa Universitesi Kadin Hastaliklari ve Dogum klinigine Ocak 2012- Haziran 2015 tarihleri arasindaki yaklasik 3.5 yillik donemde basvuran gebelerde idrar yolu enfeksiyonu gorulme sikligi ve ureyen ajan patojenler incelenmistir. Tam idrar tetkiki hastanemiz biyokimya laboratuarinda ve idrar kulturu analizleri hastanemiz mikrobiyoloji laboratuarinda degerlendirilmistir. Elde edilen sonuclarin otomasyon sistemi uzerinden retrospektif olarak ulasilmasi ile verilerimiz tespit edilmistir. Bulgular: Hastanemize Ocak 2012 ve Haziran 2015 tarihleri arasinda basvuran 2245 gebe hasta calismaya dahil edilmistir. Calismaya alinan hastalarin (n=2245 yas ortalamasi 28.0+/-5.63 (min:16, maks:45 olup, %86.5i (n=1942 35 yas altinda, %13.5i (n=303 35 yas ve uzerindedir. Hastalarin %36.5inde (n=819 gebelikte idrar yolu enfeksiyonu oldugu saptanmistir. 35 yas altindaki hastalarin %37.3unde (n=725 idrar yolu enfeksiyonu saptanirken, 35 yas ve uzerindeki hastalarda bu oran %31.0dir (n=94 (p<0.05. 35 yas altinda gebe olmak idrar yolu enfeksiyonu gecirme acisindan, 35 yas ve uzerinde gebe olmayana gore 1.3 kat daha riskli bulunmustur (OR=1.32; CI=1.02-1.72. Sonuc: idrar yolu enfeksiyonu gebelikte en onemli ve en sik gorulen hastaliklar arasinda yer almaktadir. Tedavi edilmeyen enfeksiyon ile preterm eylem ve buna bagli komplikasyonlar arasinda yakin iliski mevcuttur. Gebelerde idrar yolu enfeksiyonu tedavi edilmesi ve gozardi edilmemesi gereken hastaliklardan biridir. [J Contemp Med 2016; 6(2.000: 100-103

  1. İş Kazası Öyküsü Verilen Bir Cinayet Olgusu

    Directory of Open Access Journals (Sweden)

    Serpil Salaçin

    1996-07-01

    Full Text Available Adli soruşturmalar; adli tahkikat, olay yeri incelemeleri, otopsi ve laboratuvar bulgularını kapsar. Ölüm sebebinin saptanması, elde edilen tüm bilgilerin dikkatlice toparlanmasına dayanır. Otopsi yapılmaksızın, adli tahkikata dayanarak ölüm sebebinin belirtilmesi ve defin ruhsatı düzenlenmesi sonucunda; kararın yeniden gözden geçirilmesinin gerektiği durumlar ortaya çıkabilir. Bu yazıda; bir inşaatın zemininde bulunan cesedin, savcılık tarafından yapılan olay yeri incelemesi sırasındaki görüşmelerde; kişinin iş kazası sonucu kafa travmasına bağlı olarak öldüğü ifade edilmiştir. Yapılan otopside ise; kişinin av tüfeği yaralanması sonucu meydana gelen yaralanmalar nedeniyle öldüğü belirlenmiştir. Bu olgu, adli olayların sağlıklı çözümünde yaklaşımların önemini vurgulamak amacıyla sunulmaktadır. Anahtar Kelimeler: Av Tüfeği Yaralanması, Ölüm Nedeni, Olay Yeri Keşfi, Adli Soruşturma, Otopsi.

  2. From brain drain to brain gain: an insight into human capital fJight from Pakistan

    Directory of Open Access Journals (Sweden)

    Abdus SALAM

    2014-06-01

    Full Text Available Beşeri sermayenin kaçışı olarak da bilinen beyin göçü eğitimli ve vasıflı insanların gelişmekte olan ülkelerden gelişmiş ülkelere olan göçünü ifade eder. Gerçekte benzer olay Doğu Avrupa'dan batı ve kuzeye olduğu gibi birçok gelişmiş ülkede de yaşanmaktadır. Konu ile ilgili bu araştırmanın farklı sosyal ve ekonomik yönleri bulunmaktadır. Her zaman olumsuz çağrışımlara sahip olan bu olay son yirmi yılda beyin kazanımı, beyin dolaşımı gibi atıflarla ihracatçı ülkeler için potansiyel bir kazanç olarak düşünülmektedir. Bu çalışmada nitel ve nicel araştırma yöntemleri kullanılmıştır. Çalışmadan elde edilen bulgular beyin göçünün arttığını ancak olumsuz etkilerden çok olumlu etkilere sahip olduğunu göstermiştir

  3. Türkiye’de Finansal Gelişim ve Gelir Dağılımı İlişkisi: Finansal Kuznets Eğrisi

    Directory of Open Access Journals (Sweden)

    Mehmet Akif DESTEK

    2017-07-01

    Full Text Available Bu çalışmada, Türkiye’de 1977-2013 dönemi için Finansal Kuznets Eğrisi hipotezi geçerliliğinin incelenmesi amaçlanmıştır. Bu amaç doğrultusunda reel GSYH, finansal gelişim, kamu harcamaları ve enflasyonun Gini katsayısı üzerindeki etkileri ARDL sınır testi yaklaşımı ve VECM Granger nedensellik yöntemi ile incelenmiştir. Çalışmada elde edilen sonuçlara göre kamu harcamalarındaki ve enflasyon oranındaki artışın gelir eşitsizliğini arttırdığı görülmüştür. Buna karşın reel GSYH’daki artışın gelir dağılımını olumlu yönde etkilediği sonucuna ulaşılmıştır. Ayrıca finansal gelişim katsayısının pozitif, finansal gelişimin karesini ifade eden değişken katsayısının negatif işaretli olduğu dolayısıyla ters-U şeklindeki Finansal Kuznets Eğrisi hipotezinin desteklendiği görülmüştür.

  4. Effects Of Organizational Identification On Job Satisfaction: Moderating Role Of Organizational (Örgütsel Özdeşleşmenin İş Tatmini Üzerindeki Etkisi: Örgütsel Politikanın Düzenleyici Rolü

    Directory of Open Access Journals (Sweden)

    Ufuk BAŞAR

    2015-12-01

    Full Text Available The purpose of this study was to investigate the potential predictive effect of organizational identification on job satisfaction and to determine the moderating role of perceptions of organizational politics within this process after controlling for the latter. To that end the data were collected from 363 employees, who work at an international home appliances producing facility in Istanbul, Turkey via survey method. Collected data were analyzed through structural equation models. Findings indicated that organizational identification was a positive and organizational politics was a negative predictor of job satisfaction. Besides, organizational politics moderated organizational identification’s positive predictive effect on job satisfaction by lessening its effect size. Bu çalışmanın amacı örgütsel özdeşleşmenin iş tatmini üzerindeki nedensel etkisini ve örgütsel politika algısının bu süreç üzerindeki düzenleyici etkisini araştırmaktır. Bu amaçla İstanbul’da bir beyaz eşya üretim tesisinde çalışan 363 işgörenden anket yöntemi ile veri toplandı. Toplanan veri yapısal eşitlik modelleri kurularak analiz edildi. Elde edilen bulgulara göre örgütsel özdeşleşme iş tatmininin pozitif, örgütsel politika algısı ise negatif bir yordayıcısıdır. Ayrıca örgütsel politika algısı örgütsel özdeşleşmenin iş tatmini üzerindeki pozitif yordayıcı etkisini azaltmak suretiyle düzenlemektedir.

  5. Ekzopolisakkarit Üreticisi Streptococcus Thermophilus ST8.01 Suşu; Potansiyel Probiyotik Kültür (İngilizce

    Directory of Open Access Journals (Sweden)

    Banu Özden Tuncer

    2015-02-01

    Full Text Available Bu çalışmanın amacı, ekzopolisakkarit (EPS üreticisi Streptococcus thermophilus ST8.01 suşunun probiyotik potansiyelinin belirlenmesidir. Bu suş pH 3 ve %1 safra tuzunda hayatta kalma yeteneğine sahiptir. %0.4 fenol ve pH’sı 3’e ayarlanmış mide suyu uygulaması sonrası canlı hücre sayısı sırasıyla 4.80±0.04 ve 2.11±0.06 log kob/mL olarak ölçülmüştür. Strep. thermophilus ST8.01, 100 mg/L lizozim konsantrasyonunda gelişebilme ve yüksek otoagregasyon (%49.55±6.24 ve hidrofobisite (%67.23±7.16 yeteneğine sahiptir. ST8.01 suşu aynı zamanda klinik olarak önemli olan antibiyotiklere karşı duyarlı bulunmuştur. Bu araştırmadan elde edilen sonuçlar, Strep. thermophilus ST8.01 suşunun süt ürünleri üretiminde probiyotik starter kültür olarak kullanılabileceğini düşündürmektedir.

  6. BETONARME KİRİŞLERİN LİFLİ POLİMER (FRP MALZEMELER KULLANILARAK ONARIM VE GÜÇLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Nihat ÇETİNKAYA

    2004-03-01

    Full Text Available Betonarme yapıların onarım ve güçlendirilmesinde (O/G Lifli Polimer (FRP malzemenin kullanımı son zamanlarda yaygınlaşmaya başlanmıştır. FRP malzemelerin, yüksek çekme mukavemeti, korozyona karşı dayanıklılığı ve bu malzeme ile yapılan O/G'nin, yapının işleyişini çok fazla etkilememesi gibi nedenlerle tercih edilen bir malzeme olmaktadır. Pamukkale Üniversitesi, Mühendislik Fakültesi, İnşaat Mühendisliği Bölümü, Yapı labaratuarlarında yapılan bu çalışmada dört adet betonarme kirişin FRP malzemelerle onarım ve/veya güçlendirilmesi yapılmıştır. Her deney kirişi için yük deplasman eğrisi elde edilerek elemanların statik yük altında O/G'den önceki ve sonraki davranışı karşılaştırılmıştır. Bu çalışma sonucunda FRP malzemelerle yapılan O/G'nin betonarme kirişlerin taşıma gücünü çok büyük ölçüde arttırdığı görülmüştür.

  7. BAZALT DOLGULU POLİMER KOMPOZİTLERİN AŞINMA DAVRANIŞLARI

    Directory of Open Access Journals (Sweden)

    Akın Akıncı

    2009-01-01

    Full Text Available Bu çalışmada, volkanik kayaçiardan bazaltın takviye malzemesi olarak düşük yoğunluklu polietilen (DYPEmatrikse, o/ol0-70 arasındaki değişen oranlarında ilave edilmesiyle elde edilen partikül dolgulu polimer matrikslikompozitlerin değişik sürtünme hızlan ve sabit yük altında pin on disk aşınma davranışları incelenmiştir.Aşınma testleri, atmosferik ortamda, 20 N yük altında AISI 4 140 çelik diskin 0.5 mis ve 1 .5 m/s dönırıehızlarında gerçekleştirilmiştir. Aşınma hızı ve sürtünme katsayısının, bazalt takviyesi ile azaldığı görülmüştür.Bazalt takviyeli DYPE malzemenin kayma hızına ve bazaJt miktanna bağlı olarak, sürtünme katsayısı 0.1 1 ve0.51, aşınma oranı 7.18xl04-2.60xl0-2mm3/m' arasında değişmektedir.

  8. Cam Elyaf Takviyeli Plastik Kompozit Malzemenin Kenar Frezelenmesinde Kesme Parametrelerinin Yüzey Pürüzlülüğüne Etkilerinin İstatistiksel Olarak İncelenmesi

    Directory of Open Access Journals (Sweden)

    Aysun TAKMAZ

    2016-03-01

    Full Text Available Gelişen teknoloji, insan ihtiyaçlarına bağlı olarak malzeme çeşitliliği gereksinimini getirmiştir. Bunlardan biri kompozitlerdir. Cam elyaf takviyeli polimer (CTP kompozitlerin belirgin özellikleri; yüksek boyutsal stabilite, elastiklik, hafiflik, tasarım esnekliği ve korozyon direncidir. Polimer kompozitler, diğer malzemelere alternatif olarak havacılık, petrol, gaz ve otomotiv endüstrileri gibi farklı uygulamalarda çevre dostu bir malzeme olarak kullanım alanı bulmuştur. Geniş kullanım alanına rağmen bu kompozit malzemeler, anizotropik yapıya sahip olmasından dolayı talaşlı işlenmelerinde zorluklarla karşılaşılmaktadır. Bu çalışmada cam elyaf takviyeli plastik kompozit malzeme, farklı kesme parametreleri (ağız sayısı, kesme hızı, ilerleme ve kesme derinliği altında kenar frezeleme yöntemi ile işlenerek, işlenen yüzeylerin yüzey pürüzlülüğü ölçümleri yapılmıştır. Elde edilen verilere, varyans analizi (ANOVA uygulanarak, yüzey pürüzlüğüne etki eden kesme parametrelerinin etki oranları istatistiksel olarak incelenmiştir.

  9. KANSER VERİLERİNİN SINIFLANDIRILMASINDA YAPAY SİNİR AĞLARI İLE DESTEK VEKTÖR MAKİNELERİ'NİN KARŞILAŞTIRILMASI

    Directory of Open Access Journals (Sweden)

    Semra ERPOLAT

    2013-01-01

    Full Text Available Sınıflandırma, bilinmeyen herhangi bir verinin belli kurallara göre düzenlenmiş olan veri kümesindeki sınıflardan hangisine ait olduğunu tahmin etme işlemidir. Birçok alanda önemli bir yere sahip olan sınıflandırmanın özellikle insan hayatının söz konusu olduğu tıbbi alandaki yeri daha da önemlidir. Bu çalışmada makine öğrenmesi yöntemlerinden olan Yapay Sinir Ağları (YSA ve Destek Vektör Makineleri (DVM'nin sınıflandırma başarıları tıbbi veriler üzerinde sınanmıştır. Bu amaçla UCI Makine Öğrenmesi Ambarları'ndan alınan göğüs kanseri verilerinden yararlanılmıştır. Elde edilen sonuçlardan iki smıfladırma yönteminin de oldukça iyi sonuçlar verdiği ancak YSA'nın DVM'ye oranla daha iyi sonuçlar verdiği gözlemlenmiştir.

  10. BİR ÇEVRİM İÇİ UZAKTAN TAKİP SİSTEMİ TASARIMI

    Directory of Open Access Journals (Sweden)

    Ahmet Emir DİRİK

    2004-02-01

    Full Text Available Bu çalışmada düşük maliyetli bir çevrim içi takip sistemi geliştirilmiştir. Takip sistemi, konum belirleme, kablosuz haberleşme ve sayısal harita modülleri olmak üzere üç ana modülden oluşmaktadır. Takip sistemlerinde konum belirleme modülü, hareketli araçların pozisyonlarının tespitinde kullanılmaktadır. Bu modül ile elde edilen pozisyon bilgisi, kablosuz haberleşme sistemi aracılığı ile takip merkezine iletilmekte, takip merkezine ulaşan pozisyon bilgisi merkezde işlenerek araç konumları sayısal harita üzerinde görüntülenmektedir. Geliştirilen sistem ile kampüs içerisinde hareket eden araçların konumları 10m civarında bir hata ile tespit edilebilmekte ve araç hareketleri takip merkezinden on-line izlenebilmektedir. Sistemde kablosuz veri haberleşmesi için analog araç telsizleri kullanılmıştır. Böylece haberleşme için uydu ya da GSM şebekelerinin kullanılmasına gerek kalmamış ve düşük maliyetli-yüksek performanslı bir çevrim içi araç takip sistemi gerçekleştirilmiştir.

  11. Afyon-Sandıklı Hüdai Jeotermal Sisteminin Rezervuar Sıcaklığının Araştırılması

    Directory of Open Access Journals (Sweden)

    Ümit MEMİŞ

    2014-02-01

    Full Text Available Sandıklı-Hüdai jeotermal alanı Afyon ilinin yaklaşık 40 km güneybatısında yeralır. Çalışma alanı volkanik, sedimanter ve metamorfik kayaçlardan oluşur. Hüdai jeotermal alanının rezervuar kayacı kuvarsitlerdir. Jeotermal akışkanın kullanım alanları sıcaklığına bağlı olarak değiştiğinden, çalışma alanındaki jeotermal sistemin rezervuar sıcaklığı araştırılmıştır. Afyon-Sandıklı jeotermal sahasındaki jeotermal akışkanlar Na-K-Mg üçgen diyagramına göre olgun olmayan sular grubuna girmektedir. Jeotermal akışkanların rezervuar sıcaklıkları silika jeotermometreleri ile 85-120 oC arasında hesaplanmıştır. Entalpi-silika ve entalpi-klorür karışım modelleri sırasıyla 108-134 oC ve 98-120 oC rezervuar sıcaklıkları önermektedirler. Hüdai jeotermal sahası için elde edilen ortalama rezervuar sıcaklığı 110 oC'dir. Anahtar Kelimeler: Afyon-Sandıklı-Hüdai, Jeotermal Akışkan, Jeotermometre, Karışım Modelleri

  12. AMASRA’DA OSMANLI DÖNEMİ’NDE KİLİSEDEN ÇEVRİLMİŞ BİR MABET: FATİH CAMİİ

    Directory of Open Access Journals (Sweden)

    Ercan Verim

    2015-11-01

    Full Text Available Bu çalışma Bartın ili Amasra ilçesinde yer alan Fatih Camii’nin mimari yapısını inceleyerek Bizans ve Osmanlı Dönemi’nde geçirdiği değişimi değerlendirmektedir. Fatih Camii’nin plan ve mimari özelliklerinin yanında bazı tarihî belgelerden elde edilen bilgilere göre IX. yüzyılda inşa ettirildiği tahmin edilmektedir. 1461 yılında, Fatih Sultan Mehmet’in Amasra’yı fethi sonrasında yapı camiye çevrilmiştir. Zamanla harap olan yapı 1887 yılında önemli bir onarım geçirmiştir. Son olarak da 2002 yılında Kültür Bakanlığı tarafından onarılmıştır. Yapı plan açısından doğu-batı istikametinde, dikdörtgen bir mekân kurgusuna sahiptir. Harim kısmı, tek sahınlı olarak düzenlenmiştir. Dış cephelerde Bizans Dönemi’nden kalma taş süslemeler bulunmaktadır.

  13. HASTA VERİLERİ ÜZERİNDE VERİ MADENCİLİĞİ UYGULAMASI İLE KALP KRİZİ RİSKİNİN TESPİTİ

    Directory of Open Access Journals (Sweden)

    İlhan TARIMER

    2015-04-01

    Full Text Available Bu çalışmada, veri tabanları içerisinde, karar verme süreçlerine etki edebilecek anlamlı bilgileri çıkarmak için kullanılan veri madenciliğinin sağlık alanında uygulanabilirliği araştırılmıştır. Alan çalışmasına örnek olarak, kalp krizi geçiren hastaların kan değerlerinde meydana gelen ortak değişimler tespit edilerek kalp krizini tetikleyen faktörlerin tespitine çalışılmış; elde edilen sonuçlar hasta grubu üzerinde test edilerek yapılan analizin başarımı ölçülmüştür. Bu çalışmada birliktelik kuralı algoritmalarından Apriori ve Gri algoritmaları kullanılmış; bunların oluşturdukları kural kümelerinin başarımı, karşılaştırmalar yapılarak incelenmiştir. Gri algoritmasının Apriori’ye göre daha az kural ürettiği halde aynı başarımı gösterdiği tespit edilmiştir. Sonuç olarak kan değerleri verilen bir hasta grubu verilerinden kalp krizi riskinin tespiti için ön sinyaller anlamına gelen çeşitli desenler ortaya konmuştur

  14. HİZMET KALİTESİ VE MÜŞTERİ MEMNUNİYETİNİN ŞUBE-İNTERNET BANKACILIĞINDA KARŞILAŞTIRILMASI - COMPARISON OF SERVICE QUALITY OF CUSTOMER SATISFACTION IN BRANCH-INTERNET BANKING

    Directory of Open Access Journals (Sweden)

    Tolga DURSUN

    2014-03-01

    Full Text Available ÖzetKüreselleşme ve teknolojik gelişmelerle birlikte işletmelerin sürdürülebilirliklerinde ve birbirleriyle olan rekabetlerinde hizmet, hizmet kalitesi ve müşteri memnuniyetinin önemi artmıştır. Bu nedenle bu araştırma müşteri memnuniyetini, müşteri memnuniyetinde etkili olan hizmet kalitesi faktörlerini (fiziksel unsurlar, heveslilik, güvenlik, güvenilirlik, işlemleri gerçekleştirme, servis çeşitliliği, işlem ücreti bankacılık sektöründe iki farklı kanal olan Şube ve İnternet bankacılığında değerlendirerek karşılaştırma yapmaktadır. İki kanal arasındaki farkların ortaya konularak nedenlerinin belirlenmesi amaçlanmaktadır. Veri toplama yöntemi olarak uygulanan anket internet üzerinden yapılmış ve 429 katılımcıdan elde edilen veriler istatistiksel tekniklerle değerlendirilmiştir.AbstractGlobalization and technological developments, the competitiveness of enterprises and between sustainability services, service quality and customer satisfaction has increased in importance. Therefore, this research aims to evaluate customer satisfaction in branch and internet banking by addressing the factors affecting the quality of service (tangibles, responsiveness, trust, reliability, fulfillment, service portfolio and transaction fees in customer satisfaction. It is intended to determine the causes of the differences between the two channels and is to put forth. The survey made on the internet as a method of data collection and statistical analysis of the data from 429 participants were statistically evaluated.

  15. Arduino ve LabVIEW Kullanarak EMG Verilerinden Eşik Seviye Belirleme ile Motor Kontrol Düzeneği Tasarımı

    Directory of Open Access Journals (Sweden)

    Savaş ŞAHİN

    2017-10-01

    Full Text Available Biyomedikal sinyaller içinde Elektromiyografinin (EMG incelenmesi popüler bir araştırma alanıdır ve rehabilitasyon tasarım sistemleri için oldukça önemidir. Bu çalışmada kullanılan yöntemler sırasıyla; i insan üzerinden iskelet kasının sinir yolu ile uyarılarak gerçek zamanlı el parmaklarına ait EMG verilerinin alınması, ii elde edilen EMG işaretlerinden el açma ve kapama hareketlerinin eşik seviyelerinin histogram yöntemiyle belirlenmesi iii eşik gerilimlerini kullanarak Arduino kartı üzerinden gerçek zamanlı DC motor kontrolü yapılmıştır. Bu çalışma da belirlenen eşik gerilimleri kullanılarak Arduino tabanlı bir devre ile rehabilitasyon sistemine hazırlık çalışması yapılmıştır. Gerçek zamanlı EMG verileri QNET02697-MYOELECTRIC eğitim seti ile alınmış ve LabVIEW programı ile ara yüzü tasarlanmıştır. Böylece, rehabilitasyon sistemleri için araştırma ve eğitim altyapısına katkı oluşturulabilecektir.

  16. Yüzde tabanlı String Eşleme Problemi için yeni bir donanım modülü tasarımı

    Directory of Open Access Journals (Sweden)

    İbrahim Şahin

    2016-12-01

    Full Text Available Bir verinin bir dizgi içerisinde veya bir gen yapısının bir DNA gen dizilimi içerisinde arama işleminin gerçekleştirilmesi için çeşitli algoritmalar kullanılmaktadır. Kullanılan bu algoritmalardan bazıları bize mutlak eşleşme olmadığı durumlarda olumsuz dönüt vermekte, bazıları ise “bunu mu arıyorsunuz” diye alternatifler sunmaktadır. Her iki algoritma da genel amaçlı PC’lerde saniyeler süren işlemler sonucunda bize dönüt verebilmektedir. Bu çalışmada bize hem mutlak eşleşmeyi hem de hedef dizgi içinde yüzdelik eşleşme oranlarının gerçekleştiği konumu veren FPGA çiplerine yönelik yüksek performanslı bir donanım modülü tasarlanmıştır. Geliştirilen modülün veri işleme hızı farklı PC’lerle karşılaştırılmış ve 2300 kata kadar daha hızlı arama gerçekleştirdiği karşılaştırma sonuçlarından elde edilen veriler ile doğrulanmıştır.

  17. Geri Dönüstürülmüs Atık Betonlarda Mugla-Yatagan Uçucu Külünün Etkileri

    Directory of Open Access Journals (Sweden)

    İsmail KILIÇ

    2009-04-01

    Full Text Available Bu çalısmada, Yatagan uçucu külünün, atık beton agregasından elde edilen betonların özelliklerine etkileri deneysel olarak arastırılmıstır. Çalısmada kullanılan atık beton agregası gerekli granülometrik degerlere sahip olmadıgından dolayı, Isparta-Atabey agregasıyla uygun granülometriyi saglayacak sekilde karıstırılmıstır. Uçucu kül, betona çimento agırlıgının %10, 15, 20, 25, 30 oranlarında çimento ile yer degistirmeli olarak katılmıstır. Çalısmada, elek analizi, taze beton birim hacim agırlık, taze beton kıvam (çökme hunisi metodu, ultrases geçis hızı ve tek eksenli basınç dayanımı deneyleri yapılmıstır. Uçucu külün, basınç dayanımı ve ultrases geçis hızı degerlerinde azalmaya neden oldugu, birim hacim agırlık ve çökme degerlerini ise artırdıgı tespit edilmistir.

  18. KONYA YÖRESİ DOLOMİTLERİNİN SİNTERLENMESİNE DEMİR TUFALI VE KUVARS KATKILARININ ETKİLERİ

    Directory of Open Access Journals (Sweden)

    H. Aygül YEPREM

    2004-03-01

    Full Text Available Bu çalışmada Konya/Sille-Ecmel ocağından alınan dolomitin sinterlenmesine demir tufalı ve kuvars katkılarının etkileri araştırılmıştır. Ocaktan alınan dolomitin diferansiyel termal analizi (DTA ve X-ışın difraksiyon analizi (XRD yapılarak çok az miktarda kalsit içeren dolomit olduğu tesbit edilmiştir. Hammaddenin ince kesiti alınarak oldukça homojen dağılımlı olduğu ve tane boyutunun da interlenmeye uygun olduğu saptanmıştır. Doktora araştırmasının ön çalışması olan bu çalışmada, sinterlemeye olumlu etkisi olacağı düşünülerek hammaddeye -45µm boyutlu kuvars (% 99 SiO2 içeren ve demir oksit (% 98.66 Fe2O3 içeren tozları katılarak 1625 °C ve 1675 °C derecelerde 2 saat süre ve 10 °C/dak ısıtma hızı ile sinterleme yapılmış, elde edilen dolomaların (sinter dolomit mikro yapıları, kütle yoğunlukları, görünür gözeneklilikleri ve hidratasyon durumları incelenmiştir.

  19. İskenderun Körfezi'nde Dağılım Gösteren Kum Yengeci [Portunus pelagicus (Linneaus, 1758] ve Mavi Yengeç (Callinectes sapidus Rathbun, 1896 Populasyonları ve Morfometrisi Üzerinde Araştırmalar.

    Directory of Open Access Journals (Sweden)

    Tahir Özcan

    2015-12-01

    Full Text Available Bu çalışma ile İskenderun Körfezi’nden Temmuz 2002- Haziran 2003 tarihleri arsında elde edilen örnekler incelenerek Atlantik kökenli mavi yengeç ( Callinectes sapidus Rathbun, 1896 ve İndo-Pasifik kökenli kum yengeci (Portunus pelagicus Linneaus, 1758’nin boy dağılımları, erkek-dişi oranları belirlenmiştir. Toplam 467 birey (139 adet mavi yengeç ve 328 adet kum yengeci incelenmiştir. İskenderun Körfezi’ndeki kum yengeci populasyonunda %58 ile erkeklerin baskın olduğu, dişi bireylerin ortalama uzun karapas genişlikleri 119,9±2,8 mm genişliğinde, erkek bireylerin ortalama 104,9±2,1 mm uzun karapas genişliğinde oldukları belirlenmiştir. Mavi yengeç populasyonunda ise yaklaşık olarak populasyonun %69’unu dişi bireylerin oluşturduğu ve ortalama uzun karapas genişliği 148,9±2,5 mm, %31’ini oluşturan erkek bireylerin ise ortalama 123,3±3,4 mm uzun karapas genişliğinde oldukları belirlenmiştir

  20. Farklı Oranlarda Tiyoüre Katkısının Nanoyapılı Kadmiyum Oksit (CdO Filmlerin Fiziksel Özellikleri Üzerine Etkisinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Raşit AYDIN

    2017-05-01

    Full Text Available Bu çalışmanın amacı nanoyapılı CdO filmlerin fiziksel özelliklerine tiyoüre konsantrasyonunun etkisini incelemektir. Bunun için farklı tiyoüre konsantrasyonlarındaki (%0, 0.5, 1 ve 2 dört seri CdO film soda lime cam altlık üzerine SILAR tekniği kullanılarak büyütüldü. Bu filmlerin morfolojileri, kristal yapıları ve optik özellikleri sırasıyla MM, XRD ve UV-visible spektroskopi teknikleri ile karakterize edilmiştir. MM görüntüleri tiyoüre konsantrasyonunun nanoyapılı CdO filmlerin yüzey morfolojilerini etkilediğini göstermektedir. CdO filmlerinin düzlemlerinin tercihli yöneliminin tiyoüre konsantrasyon değerine kuvvetle bağlı olduğunu XRD analizinden elde edilen sonuçlar ortaya koymaktadır. UV-vis analizinden, tiyoüre miktarı arttıkça CdO filmlerinin optik enerji bant aralığının (Eg önce azaldığı ve daha sonra tekrar artan konsantrasyonla arttığı belirlenmiş ve bu enerji değerlerinin (2.25 - 2.13 eV aralığında olduğu bulunmuştur.

  1. İstanbul'un Trakya ve Anadolu Yakasında Yaşayan Lissotriton vulgaris (Linnaeus, 1758 Populasyonlarının Biyometrik Özelliklerinin Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Murat DEMİRTAŞ

    2014-07-01

    Full Text Available Bu çalışmada Lissotriton vulgaris (L., 1758'in İstanbul'un Trakya ve Anadolu yakasındaki populasyonlarının biyometrik özellikleri karşılaştırılmıştır. Araştırmada kullanılan kuyruklu kurbağalar İstanbul'un Trakya ve Anadolu yakasında çalışılan 11 lokaliteden toplanmıştır. Toplama elle yakalama ve 20 cm çaplı bir atrapla gerçekleşmiştir. Yakalanan numuneler kavanozlara konulup % 20'lik formaldehitte muhafaza edilmiştir. Toplanan numunelerin biyometrik ölçümleri 0.01 hassasiyetli bir kumpas ile yapılmıştır. Anadolu ve Trakya yakasına ait değerler birbirleriyle karşılaştırılmış ve "t" testi ile önem kontrolü yapılmıştır. Her iki bölgede elde edilen biyometrik ölçümler arasında önemli farklılıkların olduğu tespit edilmiştir. Ayrıca farklılık katsayısı bağıntısı ile alttür durumları kontrol edilmiştir. Böylece İstanbul Boğazı'nın izolasyon etkisi incelenmiştir.

  2. Eugenol Katkılı Aynalı Sazan Balığı Köftelerinin Raf Ömrünün Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Özlem Pelin CAN

    2014-07-01

    Full Text Available Bu çalışmada, aynalı sazan balığından (Cyprinus carpio L., 1758 elde edilen kıymaya çeşitli katkı maddeleri ilave edilerek balık köftesi yapılmıştır. Köfteler biri kontrol (grup A olmak üzere, diğerlerine %0.5 (grup B ve %1(grup C oranlarında eugenol ilave edilerek üç gruba ayrılmıştır. Muhafaza süresi boyunca meydana gelen mikrobiyolojik, kimyasal ve duyusal değişimler incelenmiştir. Mikrobiyolojik analiz sonuçlarına göre A grubu B ve C grubuyla karşılaştırıldığında değerler yüksek bulunmuştur (P<0.05. İstatistiksel olarak C grubu örneklerinde enterobakteriler, maya, küf ve mezofil aerob bakteri sayısı daha düşük bulunmuştur (P<0.05. TVB-N ve TBA değerleri üç grupta muhafaza süresi boyunca yükselmiştir. Duyusal değerlendirmede, C grubu örnekleri düşük puan almıştır. Sonuç olarak, yüksek konsantrasyon içeren grup (C grubu, mikrobiyolojik ve kimyasal olarak iyi kalitede olmasına rağmen duyusal değerlendirme sonuçlarına göre tüketilmesi uygun değildir.

  3. Tortum Gölü'nün (Erzurum Bentik Alg Florasının Mevsimsel Değişimi.

    Directory of Open Access Journals (Sweden)

    Ersin Kıvrak

    2015-12-01

    Full Text Available Mart 2002-Şubat 2003 tarihleri arasında Tortum Gölü’nün bentik alglerinin kompozisyonu, yoğunluğu ve mevsimsel değişimleri incelenmiştir. Elde edilen veriler 21 yıl önce yapılan araştırmanın sonuçlarıyla karşılaştırılmıştır. Bu araştırmada Navicula capitata var. hungarica (Grunow Ross, Navicula cryptocephala Kütz., Cymbella affinis Kütz., Amphora ovalis (Kütz. Kütz., Cocconeis placentula var. euglypta (Ehrenb. Grunow, Nitzschia sublinearis Hust, Cyclotella krammeri Håk., Merismopedia elegans A. Braun epipelik alg florasında dominant taksonlar olmuştur. Yaz başında ve sonbaharda epipelik florada artış gözlenmiştir. Cymbella affinis, Cymbella lanceolata (Ehrenb. Kirchner, Fragilaria capucina var. rumpens (Kütz. Lange-Bert., Cocconeis placentula var. euglypta, Cyclotella krammeri epilitik alg florasında bol ve yaygın bulunan taksonlardır. Spirogyra aequinoctialis G. S. West ise sadece yaz aylarında epilitik florada çok bol olarak bulunmuştur. Bentik alg florasının, gölün organik maddelerle kirlenmesinden etkilendiği sonucuna varılmıştır

  4. Edremit Körfezi'nde Bakalyaro'nun (Merluccius merluccius L., 1758 yaş ve büyüme özelliklerinin incelenmesi

    Directory of Open Access Journals (Sweden)

    Sencer Akalın

    2015-12-01

    Full Text Available Bu çalışma, Bakalyaro (Merluccius merluccius L., 1758’nun Edremit Körfezi’ndeki boy, ağırlık, yaş, cinsiyet dağılımları ile büyüme parametrelerinin tespit edilmesi amacıyla Eylül 1999-Aralık 2000 tarihleri arasında yapılmıştır. Çalışma periyodu süresince, 38-80 m derinliklerde yapılmış olan trol çekimlerinden elde edilen toplam 2375 birey incelenmiş ve bu örneklerin 7.6-46.2 cm total boy ve 2.09-766.0 g total ağırlıklar arasında bulunduğu tespit edilmiştir. Otolitlerden yapılan yaş tayinleri sonucunda örneklerin 0+ ile V yaş grupları arasında dağılım gösterdiği saptanmıştır. Ortalama total boy değerlerinden hesaplanan von Bertalanffy büyüme parametreleri dişi, erkek ve tüm bireyler için sırasıyla; L=53.49 cm, 47.49 cm ve 53.90 cm; k=0.385, 0.349 ve 0.377 yıl-1; t0=-0.078, -0.112 ve -0.045 yıl; gelişim performansı indeksi (Ф değerleri ise 2.895, 3.042 ve 3.040 olarak bulunmuştur

  5. Perception and demand for artificial reef by relevant local groups in Altınoluk (Turkey.

    Directory of Open Access Journals (Sweden)

    Sezgin Tunca

    2015-12-01

    Full Text Available Bu çalışmada, Türkiye Ulusal Yapay Resif Master Planı’nın pilot bölgesi olan Altınoluk’da yerleştirilmesi planlanan yapay resiflere olan talebin belirlenmesi amaçlanmaktadır. Çalışma kapsamında, Altınoluk’daki ticari balıkçılar, rekreasyonel balıkçılar ve yöre sakinleri ile yüz yüze görüşmeler gerçekleştirilmiştir. Veri toplama çalışmaları, yapay resif yerleştirmesi yapılmadan önce, Nisan, 2011’de tamamlanmıştır. Çalışma hedef gruplarının yapay resif algısı özel olarak tasarlanan 13 ifade Likert ölçeği yardımıyla analiz edilmiştir. Elde edilen sonuçlara göre, yapay resifler ile ilgili olumlu algı gözlenmiştir. Öte yandan, yapay resif yerleştirilmesi ile birlikte hem rekreasyonel balıkçılık (%158 artış hem de ticari balıkçılık (31% artış günlerinde artış tespit edilmiştir. Sonuç olarak, yapay resiflerle ilişkili grupların daha iyi anlaşılması ve yönetim süreçlerine dahil edilmesi yapay resiflerin etkinliği açısından önem taşımaktadır

  6. 60-66, 66-72, 72-84 Aylık Çocukların Okul Olgunluk Ve Okuma Yazma Becerilerini Kazanma Düzeylerinin İncelenmesi Investigating The Level Of 60-66, 66-72, 72-84 Month-Old Children’s School Readiness And Acquisition Of Literacy Skills

    Directory of Open Access Journals (Sweden)

    Muhittin ÇALIŞKAN

    2013-09-01

    Full Text Available The aim of this research is to investigate the level of 60-66, 66-72,72-84 month-old children’s scholl readiness and acquisition of literacyskills. The Metropolitan Readiness Test and The Assessment Form ofLiteracy Process were used to collect the data. An interviews was madein order to determine the opinions of teachers on thelevel of 60-66, 66-72, 72-84 month-old children’s scholl readiness and acquisition ofliteracy skills. The participants were 205 children (105 of whom werefemales and 100 of whom were males. The results obtained in thestudy are as follows: 1. All groups have school readiness at mediumlevel. 2. The level of 72-84 month-old children’s school readiness washigher than other groups. 3. 66-72 and 72-84 month old children’s “theassessment form of literacy process” scores was higher than that of 60-66 month-oldchildren. 4. The level of 72-84 and 66-72 month-oldchildren’s acquisition of literacy skills was higher than that of 60-66month-oldchildren. 5. According to the teachers’ views, there were noobserved difference in the dimension of cognitive. But there wereobserved some difficulties 60-66 and 66-72 month-old children. Thisdifficulties were observed in 60-66 month old children intensely. Bu araştırmanın temel amacı; 60-66, 66-72, 72-84 aylık çocukların okul olgunluk ve okuma yazma becerilerini kazanma düzeylerini betimlemek, okul olgunluk ve okuma-yazma becerilerini kazanma düzeyleri açısından gruplar arasında fark olup olmadığını incelemektir. Öğrencilerin sahip oldukları okul olgunluk düzeyi “Metropolitan Olgunluk Testi” ve okuma-yazma becerilerini kazanma düzeyleri “İlk Okuma Yazma Sürecini Değerlendirme Formu” ile elde edilen verilerle betimlenmeye çalışılmıştır. Ayrıca, grupların (60-66, 66-72, 72-84 aylık çocuklar okul olgunluk ve okuma yazma becerilerini kazanma düzeylerinin derinlemesine ve bütüncül bir yaklaşımla incelenebilmesi için nitel ara

  7. Ortaöğretim 9. Sınıf Öğrencilerinin Yazılı Anlatım Alan Bilgisi Başarı Düzeyleri Üzerine Bir Araştırma A Research On 9th Grade Of Secondary Education Students ' Achievement Levels Of Field Knowledge Of Writing Expression

    Directory of Open Access Journals (Sweden)

    Hasan BAĞCI

    2012-12-01

    ğretimin son aşamasına kadar bu becerilerinin geliştirildiği süreci içine alan bir dönemdir. Yazma becerisi bilgi, birikim ve dili etkili kullanmayı gerektirdiğinden bu sürecin okuma, dinleme/izleme, konuşma ve dil bilgisi etkinlikleriyle de desteklenmesi gerekir.Öğrencilerin yazılı anlatım metinlerini inceleyen araştırmacılar, öğrenci metinlerinde birçok eksikliğin olduğunu, öğrencilerin yazma becerilerinin beklenen yeterliliğe ulaşamadığını ifade etmektedir. Bu becerideki eksikliklerin bilgi aşamasından bilgilerin beceriye dönüştürülememesine kadar geniş bir çerçeveye dağıldığı düşünülmektedir. Bu yüzden bu çalışmanın amacı, ortaöğretim 9. sınıf öğrencilerinin Dil ve Anlatım Ders Programı’nda da ifade edilen yazma becerisine yönelik kazanım cümleleri doğrultusunda yazılı anlatım alan bilgisi düzeylerini belirlemektir. Araştırmada ayrıca öğrencilerin yazılı anlatım alan bilgisi yeterlilik düzeylerinin başta cinsiyet olmak üzere diğer değişkenlere göre de değişip değişmediği tespit edilmiştir.Araştırmadan elde edilen bulgulara göre, ortaöğretim 9. sınıf öğrencilerin Yazılı Anlatım Alan Bilgisi Testi genel başarı puanları ortalamaları 100 tam puan üzerinden 59 puanla sınırlı kalmıştır. Yine 9. sınıf öğrencilerinin yazılı anlatım alan bilgisi başarı düzeyleri, cinsiyet değişkenine göre anlamlı bir farklılık göstermezken öğrencilerin akademik başarına, serbest yazma etkinliği yapmalarına, günlük tutmalarına, Dil ve Anlatım dersini sevmeleri ile yazma etkinliklerinden memnun olmalarına göre ise değişmektedir. Araştırmanın sonunda elde edilen sonuçlara bağlı kalınarak Dil ve Anlatım derslerini veren öğretmenlere bazı önerilerde bulunulmuştur.

  8. Evaluation of pyrethroids toxicity in a laboratory strain and a fi eld population of Rachiplusia nu (Lepidoptera: Noctuidae using two bioassay techniques Evaluación de la toxicidad de piretroides en una cepa de laboratorio y una población de campo de Rachiplusia nu (Lepidoptera: Noctuidae usando dos métodos de bioensayo

    Directory of Open Access Journals (Sweden)

    Romina Russo

    2012-06-01

    Full Text Available Soybean is the most important crop in Argentina and Rachiplusia nu (Gueneé (Lepidoptera: Noctuidae is one of its main pests. In this study, the toxicity of five pyrethroids applied topically and by exposure to films on filter paper was evaluated on third instar larvae from a laboratory strain and a field population of R. nu. Four cyanopyrethroids and one non-cyanopyrethroid (permethrin were tested. All cyanopyrethroids showed the same order of increasing toxicity, regardless of the form of application and origin of the larvae: cypermethrin La soja es el cultivo más importante en la República Argentina y Rachiplusia nu (Gueneé (Lepidoptera: Noctuidae, una de sus principales plagas. En este estudio se evaluó la toxicidad de cuatro cianopiretroides y un no-cianopiretroide, aplicados en forma tópica o por exposición a filmes sobre papeles de filtro, en ninfas del tercer estadio de una cepa de laboratorio y una población de campo de R. nu. Todos los cianopiretroides mostraron el mismo orden de toxicidad creciente, independientemente de la forma de aplicación y del origen de las larvas: cipermetrina < ?-cihalotrina < deltametrina < ß-ciflutrina. Los valores de Dosis de Volteo para el 50% (DV50 y de Tiempo de Volteo para el 50% (TV50 aumentaron en función de la solubilidad de los cianopiretroides en agua. El no-cianopiretroide permetrina mostró un comportamiento diferente: fue el insecticida más tóxico para la cepa de laboratorio cuando se hizo una aplicación tópica, pero el menos tóxico cuando las larvas fueron expuestas a filmes sobre papeles de filtro. En general, todos los piretroides fueron más tóxicos para las larvas criadas en laboratorio que para las provenientes del campo. La estimación de los valores de Factor de Resistencia (FR permitió establecer que la población de campo presentaba resistencia moderada o baja a permetrina, cipermetrina y ?-cihalotrina, cuando los insecticidas fueron aplicados en forma tópica. Sin embargo, no se detectó resistencia cuando se realizó la exposición en papeles de filtro tratados. No hubo correlación entre los valores de FR obtenidos por ambos métodos. Estos resultados sugieren que la población de campo de R. nu estudiada, presentaba resistencia moderada a algunos piretroides, y que la aplicación tópica es un método más apropiado que la exposición a filmes sobre papeles de filtro para cuantificar la resistencia.

  9. İlkokul 2, 3 ve 4. Sınıf Türkçe Ders Kitapları Bütüncesinin Kelime Hazinesini Geliştirme Eğitimi Açısından İncelenmesi Examining Corpus Of 2. 3. and 4. Grades’ Turkish Language Texbooks In Terms Of Vocabulary Teaching

    Directory of Open Access Journals (Sweden)

    Tahir GÜR

    2013-03-01

    çlamaktadır. Araştırma nitel araştırma yöntemlerinden durum çalışması şeklinde desenlenmiştir. Durum çalışmaları var olan durumun derinlemesine analizini gerektirmektedir. Araştırmada ilkokullarda okutulan özel yayınevlerince basılan kitaplardaki metinler Microsoft Office Word dosyaları haline getirilip Text Master programında ön analizi yapılmıştır. Bu analizde elde edilen kelime listeleri Microsoft Office Excel dosyası haline getirilip içindeki özel isimler ve sayılar ayıklanmıştır. Sonra kelimelerin yapım ve çekim ekleri incelenmiştir. Bu şekilde elde edilen bütüncenin Text Master programında son analizi yapılmıştır. Araştırmanın sonucunda sınıflara göre farklı kelime sayılarının belirli bir oranda arttığı görülse de farklı sınıflarda tekrar edilen kelimeler yüzünden toplamın düştüğü; incelenen kitapların öğrencileri yeni kelimelerle karşılaştırmada, yapım ekleri ile farklı anlamlar oluşturma imkanı olan kök kelime vermede yetersiz oldukları bulunmuş; kelime hazinesinin geliştirilmesi ve yeni kelime öğretimi konusunda önerilerde bulunulmuştur.

  10. Türkiye Türkçesi Ağızlarında Özellikleri Bakımından Yağış Türlerine Verilen Adlar The Names That Given to Kinds of Precipitation in Turkey Turkish Dialects for Their Charateristics

    Directory of Open Access Journals (Sweden)

    Selim EMİROĞLU

    2012-09-01

    rkçeye geçmemiş pek çok sözcük halkın dilinde yaşamakta ve kullanılmaktadır. Ağızlarda renk, yemek, organ, akrabalık, hastalık, hayvan, ölçü birimleri, giysi vb. adlar bakımından yüzlerce sözcük bulunmaktadır. Bunlar içerisinde yağış adları da önemli bir yer tutar. Bu çalışmada Türkiye Türkçesi ağızlarında yer alan yağış adları, çeşitli özellikleri göz önünde bulundurularak sınıflandırılmıştır. Yağış türlerinden yağmur ve kar yağışı için kullanılan isimler, bu yağışların sürekliliği, miktarı, hızı; tane veya damlaların büyüklüğü-küçüklüğü; yağışın düştüğü zaman (mevsim, ay, gün, saat vb.; yağışın yönü, diğer tabiat olaylarıyla ( rüzgâr, güneş, sis vb. eş zamanlı meydana gelmesi gibi özellikler dikkate alınarak verilmiştir. Tespit edilen ve sınıflandırılan yağış adları üzerinden çeşitli yorum ve değerlendirmelere ulaşılmıştır. Araştırma, Türklerin, görünüşte aynı sanılan yağış türlerini, bu türlerin çeşitli özelliklerine bakarak farklı adlandırmalarla ustalıklı bir biçimde birbirinden ayırdıklarını göstermektedir. Çalışmanın verileri Derleme Sözlüğü taranarak elde edilmiştir. Ancak Standart Türkçedeki kullanımları da tespit etmek için Büyük Türkçe Sözlük (TDK-BTS taranmıştır. Çalışmanın sonunda, ek olarak, tespit edilen ve özellikleri bakımından sınıflandırılan sözcüklerin anlamlarını içeren bir sözlük bulunmaktadır. Elde edilen veriler, Türkçenin yağış türlerini adlandırmak bakımından söz varlığının zenginliğini ortaya koymaktadır. Ağızlarda geçen yağış adları ile ilgili bu sözcüklerin birçoğunun Standart Türkçeye kazandırılması gerekir.

  11. Dergilerden Özetler

    Directory of Open Access Journals (Sweden)

    Mehmet Akif İnanıcı

    1998-04-01

    Full Text Available ADLİ CAM DELİLİN BİR BAYESİAN YORUMUNDA GEÇİŞ İHTİMALİNİN TAYİNİ Assessing transfer probabilities in a Bayesian interpretation of forensic glass evidence. Curran JM, Tnggs CM, Bucketon JS, Walsh KAJ, Hicks T. Bir kişi cam kırdığında, çok küçük parçacıklardan bir kısmı o kişiye geçebilir. Suç eyleminde cam kırılmışsa bu parçacıklar delil olarak kullanılabilinir. Bu kanıtın bir Bayesian yorumu geçiş ihtimalini tayin edecek adli bilimcinin kabiliyetine güvenir. Bu çalışma ihtimalin belirlenme sorununu inceleyerek bazı çözümler önerir. DIŞ YÜZEYLERDE BULUNAN BOYALI TEKSTİL İPLİKLERİNİN YOĞUNLUĞU The population of coloured textile fibres on outdoor surfaces Gneve MC, Biermann T. Science and Justice 1997; 37/ 4 : 231-9. İplik uzmanları çeşitli dış yüzeylerden elde edilen karışık iplik materyalin incelemesini yaparlar. Adli incelemelerde dış yüzeylerden toplanan ipliklerin değerlendirilmesi normal popülasyondaki bilgiler yeterli olmadığında çok zordur. Çalışmada bulunan materyaller ayrı olarak değerlendirilmiş (33, popülasyondan elde edilen iplikler şekline, rengine ve uzunluğuna göre sınıflandırılmıştır. Selülozik ipliklerin sıklığı oldukça fazla bulunmuştur. (% 92. Renksiz kotonlar her yüzeyde saptanmıştır. Mavi pamuk iplikler üçü hariç her yüzeyde görülürken gri/ siyah ve kırmızı pamuk iplikler yüzeylerin çoğunda tesbit edilmiştir. Sentetik iplikler büyük oranda seyrek olarak bulunmuşlardır. Vizkozlar daha sıkça belirlenmiştir. Bulunan ipliklerin çoğu bir milimetreden daha aşağıda ölçülmüştür; daha uzun ipliklerin sıklıkla başka yerlere taşınarak gittikleri anlaşılmıştır. RENKLİ AKRİIİK İPLİKLERİNİN ITIR TAYFINDA BULUNAN KARAKTERİSTİK BOYA EMİŞ PİKLERİ Characteristic dye absorption peaks found in the FTIR spectra of coloured acrylic fibres. Gneve MC, Griffin RME, Malone R. Science and

  12. 3D laser scanning for quality control and assurance in bridge deck construction.

    Science.gov (United States)

    2014-08-01

    The inspection of installations of rebar and other embedded components in bridge deck construction is a tedious : task for eld inspectors, requiring considerable eld time for measurement and verication against code requirement. The verica...

  13. RES COVER FEB 08

    Indian Academy of Sciences (India)

    THOLASI

    T his initialcon¯guration is com pletely static w ith a m agnetic ¯eld B con¯ned w ithin the solenoid and an electric ¯eld E produced by the charge located on the ring. Let us suppose that the current source is dis- connected leading the m agnetic ¯eld to die dow n. T he change in the m agnetic °ux w illlead to an electric ¯eld.

  14. On Integers, Primes and UniqueFactorization in Quadratic Fields

    OpenAIRE

    Hedenlund, Alice

    2013-01-01

    Abstract. This thesis will deal with quadratic elds. The prob- lem is to study such elds and their properties including, but not limited to, determining integers, nding primes and deciding which quadratic elds have unique factorization. The goal is to get famil- iar with these concepts and to provide a starting point for students with an interest in algebra to explore eld extensions and inte- gral closures in relation to elementary number theory. The reader will be assumed to have a basic kn...

  15. Invariance properties of the Dirac equation with external electro ...

    Indian Academy of Sciences (India)

    In this paper, we attempt to obtain the nature of the external field such that the Dirac equation with external electro-magnetic field is invariant. The Poincar´e group, which is the maximal symmetry group for field free case, is constrained by the presence of the external field. Introducing infinitesimal transformation of x andψ, ...

  16. Büyükbaş Hayvan Atıkları için Kurulacak Havasız Çürütme Tesisinin Ekonomik Analizi / The Economical Analysis of Cattle Manure Treatment by Anaerobic Digestion Process

    Directory of Open Access Journals (Sweden)

    Tamer Coşkun

    2012-12-01

    Full Text Available Büyükbaş hayvan atıkları, içeriğindeki yüksek katı madde, organik kirlilik ve patojen mikroorganizmalar sebebiyle halk sağlığı açısından olumsuz etkiler yapabilecek bir atıktır. Bu çalışmada havasız çürütme ile atıkların stabilize edilerek biyogaz elde edilmesi ve çürümüş atıkların toprakta doğal gübre olarak kullanılmasını içeren bir yönetim modeli uygulanmıştır. Bunun için pilot ölçekli bir havasız çürütme reaktörü işletilmiş ve çürümüş atıklar çeşitli dozlarda yonca, Macar fiğ ve arpa karışımı ile mısır silajı bitkilerinin ekildiği alanlarda doğal gübre olarak toprağa eklenmiştir. Havasız çürütme işleminde yarımcı materyal olarak mısır silajı da reaktöre beslenmiştir. Çalışma sonunda elde edilen sonuçlar ve literatür yardımıyla 1000 baş hayvan için kurulum ve işletme maliyetleri hesaplanmıştır. Kurulum maliyeti; elektrik üretim sisteminin kurulup kurulmaması açısından iki farklı değer olarak hesaplanmıştır. İşletme maliyetleri farklı tarla ürünleri ve yine elektrik sisteminin kurulup kurulmaması açılarından çeşitli durumlar için hesaplanmıştır. Sonuç olarak elde edilen en iyi sonuçlara göre; çürümüş atıklar Macar fiğ ve arpa karışımı bitkisinin ekiminde kullanıldığında kurulacak tesisin elektrik üretim sistemi de kurulduğunda 2,5 yılda, elektrik üretim sistemi kurulmadığında ise 2,1 yılda kendisini amorti ettiği bulunmuştur. The Economical Analysis of Cattle Manure Treatment by Anaerobic Digestion Process Cattle manure is a potential for causing detrimental effects on human health due to its high solid matter and pathogen microorganism content. In this study, it was aimed to achieve biogas production by stabilizing the waste using anaerobic digestion. Digested waste was utilized as natural fertilizer. For that reason, a pilot-scale anaerobic digestion tank was operated and digested wastes

  17. Çocuklarda Görülen Sosyal Problemlerin Akademik Başarıya Etkisi Üzerine Öğretmen Görüşlerinin İncelenmesi The Investigation Of The Teachers’ Views About The Effect Of Social Problems In Children On Academic Success

    Directory of Open Access Journals (Sweden)

    Onur KÖKSAL

    2013-09-01

    örülen sosyal problemlerin akademik başarıya etkisine ilişkin görüşlerinin belirlenmesi amaçlanmıştır. Araştırmanın verileri, 2012-2013 eğitim öğretim yılı bahar yarıyılında, Sivas ili Suşehri ilçe sınırları içerisinde yer alan farklı eğitim kurumlarında çalışmakta olan 25 öğretmenle yapılan yarı yapılandırılmış görüşmelerden elde edilmiş, elde edilen veriler betimsel ve içerik analiz yöntemleriyle irdelenmiştir. Elde edilen bulgulara göre öğretmenler sosyallik kavramını iletişim ve arkadaşlık ilişkileri ile ifade etmiştir. Sosyal problem yaşayan öğrencilerin akademik başarısının daha düşük olduğunu belirten öğretmenler, bu öğrencilerin derslere ilgilerinin düşük seviyede olduğunu ve motivasyon sorunu yaşadıklarını belirtmişleridir. Ailenin, sosyal beceri gelişiminin önemli bir parçası olduğunu vurgulamış ve bu konuda ailelerin bilinçlendirilmesi gerektiğini ifade etmişlerdir. Ayrıca sosyal problemlerin kız öğrencilerde daha çok görüldüğünü belirtmişlerdir. Sosyal becerileri geliştirmek için öğrencilere sosyal paylaşımlarda bulunabilecekleri ortamlar yaratılması, öğrencilerin kendilerini ifade etmelerine olanak sağlanması gerektiğini vurgulamışlardır. Geleceğin sağlıklı toplumunu oluşturacak çocukların, sosyal beceriler ve olumlu karakter özellikleri kazanmaları gerekmektedir. İlkokul dönemi çocukların bu özellikleri kazanmaya en açık olduğu dönemdir. Bu dönemde öğretmenler çocukların model aldıkları en önemli figür haline gelirler. Bu nedenle öğrencilerde sosyal becerilerin geliştirilmesi, pekiştirilmesi ve bu becerilerin değişik ortamlarda uygulanmasının gerektiğinin vurgulandığı bu çalışmada öğrencilerde sosyal becerilerin geliştirilmesi konusunda öğretmenlere bazı tavsiyelerde de bulunulmuştur.

  18. Dokuzuncu Sınıf Tarih Ders Kitabında Yer Alan Görseller Hakkında Öğretmen Görüşleri: Trabzon Örneği Perceptions of History Teachers about Visual Materials of Ninth Grade History Textbook

    Directory of Open Access Journals (Sweden)

    Ebru DEMİRCİOĞLU

    2013-09-01

    ında yer alan görseller hakkındaki görüşlerini ortaya koymaktır. Çalışmanın evrenini Trabzon ilinde bulunan tarih öğretmenleri oluştururken, araştırmanın örneklemini Trabzon il merkezi ve sahil şeridindeki ilçelerde görev yapan deneyimli Tarih öğretmenleri oluşturmaktadır. Araştırma nitel bir anlayışla gerçekleştirilmiş olup, örneklem seçiminde amaçlı örneklem kullanılmıştır. Çalışmada veri toplama aracı olarak açık-uçlu sorulardan oluşan bir anket ve yarı-yapılandırılmış mülakat kullanılmıştır. Bu veri toplama araçlarıyla derinlemesine bilgi elde edilmeye çalışılmıştır.Açık-uçlu anket çalışmasına kırk dokuz tarih öğretmeni katılırken, mülakatlar sekiz öğretmenle gerçekleştirilmiştir. Her iki veri toplama aracıyla elde edilen veriler, kendi içinde kategorilere ayrılarak analiz edilmiştir. Araştırmadan elde edilen verilerin ışığı altında, araştırmaya katılan tarih öğretmenlerinin, dokuzuncu sınıf tarih ders kitabında bulunan görsellerin nasıl kullanılması gerektiği konusunda yeterli eğitim ve bilgilerinin olmadığı anlaşılmaktadır. Buna ek olarak, öğretmenlere göre dokuzuncu sınıf tarih ders kitabında yer alan görsellerin bir kısmının metinlerle uyumlu olmadığı, bazı görsellerin açık ve net olmamasının yanında anlaşılır olmadığı görülmektedir.

  19. THE RELATIONSHIP BETWEEN PSYCHOLOGICAL EMPOWERMENT AND PSYCHOLOGICAL WELL BEING: THE ROLE OF SELF-EFFICACY PERCEPTION AND SOCIAL SUPPORT

    Directory of Open Access Journals (Sweden)

    Seçil BAL TAŞTAN

    2013-07-01

    Full Text Available PSİKOLOJİK GÜÇLENDİRME ALGISI VE PSİKOLOJİK İYİ HİSSETME HALİ ARASINDAKİ İLİŞKİ: ÖZ-YETERLİLİK ALGISI VE SOSYAL DESTEK ALGISININ ROLÜÖzet: Bu çalışmanın amacı, bireylerin psikolojik güçlendirme algısı ile işle ilgili iyi hissetme hali arasındaki ilişkiyi incelemektir. Bununla birlikte çalışmanın amacı, işyerinde psikolojik güçlendirme algısı ile psikolojik iyi hissetme hali arasındaki ilişkide bireylerin öz-yeterlilik inancının ara değişken rolüne ve sosyal destek algısının düzenleyici değişken rolüne ilişkin bulgular elde edebilmektir. Bu bağlamda, psikolojik güçlendirme algısı ve iyi hissetme hali arasındaki ilişkiyi ve algılanan öz-yeterlilik duygusu ve sosyal desteğin rolünü incelemeye yönelik tasarlanan yapılandırılmış saha araştırması, İstanbul ili Kadıköy ilçesine bağlı devlet ilköğretim okullarında görev yapmakta olan öğretmenler üzerinde uygulanmıştır. Araştırma modelinde ön görülen bir dizi hipotez, katılımcılardan elde edilen ampirik verilere dayanarak test edilmiştir. Araştırma sonuçları, psikolojik güçlendirme algısının dört boyutunun da psikolojik iyi hissetme hali ile pozitif ve anlamlı şekilde ilişkili olduğunu göstermiştir. Bununla birlikte, elde edilen istatistiksel bulgulara gore, bireylerin öz-yeterlilik algısının psikolojik güçlendirme ve iyi hissetme hali arasındaki ilişkide kısmi seviyede ara değişken rolüne sahip olduğu ve amir sosyal desteğinin bu ilişkide düzenleyici bir etkiye sahip olduğu görülmüştür. Bütün bu sonuçlar, çalışanlarının işyerindeki psikolojik iyi hissetme halini ve çalışma yaşamıyla ilgili olumlu duygulanımlarını güçlendirmeyi amaçlayan ve farklı sektörlerde yer alan özel ve kamu kurumlarına bakış açısı sunmaya yardımcı olmaktadır.THE RELATIONSHIP BETWEEN PSYCHOLOGICAL EMPOWERMENT AND PSYCHOLOGICAL WELL BEING: THE ROLE OF SELF

  20. Büyükbaş Hayvan Atıkları için Kurulacak Havasız Çürütme Tesisinin Ekonomik Analizi

    Directory of Open Access Journals (Sweden)

    Tamer Coşkun

    2012-12-01

    Full Text Available Özet Büyükbaş hayvan atıkları, içeriğindeki yüksek katı madde, organik kirlilik ve patojen mikroorganizmalar sebebiyle halk sağlığı açısından olumsuz etkiler yapabilecek bir atıktır. Bu çalışmada havasız çürütme ile atıkların stabilize edilerek biyogaz elde edilmesi ve çürümüş atıkların toprakta doğal gübre olarak kullanılmasını içeren bir yönetim modeli uygulanmıştır. Bunun için pilot ölçekli bir havasız çürütme reaktörü işletilmiş ve çürümüş atıklar çeşitli dozlarda yonca, Macar fiğ ve arpa karışımı ile mısır silajı bitkilerinin ekildiği alanlarda doğal gübre olarak toprağa eklenmiştir. Havasız çürütme işleminde yarımcı materyal olarak mısır silajı da reaktöre beslenmiştir. Çalışma sonunda elde edilen sonuçlar ve literatür yardımıyla 1000 baş hayvan için kurulum ve işletme maliyetleri hesaplanmıştır. Kurulum maliyeti; elektrik üretim sisteminin kurulup kurulmaması açısından iki farklı değer olarak hesaplanmıştır. İşletme maliyetleri farklı tarla ürünleri ve yine elektrik sisteminin kurulup kurulmaması açılarından çeşitli durumlar için hesaplanmıştır. Sonuç olarak elde edilen en iyi sonuçlara göre; çürümüş atıklar Macar fiğ ve arpa karışımı bitkisinin ekiminde kullanıldığında kurulacak tesisin elektrik üretim sistemi de kurulduğunda 2,5 yılda, elektrik üretim sistemi kurulmadığında ise 2,1 yılda kendisini amorti ettiği bulunmuştur. Abstract Cattle manure is a potential for causing detrimental effects on human health due to its high solid matter and pathogen microorganism content. This study aims to achieve biogas production by stabilizing the waste using anaerobic digestion. Digested waste was utilized as natural fertilizer. For that reason, a pilot-scale anaerobic digestion tank was operated and digested wastes were added to soil in diverse dosages where alfalfa, the mixture of Hungarian

  1. Ortaokul Öğrencilerinin Bilgiye Erişim Aracı Olarak İnternete Yaklaşımları: Betimleyici Bir Çalışma

    Directory of Open Access Journals (Sweden)

    Halise Şerefoğlu Henkoğlu

    2015-01-01

    Full Text Available Bu çalışma, ortaokul öğrencilerinin bilgi kaynağı olarak internete yaklaşımlarının, bilgi arama sürecinde internetin sunduğu üstünlüklere ilişkin düşüncelerinin, internet ortamında bilgi ararken karşılaştıkları problemlerin ve elde ettikleri bilgiyi kullanma sürecinde kaynak gösterme özelliklerinin belirlenmesi amacıyla gerçekleştirilmiş nitel bir çalışmadır. Çalışmanın amacını gerçekleştirmek için ortaokul beşinci ve altıncı sınıf öğrencileri seçilmiştir. Araştırmanın gerçekleştirildiği ortaokulda öğrenim gören öğrencilerden çalışmaya katılmayı kabul eden 165 öğrenciye 10 adet açık uçlu sorudan oluşan bir form uygulanmış ve elde edilen veriler içerik analizi tekniğinden yararlanılarak analiz edilmiştir. Verilerin analizi sonucunda; öğrencilerin interneti bir bilgi kaynağı olarak nasıl değerlendirdikleri, bilgiye erişiminde internetin sunduğu üstünlükler ve karşılaşılan problemler, öğrencilerin bilgi arama sürecinde internette tercih ettikleri öncelikli kaynaklar ve öğrencilerin kaynak gösterme özellikleri ve kaynak gösterme konusundaki farkındalıkları belirlenmeye çalışılmıştır. Elde edilen bulgular öğrencilerin bilgiye erişimde interneti öncelikli olarak tercih ettiklerini; interneti kolay ulaşılabilen, bilgiye daha hızlı ve rahat bir şekilde erişim olanağı sağlayan ve aranan her türlü bilginin bulunabileceği bir ortam olarak algıladıklarını; internetin sunduğu üstünlüklerin yanı sıra bilgiye erişimde bireyden ve ortamdan kaynaklanan birtakım problemleri de beraberinde getirdiğini ve öğrencilerin internetten bulunan bilgileri ödevlerinde kullanırken kaynak belirtme konusunda yeterli bilince sahip olmadıklarını ortaya koymaktadır.Anahtar Sözcükler: İnternet, bilgi arama, bilgi okuryazarlığı, ortaokul öğrencileri, arama motoruApproaches of Middle School Students to Internet as an

  2. Gösterenleri Aynı Gösterilenleri Farklı Fiillere Yönelik Bir İnceleme An Examination On The Verbs Having Different Functions Though Written Same

    Directory of Open Access Journals (Sweden)

    Seda YILMAZ

    2013-03-01

    -t, -Dİr, -l, -n, -ş biçim birimleri çatı işlevinde veyahut fiilin bağımsız anlamının kendisiyle özdeşliğinin bozulmasıyla kelime türetme işlevinde kullanılmıştır.Çatı ekleri ve türetme eklerinin işlevi birbirinden tamamen ayrıdır. İlki fiille temsil edilen eylemin nesnelerle belirli bağlantılarını dile getirir, söz dizimi unsurları olan özne ve nesneyi yönetir ve fiilin semantik bir özelliği olan geçişlilik-geçişsizlik üzerinde belirleyici olur; ikincisi ise kelime kök veya gövdesinin sahip olduğu bağımsız leksik anlamın kendisiyle özdeşliğini bozar ve farklı anlama sahip bir kelime şekli ortaya çıkarır. Çatı ekleri kelimenin bağımsız anlamında böyle bir değişiklik meydana getirmediğinden türetme eki olarak değerlendirilmemelidirler.Çalışmada gösterenleri aynı gösterilenleri farklı fiillerin sahip oldukları farklı anlatılanların eksiksiz ve hatasız bir şekilde ortaya konulabilmesi için Çağdaş Türk edebiyatı malzemesinden ve konuşmalardan yararlanılmıştır. Birleşiminde söz konusu biçim birimlerin yer aldığı fiillerin işlevleri tarama yöntemiyle elde edilen örneklerle sınanmıştır.Araştırmada, incelenen fiillerin birleşiminde yer alan biçim birimlerin aynı anlatımda ya çatı ya kelime türetme işleviyle kullanıldığı, söz konusu biçim birimlerin aynı anlatımda hem çatı hem de kelime türetme işleviyle kullanılamayacağı, çatı eklerinin fiille temsil edilen eylemin nesnelerle belirli bağlantılarını dile getirmekle görevli oldukları, fiilin bağımsız anlamının kendisiyle özdeşliğini bozmadığından çatı kategorisinin ilgili morfemlerinin türetme eki olarak değerlendirilemeyeceği vb. sonuçlara ulaşılmıştır.

  3. The Challenges of the Ontario Secondary School Literacy Test for Second Language Students

    Science.gov (United States)

    Cheng, Liying; Klinger, Don A.; Zheng, Ying

    2007-01-01

    Results from the Ontario Secondary School Literacy Test (OSSLT) indicate that English as a Second Language (ESL) and English Literacy Development (ELD) students have comparatively low success and high deferral rates. This study examined the 2002 and 2003 OSSLT test performances of ESL/ELD and non-ESL/ELD students in order to identify and…

  4. Cosmological magnetic fields

    Indian Academy of Sciences (India)

    Magnetic fields are observed not only in stars, but in galaxies, clusters, and even high redshift Lyman- systems. In principle, these fields could play an important role in structure formation and also affect the anisotropies in the cosmic microwave background radiation (CMB). The study of cosmological magnetic fields aims ...

  5. Computation of flow and thermal fields in a model CVD reactor

    Indian Academy of Sciences (India)

    The algorithm is a two-step procedure, wherein the first step predicts the velocity field using an assumed pressure field. The second step corrects the fields using a Poisson equation to obtain the pressure corrections. Advection terms have been treated by a hybrid upwind-central difference technique. The computer code ...

  6. Decoherence and infrared divergence

    Indian Academy of Sciences (India)

    Abstract. The dynamics of a particle which is linearly coupled to a boson field is investigated. The boson field induces superselection rules for the momentum of the particle, if the field is infrared divergent. Thereby the Hamiltonian of the total system remains bounded from below.

  7. Düzce İlinde Arıcılığın Yapısı ve Arıcılık Faaliyetleri Üzerine Bir Araştırma

    Directory of Open Access Journals (Sweden)

    Meral KEKEÇOĞLU

    2014-09-01

    Full Text Available Düzce ili zengin florası ve eşsiz arı ekotipi nedeniyle büyük bir arıcılık potansiyeline sahiptir. Bu çalışma Düzce ilinde arıcılığın genel yapısını ve arıcılık faaliyetlerini ortaya koymak amacıyla gerçekleştirilmiştir. Araştırma kapsamında 412 arıcıya ulaşılmıştır. Yüz yüze yapılan görüşmeler ve anket çalışması ile mevcut durum ortaya konulmuştur. Elde edilen sonuçlara göre ankete katılan arıcıların yaş ortalamasının 50 olduğu, % 73,10’unun ilköğretim, % 14,10’unun lise mezunu, % 20,90’ının ana gelir kaynağı olarak arıcılık yaptığı; % 59,20’sinin Arı Yetiştiricileri Birliği’ne, % 24,50’sinin Bal Üreticileri Birliği’ne üye olduğu; % 61,50’sinin yerel bölge arısını, % 34,70’inin de Kafkas arı ırkını kullandıkları; % 46,80’inin gezginci arıcılık yaptığı, tercih edilen bitki çeşitliliğinin sırasıyla ayçiçeği (% 62,96 kestane (% 54,32 kır çiçekleri (% 22,22, kanola (% 11,73 ve ormangülü (% 11,73 olduğu, kovan başına verimin 2010 ve 2011 yıllarına göre sırasıyla 9 ve 8 kg arasında değiştiği saptanmıştır. En fazla süzme bal üretimi yapılmakta bunu polen ve propolis takip etmektedir. Bu araştırmada, Düzce arıcılığının genel yapısı ve arıcılık problemleri tespit edilmiş ve çözüm önerileri sunulmuştur

  8. Öğretmen Adaylarının “Matematik Öğretmeni”, “Matematik” ve “Matematik Dersi” Kavramlarına İlişkin Sahip Oldukları Metaforik Algılar

    Directory of Open Access Journals (Sweden)

    Baki ŞAHİN

    2013-04-01

    Full Text Available Bu araştırmanın amacı Muğla Üniversitesi Eğitim Fakültesinde okuyan öğretmen adaylarının “Matematik Öğretmeni”, Matematik” ve “Matematik” dersi kavramlarına yönelik algılarını oluşturan metaforları belirlemektir. Araştırmaya anket maddelerinin oluşturulma sürecinde iki branştan toplam  76 ve oluşturulan anket maddelerini cevaplandırmak için de  dokuz farklı branştan toplam 1185 öğretmen adayı katılmıştır. Araştırmada nitel ve nicel ölçme araçları kullanılmıştır. Elde edilen sonuçlara göre üç kavramda da öğrencilerin algılarının branşlara göre farklılaştığı görülmüştür. “Matematik Öğretmeni” kavramı en çok “Bilgili” ve “Otoriter” metaforlarıyla algılanmaktadır. “Matematik Öğretmeni” kavramı, ilköğretim matematik öğretmeni ve lise matematik öğretmeni olarak iki farklı şekilde düşünüldüğünde, algılanan metaforların da değiştiği fark edilmiştir. “Matematik” kavramı “Zeka”, “Zevkli”, “Gerekli”, “Yetenek”, “Zor”, “Başarı” metaforlarıyla ilişkilendirilmiştir. En az tercih edilen metaforlar ise, “Gereksiz”, “Kolay” ve “Otorite” olmuştur. Matematik Derslerini algılama metaforları açısından anabilim dalları öğrencilerinin üç gruba ayrıldığını göstermektedir. Fen, Sınıf ve Okul Öncesi Öğretmenli öğrencileri “Matematik Dersi” kavramını olumlu metaforlarla ilişkilendirmekte; Almanca, İngilizce ve Türkçe Öğretmenliği öğrencileri kısmen olumlu, özellikle lise yıllarında olumsuz algı oluştururken;  Müzik, Resim ve Sosyal Bilgiler Öğretmenliği öğrencileri en olumsuz, özellikle de lise yıllarında matematik dersini olumsuz algılamışlardır.

  9. BUĞDAY SAPLARINDAN (Triticum aestivum L. VE SAMAN-ODUN KARIŞIMI LİFLERDEN ORTA YOĞUNLUKTA LİF LEVHA (MDF ÜRETİMİ

    Directory of Open Access Journals (Sweden)

    Hüdaverdi EROĞLU

    2001-02-01

    Full Text Available Bu çalışmada, hammadde olarak Ankara ilinden temin edilen buğday (Triticum aestivum L. sapları kullanılmıştır. Kuru yöntemle MDF üretiminde % 8, 10 ve 12 oranında üre formaldehit tutkalı yapıştırıcı, sulu amonyum klorürün % 30'luk çözeltisinden % 1 oranında sertleştirici olarak kullanılmıştır. Ayrıca, 5, 6 ve 7 dk'lık presleme süreleri denenmiştir. Buğday saplarının alkol-benzen, soğuk su, sıcak su ve % 1'lik NaOH çözünürlüğü sırasıyla; % 5.15, % 7.31, % 9.84 ve % 40.79 olarak bulunmuştur. Ayrıca, holoselüloz, selüloz, lignin ve kül miktarları sırasıyla; % 74.79, % 52.67, % 20.17 ve % 4.21 olarak belirlenmiştir. Yapılan lif morfolojisiyle ilgili çalışmalarda kullanılan buğday saplarının lif uzunluğu 1.2-1.5 mm, lif genişliği 12-16 µm, lümen çapı 4-6 µm ve çift çeper kalınlığı 7.5-11.5 µm bulunmuştur. Buğday saplarından MDF eldesi için en uygun lif üretim şartları; buhar basıncı 10.5 atm, buharlama süresi 4 dk ve liflendirme süresi 2 dk olarak belirlenmiş ve uygulanmıştır. Saman liflerinden 0.700 g/cm 3 ve 0.800 g/cm 3 , odun ve saman-odun karışımı (% 30 saman + % 70 odun, % 50 saman + % 50 odun, % 70 saman + % 30 odun liflerden ise 0.800 g/cm 3 özgül kütleli MDF levhaları üretilmiştir. Tüm levhaların elastikiyet modülü, eğilme direnci, yüzeye dik çekme direnci ile 24 saatteki su alma ve kalınlığına şişme değerleri belirlenmiştir. Laboratuar koşullarında elde edilen MDF levhaların fiziksel ve mekanik özellikleri üzerinde yapılan değerlendirmeler sonucunda buğday saplarından en uygun MDF üretim koşulları; tutkal miktarı % 12, pres süresi 6 dakika, pres sıcaklığı 150 °C, pres basıncı 200-220 kp/cm 2 , sertleştirici miktarı % 1 ve saman/odun oranı % 50 -% 50 şeklinde belirlenmiştir.

  10. Hindiba (Cichorium intybus L. Bitkisinden Myrosinaz Enziminin Saflaştırılması, Karakterize Edilmesi ve Kozmetik Alanında Kullanılabilirliğinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Nazan DEMİR

    2014-07-01

    Full Text Available Myrosinaz glukosinolatların hidrolizinden sorumlu bir enzimdir (E.C: 3.2.3.2 β-thioglucosidase, β-thioglucoside glucohydrolase olarak da bilinir. Kanserle mücadele için umut verici bileşikler olarak kabul edilen sinigrin, glukoraphanin (GRA ve glukoraphenin (GRE gibi ara yıkım ürünlerinden dolayı bazı alifatik glukosinolatlar oldukça ilgi çekmiş ve myrosinaz enziminin bu tümör küçültücü etkisi son yıllarda önem kazanmıştır. Bu çalışmada, myrosinaz amonyum sülfat çöktürmesi, Q-sepharose, Konkanavalin A sepharose afinite kromatografisi ile Hindiba'dan (Cichorium intybus'un L. homojen olarak saflaştırıldı. Saflaştırılan protein SDS- poliakrilamid jel elektroforezinde 35 kDa ağırlığında tek bir bant olarak gözlenmiştir. Enzim pH 8,0'de ve 70 °C' de maksimum aktivite göstermiştir. Saflaştırılmış enzim 1 yıldan fazla süreyle 4° C de sabit kalmıştır. Substrat olarak sinigrin kullanılarak, saflaştırılmış enzim için KM ve Vmax değerleri sırasıyla 0,02 ve 0,074 μmol glukoz. min–1.mg–1 olarak belirlenmiştir. Enzim askorbik asit (AA, EDTA, SDS ve β-merkaptoethanol tarafından güçlü bir şekilde aktive edilmiştir. Buna ek olarak, bazı iyonların myrosinaz enzim aktivitesi üzerine 10, 1 ve 0,1 mM'lık konsantrasyonlardaki etkileri (Cu2+, Ni2+, Ca2+ incelenmiş ve enzim aktivitesini önemli ölçüde etkiledikleri belirlenmiştir. Hindiba (Cichorium intybus'un L.'dan elde edilen myrosinaz enziminin kozmetikte kullanılabilirliliği araştırılmıştır. Çalışmada saf myrosinaz enzimi içeren krem oluşturulmuş ve karışım güneş lekesi ve benzeri cilt sorunları olan 10 gönüllü denek üzerinde 20 gün süreyle uygulanmıştır. Belirlenen gün sonunda deneklerde mevcut olan lekelerin şiddetinde kısmi azalmalar gözlenmiştir.

  11. Ehl-i Sünnet Açısından Bilgi ve DeğeriKnowledge and its Value in Terms of the Ahl As-Sunnah

    Directory of Open Access Journals (Sweden)

    ismail yücedağ

    2014-06-01

    Full Text Available Kelâm ilmînin amacı, dinî inançları kesin deliller kullanarak ispat etmektir. Bu nedenle kelâmcılar Kur’an’ı ve iki kısma ayırdıkları Sünnet’in ilk kısmında yer alan mütevâtir haberleri esas almışlardır. Kelâm ilminde üç bilgi edinme yolu olduğu kabul edilmiştir. Bunlar, beş duyu, akıl ve haber-i sâdık’tır. Bilgi edinme yollarından ilk ikisini oluşturan beş duyu ve akıl ile elde edilen bilgiler ile Sünnet’in ilk kısmında yer alan mütevâtir haberin değeri konusunda İslâm âlimleri arasında bir ihtilâf söz konusu değildir. Hicretin II. asrından itibaren, sünnetin ikinci kısmını oluşturan haber-i vahid’in değeri ve itikâdî konularda delil teşkil edip etmeyeceği konusunda âlimler tarihsel süreç içinde birbirinden farklı görüşler ortaya koymuşlardır. Böylelikle problem günümüze kadar devam etmiştir. Konu hakkında fikir yürüten âlimler, Kelâmcılar ve Selefiyye olmak üzere iki ana gruba ayrılmışlardır. Bu çalışmanın amacı, haber-i vâhid hakkındaki fikir ayrılıklarının nedenlerini, kelâmcılar tarafından bilgi edinme yollarından biri olarak kabul edilen haber-i sâdıkı dikkate alarak araştırmaktır. Abstract The purpose of the Kalam science is to prove the religious beliefs by using definitive evidences. For this reason, the Kalam scholars are inclined to Koran and the mutawatir reports which are included in the first part of Ahl As-Sunnah divided into two parts. In the Kalam science, it has been accepted that there are three ways of attaining knowledge. These are the five senses, intelligence, and precise reports. It is not the case that Islamic scholars have a disagreement on not only knowledges obtained through the five senses and intelligence but the value of mutawatir reports included in the first part of Ahl As-Sunnah. As of the second century of Hegira, the scholars have put forward different opinions about whether the value of

  12. İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 / Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports

    Directory of Open Access Journals (Sweden)

    Tahir Bilirli

    2016-06-01

    Full Text Available İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 Öz Bu makale, Osmanlı Devleti'nde 1845 yılında ilan edilen Tensikât-ı mülkiye kararı çerçevesinde geçici olarak olarak kurulan İmar Meclisleri'nin görevlerini incelemektedir. Makalede, bu meclislerin özellikle halkın borç para alma durumları ile selem usulü denilen mahsulün hasattan önce satılması konusundaki faaliyetleri incelenmektedir. Hasat zamanından önce alınan vergi, ahaliyi borçlanmaya yöneltmekte, bu da halkın fahiş faiz oranlarıyla tefecilerden borç almalarına ve ürünün hasat edilmeden önce daha düşük fiyatlara satılmasına sebep olmaktaydı. Bu durum gelir kaybı nedeniyle hem tebaya hem de devlete zarar vermekteydi. İmar Meclisi memurları yaşanan bu sıkıntının giderilmesi noktasında yerinde durum tespiti yapmışlardır. Makalenin birinci bölümünde İmar Meclisleri'nin kuruluşu ve görevleri hakkında bilgi verilmektedir. İkinci bölümde makalenin ana konusu olan borçlanma ve selem usulünün uygulanmasının meclis raporlarına nasıl yansıdığı arşiv belgelerine göre ele alınmıştır. Makalenin sonuç bölümünde arşiv belgelerinde elde edilen veriler doğrultusunda değerlendirme yapılmıştır. Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports Abstract This article examines the mission of Macalis Imariyya (Develepment Counsils which were founded by the decree of Tankisat al-Mulkiyye declared in 1845. In the article, the activity of these Counsils about the indebtedness status of the people and the selling of products before the harvest -called “selem”- particularly examined. The tax collection before harvest period was impelling the people borrowing from usurers with excessive interest rates and to sell the product at nearly half price. This case was damaging both the state and the citizens because of income loss. Development Council

  13. COĞRAFİ BİLGİ SİSTEMİ YARDIMI İLE ISPARTA İLİ KENTİÇİ TRAFİK KAZA ANALİZİ

    Directory of Open Access Journals (Sweden)

    Meltem SAPLIOĞLU

    2006-03-01

    Full Text Available Son yıllarda, ülkemizde ulusal bir problem haline gelen trafik kazaları, doğal afetlerden daha fazla sosyal ve ekonomik kayıplara neden olmaktadır. Bu problemi çözebilmek, kayıpları azaltabilmek için yol güvenlik projeleri gerçekleştirilmektedir. Ancak bu projelere ayrılan bütçenin sınırlı olması nedeniyle, bazı pratik ve ekonomik çözüm yöntemlerinin bulunması gerekli olmuştur. Bu yöntemlerin en önemlisi; trafik kazalarında, tehlikeli kesimler olarak adlandırılan Kaza Kara Noktalarının tespiti ve iyileştirilmesidir. Yeni teknolojiler, trafik mühendisliğinde ve mühendislik hizmetlerinde hızlı iyileşmelere neden olan gelişme döngüsünü sürekli çevirmektedir. Bu gelişen hizmetlerin daha etkin rol üstlenebilecek ileri görüşlü mühendislik çalışmaları adına önemli bir potansiyel oluşturacağı açıktır. Çalışmada örnek olarak Isparta ilindeki trafik kazalarının yoğun olduğu bölgeler ve kaza kara noktaları Coğrafi Bilgi Sistemleri (CBS kullanılarak tespit edilmiştir. Arcinfo 7.21 programı kullanılarak digitizer ile sayısallaştırılan Isparta ili imar haritası üzerinde, tespit edilen kara noktalar ve kaza meyilli bölgeler gösterilmiştir. Isparta İli Trafik Bölge Müdürlüğü'nden alınan, 1998-2002 yılları arasında meydana gelen trafik kazalarının tespit tutanakları ile veri tabanı oluşturulmuştur. Trafik kazası çarpışma diyagramları ile coğrafi kodlama referans sistemleri kullanılarak topoloji kurulmuştur. CBS'nin kaza analizinde niçin kullanıldığı, çalışmada kullanılan veri tabanının oluşturulması ve kullanılan yöntem gösterilmiştir. Elde edilen sonuçlara göre tablolar oluşturulmuş ve yorumlanmıştır.

  14. Ortaokula devam eden işitme engelli öğrencilerin yazı performanslarının incelenmesi: Örnek grup çalışması

    Directory of Open Access Journals (Sweden)

    Reşat Alatlı

    2017-04-01

    Full Text Available Bu çalışmada, işaret dili ile dikte edilen bir metin incelenerek, işitme engelli öğrencilerin yazma performanslarının belirlenmesi amaçlanmıştır. Araştırmaya 6.,7. ve 8. sınıfa devam eden 10 işitme engelli öğrenci katılmıştır. Araştırmada veri toplama aracı olarak, araştırmacıların hazırladığı, uzman görüşü alınmış ve gündelik hayatta sık kullanılan sözcüklerin yer aldığı 57 kelimeden oluşan bir metin kullanılmıştır. Yazılı metinlerdeki, yazma hataları analiz edilmiştir. Elde edilen yazılı metinlerde harf ve/veya hece atlama (letter and/or morpheme omission, harf ve/veya hece ekleme (addition of letter and/or morpheme, sözcük atlama (word omission, sözcük ekleme (addition of word hataları olduğu görülmüştür. Ayrıca kelimenin yanlış olarak kullanılması ve çekim eki hataları gibi hatalar yaptıkları belirlenmiştir. İşitme engelli öğrencilerin, yazılı anlatım becerilerindeki sınırlılıklarının, günlük yaşam ve akademik beceriler üzerindeki etkisi alanyazın çerçevesinde tartışılmıştır. The purpose of this study is to investigate the writing performance of students with hearing impairment who are attending secondary school, on a text which has been dictated by the sign language. 10 students with hearing impairment, who are at 6th, 7th , and 8th grades, have participated in the study. A text prepared by the researchers which included 57 frequently used words, was dictated by sign language. Writing errors in the text were analyzed qualitatively. According to the results, students with hearing impairment have a number of limitations such as the omission of letters and/or morphemes, the addition of letters and/or morphemes, omission and/or adding words, mistakes on using the words and inflections. Also, it has been concluded within the scope of the information in the field that how these limitations affect academic and daily life skills.

  15. Growth and Reproduction of Female Brushtooth Lizardfish Saurida undosquamis (Richardson from the Gulf of Suez, Egypt.

    Directory of Open Access Journals (Sweden)

    Magdy M. El-Halfawy

    2015-12-01

    Full Text Available Süveyş Körfezi’nde (Mısır lokum balığı Saurida undosquamis (Richardson dişi bireylerinin büyüme ve üremesi. Ekim 2004’ten Mayıs 2005’e kadar Süveyş Körfezinden trol ile yakalanan ve Attaka balıkçı limanından çıkarılan 434 Lokum balığının (Saurida undosquamis ilk olgunluk boyu, yumurtlama dönemi, büyüme parametreleri ve yaş kompozisyonu ele alındı. Dişilerin total uzunluğu 13.2 ile 34 cm arasında değişim göstermiştir. Boy (L-Ağırlık (W arasındaki ilişki W=0.0038 L3.1666 olarak tespit edildi. FISAT programı ile analizi yapılan boy frekanslarından elde edilen yaş verileri von Bertalanffy denkleminin (1938 büyüme parametrelerinin tahmininde kullanıldı. Tahmin edilen parametreler L∞=35.56cm, K=0.26 ve t=-1.059 idi. Saurida undosquamis dişileri için maksimum yaş 6 olarak tespit edilmiştir. Yakalananlar içinde 3 yaş grubu dominant olarak gözlenmiştir. Ovaryum, gonadosomatik indeks ve oosit çapının makroskobik görüntülerinden Saurida undosquamis’in yumurtlama mevsiminin Aralık ve Mayıs’ta iki dönemlik artış göstermesiyle birlikte tüm yıl boyunca sürdüğü anlaşıldı. Gonadların, bakir, olgun bakir, gelişmekte olan, gelişmiş, yumurtlayan ve yumurtalarını dökmüş gibi dış görünüşe dayanan yedi aşaması belirlendi. Dişilerin 18.1cm’lik total boyda olgunluğa ulaşmığı tespit edilmiştir. Total, doğal ve avcılıktan kaynaklanan ölümlerinin yıllık değerleri sırasıyla 1.22, 0.99 ve 0.23 yıl-1 olarak hesaplandı. Tüketim oranı (E 0.81 olarak tahmin edildi. Her toplamadaki ilgili verim ve biomas analizleri Süveyş körfezindeki Saurida undosquamis dişi stoklarının tüketilmiş oldugu bulunmuştur. Bireylerin en azından %50’sinin toplanma ve yumurtlatma için korunmasını garantilemek amacıyla, şu anki kullanım oranının yaklaşık %53.1’e kadar azaltılması gerekmektedir

  16. TURİZM SEKTÖRÜNDE ÇALIŞANLARIN HUKUKİ HAKLARINA İLİŞKİN FARKINDALIKLARI: KONAKLAMA VE YİYECEK-İÇECEK İŞLETMELERİ ÇALIŞANLARI ÜZERİNE BİR ARAŞTIRMA

    Directory of Open Access Journals (Sweden)

    Özgür Hakan ÇAVUŞ

    2015-04-01

    Full Text Available ÖZ: Ekonomik, sosyal ve siyasal koşullar çalışma hayatını yakından etkilemektedir. Bu nedenle hukuki düzenlemeler iş hayatında ve bireylerin sosyal yaşamlarında önemli bir role sahiptir. Bu bağlamda, hemen her sektörde çalışanların özlük haklarına ilişkin yeterli bilgiye sahip olması beklenir. Bu çalışma turizm sektöründe çalışanların sosyal haklarına ilişkin farkındalıklarını test etmeye çalışmaktadır. Araştırmadan elde edilen veriler SPSS 20 ile frekans ve yüzde dağılımlarına tabi tutulmuş ve elde edilen sonuçlara makalede yer verilmiştir. Ayrıca parametrik ve parametrik olmayan testlere yönelik analizler de yapılarak katılımcıların cinsiyet, medeni durum, gelir ve eğitim durumlarıyla uygulamalar arasındaki farklılıklar tespit edilmeye çalışılmıştır. Boyutlar arasındaki ilişkileri tespit etmek amacıyla yapılan korelasyon analizinde ilişki dereceleri oldukça yüksek çıkmıştır. Son olarak yapılan regresyon analizlerine ilişkin bulgularda bağımsız değişkenlerin bağımlı değişkeni açıklama oranı %33 olarak tespit edilmiştir. Elde edilen istatistikî bulgulara göre, turizm sektöründe sendikalı çalışanların sendikal haklarına ilişkin bilgilerinin yüksek olduğu ancak sosyal sigorta haklarına ilişkin bilgilerinin düşük olduğu belirlenmiştir. Özellikle turizm çalışanlarının emeklilik işlemlerine ve haklarına ilişkin farkındalıklarının ise daha düşük olduğu gözlenmiştir. Katılımcıların cinsiyetleri ile İş Kanunu uygulamaları arasında anlamlı farklılıklar görülmüş bu bağlamda kadınların erkeklere oranla İş Kanunu uygulamalarına daha fazla önem verdikleri görülmüştür. Son olarak 1-5 yıl arasında turizm sektöründe sendikalı çalışanların İş Sağlığı ve Güvenliği Kanunu uygulamalarını daha yakından takip ettikleri saptanmıştır. Anahtar Kelimeler: Turizm

  17. Türkiye’de Adli Belge İncelemesinde Bilirkişilik Sisteminin Değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    Nevzat Alkan

    1998-12-01

    Full Text Available Adli belge incelemesi, adli bilimlerin önemli çalışma alanlarından birisidir. Çalışmamız, yurdumuzda adli belge incelemesi ile ilgili bilirkişilik uygulamalarının nasıl, hangi kuruluşlarda, kimlerce ve hangi prensiplerle yapılmakta olduğunu irdelemeyi amaçlamaktadır. Bu amaçla bilirkişiliği düzenleyen kanun maddeleri, bu konuda çalışan resmi bilirkişi kuruluşları, bu kuruluşlarda yer alan adli belge inceleme laboratuvarları, bu laboratuvarların iş yükleri, teknik ve eleman kapasiteleri, eleman seçimlerinde uygulanan prensipler, adli belge incelemesi alanında özel bilirkişilik uygulamaları ile Adli Tıp Uzmanları Derneği ve Adli Bilimler Derneği' nin tüzükleri incelenerek tartışılmıştır. Elde edilen veriler, adli belge incelemesinde yurdumuzda yeni yasal düzenlemeler yapılması gerekliliğini ortaya çıkarmaktadır. Böylece uygulamada, belirlenmiş çalışma standartları ve eğitim kurallarının oluşturulması ve ayrıca istismarı önlemek amacıyla yeterli denetimlerin yapılması sağlanacaktır. Bu da ancak yasal düzenlemelerin yanı sıra, tüm bilirkişilik alanlarında geçerli olduğu gibi meslek örgütlerinin yapacağı iç düzenlemeler ile mümkün olabilecektir. Anahtar Kelimeler: Adli Tıp, Adli Bilimler, Adli Belge İncelemesi, Grafoloji, Kaligrafi.

  18. magna (Straus, 1820.

    Directory of Open Access Journals (Sweden)

    Hatice Parlak

    2015-12-01

    Full Text Available Nif Çayi Kirletilmiş Tatli Su ve Sedimentinin Daphnia magna (Strauss, 1820 Üzerine Akut Ve Kronik Toksisitesi. Nif Çayı Endüstriyel, evsel ve tarımsal deşarjlar ile doğrudan kirlenmektedir. Çayın suyunun evsel ve endüstriyel alanlarda sulama ve yıkama suyu olarak kullanılması rahatsızlık verici boyuttadır, bu nedenle doğal populasyonlar için potansiyel toksisitesinin bilinmesi büyük öneme sahiptir. Bu çalışmanın amacı Nif Çayı su ve sediment örneklerinin su piresi Daphnia magna kullanılarak toksisitesinin belirlenmesidir. Su ve sediment örneklerinin letal toksisitesi 48-saat akut test, subletal toksisite ise 7-gün kronik test ile gerçekleştirilmiştir. D.magna kullanılarak yapılan 48 saat Akut test sonuçlarına göre LC 50 değerleri su örnekleri için 6.8 ile 12.67 µl/L arasında sediment örnekleri içn 6.826 ile 38.038 µg/L arasında bulunmuştur. Subletal konsantrasyonlara maruz bırakılarak yapılan kronik testler sonucunda tüm istasyonlardan alınan su ve sediment örneklerin canlının üremesi üzerine negatif etkisi olduğu gözlenmiştir. Elde edilen veriler ışığında bu deneme sisteminin rutin kirlilik belirleme çalışmaları için uygunluğu tespit edilmiştir

  19. Sosyal Medya Reklamlarını Görmemek İçin Para Verir Miydiniz? Facebook Özelinde Bir Çalışma

    Directory of Open Access Journals (Sweden)

    Gökhan Aydin

    2017-06-01

    Full Text Available Kullanımları dünya genelinde yaygınlaşan sosyal medya siteleri ciro yaratarak karlı birer işletme haline gelebilmek için günümüzde reklam destekli iş modelleri kullanmaktadır. Kullanıcıların ücretsiz olarak kullanmaya alıştığı bu platformlara erişim için ücret ödemek istemeyecekleri varsayımıyla reklam destekli modeller tercih edilmektedir. Bu çalışma içerisinde sosyal medya sitelerinin en yaygın kullanılanı olan Facebook üzerinde gösterilen reklamlara kullanıcıların tutumları ölçümlenmiş ve bu tutum ve tutumu oluşturan faktörlerin Facebook reklamlarını görmemek için para ödemeye etkisi test edilmiştir. Ödeme eğiliminde olan ve olmayan kullanıcılar arasında farklılar irdelenmiştir. Literatürde kabul görmüş ölçekler yardımıyla hazırlanan anket formu İnternet üzerinden Facebook kullanıcılarına dağıtılmış, elde edilen 327 soru formu bir ön-analiz sürecinden geçirilerek düşük kaliteli ve tam doldurulmamış anketler ayıklanarak 281 kullanılabilir soru formuna ulaşılmıştır. Verilerin analizinde yapısal eşitlik modellemesi kullanılmıştır. Gerçekleştirilen analiz sonuçlarına göre Facebook reklamlarına olan tutum ve tutumun öncülleri reklamları görmemek için ödeme niyetine olumsuz yönde etki etmektedir.

  20. Doğadan Toplanan ve Portakal Kütüğünde Yetiştirilen Ganoderma lucidum (Curtis P. Karst Mantar Türünün Bazı Kimyasal İçeriklerinin Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Nezahat Turfan

    2016-03-01

    Full Text Available Ganoderma lucidum (Curtis P. Karst (Reishi mantarı tıbbi mantar türlerinden biridir. Mantarların kimyasal içerikleri, yetişme ortamlarının fiziksel ve kimyasal özelliklerine bağlı olarak önemli değişiklik göstermektedir. Bu çalışmada; doğadan toplanan ve portakal kütüğünde yetiştirilen Ganoderma lucidum mantarlarının toplam çözünür protein, toplam çözünür karbonhidrat (glikoz, fruktoz ve sakkaroz ve bazı element (P, K, Mg, Mn, S, Fe, Ca ve Na içerikleri araştırılmıştır. Elde edilen bulgulara göre, portakal kütüğünde yetiştirilen G. lucidum mantarlarının toplam protein, glikoz, fruktoz, sakkaroz ve nişasta miktarları, doğadan toplanan G. lucidum mantarlarına göre daha yüksek bulunmuştur. Fosfor, demir, sodyum, potasyum ve sülfür içerikleri portakal kütüğünde yetiştirilen mantarlarda daha yüksek iken, kalsiyum, magnezyum, manganez ve çinko değerlerinin doğadan toplananlara göre daha fazla olduğu belirlenmiştir. Bu sonuçlara göre, portakal kütüğünde yetiştirilen G. lucidum mantarı örneklerinin, doğadan toplananlara göre daha yüksek besin değerlerine sahip olduğu söylenebilir.

  1. Türkçe Derslerindeki Dinleme Metinlerinde Dinleme Yöntem/Tekniği - Metin Türü İlişkisi / The Relationship between Listening Method/Technique- Text Type in Listening Texts of Turkish Courses

    Directory of Open Access Journals (Sweden)

    Ömer KEMİKSİZ

    2016-01-01

    Full Text Available Yapılandırıcı yaklaşımla hazırlanan Türkçe Dersi (6, 7, 8. Sınıflar Öğretim Programı’nda dinleme becerisi ayrıntılı bir şekilde ele alınmış ve Türkçe derslerindeki her temada bir dinleme metnine yer verilmesi zorunluluğu getirilmiştir. Dinleme metinlerinin işlenişinde kullanılabilecek yöntem/ tekniklere de programda değinilmiştir. Türkçe Dersi (6, 7, 8. Sınıflar Öğretim Programı’nın dinleme yöntem/teknikleri bölümünde yedi tür dinleme yöntem/tekniğinden bahsedilmiştir. Bu yöntem/teknikler katılımlı dinleme, katılımsız dinleme, not alarak dinleme, kendini konuşanın yerine koyarak dinleme (empati kurma, yaratıcı dinleme, seçici dinleme ve eleştirel dinlemedir. Bu çalışmada 6, 7, 8. Sınıf Türkçe dersi öğretmen kılavuz kitaplarında yer alan dinleme metinlerinde hangi tür metinlere yer verildiği tespit edilmiş, bu metinlerin hangi yöntem/ tekniklerle işlendiği üzerinde durulmuştur. Elde edilen bulgulardan hareketle dinleme yöntem/tekniği- metin türü dağılımı belirlenmiştir. Çalışmada her sınıf seviyesi için biri Bakanlık biri özel yayınevi olmak üzere ikişer kılavuz kitap incelemeye alınmıştır. Çalışma nitel araştırma yöntemlerinden doküman incelemesi ile gerçekleştirilmiştir.

  2. Profitability and Productivity Analysis of Fishery Enterprises in Lake Durusu (Terkos.

    Directory of Open Access Journals (Sweden)

    Meral Soylu

    2015-12-01

    Full Text Available Durusu (Terkos Gölü Balıkçı İşletmelerinin Karlılık ve Verimlilik Analizi. Bu araştırma, Durusu Gölü balıkçı işletmelerinde kullanılan üretim faktörlerinin dağılımlarını ve kaynak kullanım etkinliğini tespit etmek, optimum kaynak kullanımını sağlayarak karlılık ve verimliliği yükseltmek için alınabilecek önlemleri belirlemek amacıyla yapılmıştır. Çalışmanın materyalini gölde tüm balıkçı işletmelerinden (23 adet 2006-2007 yılları arasında anket yoluyla elde edilen veriler oluşturmaktadır. Balıkçı işletmelerinin değerlendirilmesinde Cobb-Douglas üretim fonksiyonu kullanılmıştır. Yapılan çoklu regresyon analizi sonucuna gore balıkçı işletmelerinde ölçeğe göre artan verim tespit edilmiştir. Girdilerin marjinal verimliliği işçilikte 2.15 TL, kumanya -1.62 TL, yakıt 1.81 TL, bakım – onarım 1.16 TL, sermaye amortismanı 2.73 TL ve diğer masraflar 2.88 TL olarak belirlenmiştir. İşletmelerin verimlilik değerleri gerçek ve tahmini üretim değerleri kullanılarak hesaplanmış ve ortalama verimlilik 102.48 olarak belirlenmiştir. İşletmelerin karlılık oranları hesaplanmış ve ortalama karlılık 1.50 olarak belirlenmiştir

  3. SANTRİFÜJ POMPANIN KANATLI VE KANATSIZ DİFÜZÖRÜNDEKİ AKIŞIN SAYISAL İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    K. Melih GÜLEREN

    2004-03-01

    Full Text Available Bu çalışmada 5 kanatlı bir santrifüj pompanın kanatlı ve kanatsız difüzöründe akış karakteristiği sayısal olarak incelenmektedir. Kullanılan yöntem, kararlı, sıkıştırılamaz ve viskoz akış kabulüyle, 2-boyutlu Navier-Stokes denklemlerinin sonlu hacimler tekniğine uygun olarak çözülmesini içermektedir. Çalışmada kullanılan pompanın çalışma aralığı 890 d/dak, çark çapı yaklaşık 20 cm ve geriye dönük kanat geometrisine sahiptir. Kanatsız difüzör, paralel düzlemsel duvar tipi olup, kanatlı difüzör ise 9 kanatlı ve salyangoz çeperi ile kuşatılmıştır. Çark çıkışı ve difüzördeki jet ve çevrintili akış yapıları ayrıntılı olarak araştırılmış olup, kanatlı ve kanatsız difüzör durumunda pompa performansına olan etkileri irdelenmiştir. Sonuçlar, performans eğrilerinin yanında, difüzördeki hız vektörleri, eş basınç eğrileri ve türbülans kinetik enerji dağılımları olarak verilmiştir. Ayrıca elde edilen sonuçlar, mevcut deneysel verilerle karşılaştırılarak aralarındaki paralellik araştırılmış olup büyük bir uyum içerisinde olduğu görülmüştür.

  4. Problem Davranışların Azaltılmasında İşlevsel İletişim Öğretiminin Etkililiği: Betimsel ve Meta-Analiz Çalışması

    Directory of Open Access Journals (Sweden)

    Mine Sönmez

    2010-01-01

    Full Text Available Problem davranışlarının iletişim kurma işlevine hizmet ettiği giderek daha fazla kabul görmekte ve bireylere, sergiledikleri problem davranışla aynı işleve hizmet edecek iletişim becerilerinin öğretilmesi yoluyla problem davranışların azaltılabileceği belirtilmektedir. İşlevsel iletişim öğretimi bu amaçla kullanılan bir tekniktir. Bu çalışmasında işlevsel iletişim öğretimi kullanılarak problem davranışların azaltılması amacıyla yürütülen 27 adet tek denekli araştırma desenli makale incelenmiştir. Araştırmalar öncelikle betimsel olarak özetlenmiş ardından etki büyüklüğü hesaplaması yoluyla meta-analiz kullanılarak incelenmiştir. Elde edilen bulgular alanyazında yer alan diğer bilgiler ışığında yorumlanmış ve ileri araştırmalara yönelik önerilerde bulunulmuştur. It is currently a well-known fact that problem behaviors serve to various functions, such as communicating, and also believed that if communication skills are being taught, problem behaviors will decrease. Teaching functional communication skills is one of techniques to deal with problem behaviors. Twenty-seven studies using single subject research designs and aiming at decreasing problem behaviors by using teaching functional communication skills were considered to be investigated in the current meta-analysis study . Studies at first were summarized descriptively and then examined using meta-analysis by effect-size calculations. Results are being discussed based on related literature and suggestions are being provided.

  5. Bursa’da Otopsisi Yapılan Asker Ölümleri

    Directory of Open Access Journals (Sweden)

    Nursel Türkmen

    2006-12-01

    Full Text Available Askerlik görevi, fiziksel ve ruhsal stres bakımından kişilerde özel bir durum oluşturmaktadır. Her ülke veya toplumda değişik faktörlerin askerlerde farklı nitelikte adli olay ve ölümlere yol açtığı görülmektedir. Bu çalışmada 5 yıllık süre içerisinde Bursa’da otopsisi yapılan asker ölüm olgularının çeşitli yönlerden incelenmesi ve konunun adli-tıbbi boyutunun ortaya konulması amaçlanmıştır. Adli Tıp Kurumu Bursa Grup Başkanlığında 1999-2003 yılları arasında otopsileri yapılan toplam 3065 adli olguya ait kayıtlar retrospektif incelenmiş, toplam 39 adet asker ölüm olgusunun çeşitli açılardan özellikleri araştırılmıştır. Olguların tümü erkek, en sık ölüm 21 yaş grubunda olup %46.15 ile intihar sonucu ölümler ilk sıradadır. Askerlerde ölüm olgularında mutlaka otopsi ve rutin postmortem incelemeler yapılarak elde edilen doğru ve ayrıntılı verilerin, bu ölümleri önleyici araştırmalar için gerekli stratejilerin ortaya konulmasında yararlı olacağı kanısındayız. Anahtar kelimeler: Asker, ölüm, otopsi.

  6. An Empirical Investigation on International Journals of Tourism, Travel, Recreation and Leisure Dünya Genelinde "Turizm", "Rekreasyon" ve "Boş Zamanlar ve Değerlendirilmesi" Alanlarında Yayımlanmakta Olan Akademik Dergiler Üzerinde Bir Araştırma

    Directory of Open Access Journals (Sweden)

    Nazmi Kozak

    1999-03-01

    Full Text Available This study presents the results of an empirical research carried out amongst tourism, travel, recreation and leisure journals published, internationally. The findings of previous research were used for the development of the questionnaire instrument. The questionnaire was mailed to the Chief-Editors of 115 journals. A total of 33 usable questionnaires were returned yielding a 29 Chief-Editors of 115 journals. A total of 33 usable questionnaires were returned yielding a 29 percent response rate. SPSS for Macintosh was used for the analysis of data. Findings were analysed on the basis of three groups entitled general issues 'review process of manuscripts' and 'publication of manuscripts'. The study revealed that the journals were in an attempt to be consistent with the manuscript review and publication guidelines recognised, in the international academia. Bu çalışma, uluslararası boyutta yayımlanmakta olan "Turizm", Rekreasyon" ve "Boş Zamanlar ve Değerlendirilmesi" alanlarındaki akademik dergiler üzerinde yürütülen araştırmanın verileri baz alınarak hazırlanmıştır. Araştırma, daha önce bu alanda gerçekleştirilmiş çalışmaların bulgularından yararlanılarak hazırlanan sorular ile yürütülmüştür. Adresleri saptanan 115 derginin editörüne postayla gönderilerilen araştırma sorularına 33 derginin editöründen yanıt alınmıştır. Elde edilen bulguların SPPS for Mackintosh istatistik paket programında analiz edilmesiyle, dergilerle ilgili "genel", "makale denetleme" ve makale yayımlama" uygulamalarına ilişkin çeşitli bulgulara ulaşılmıştır. Araştırmada sonuç olarak, genel itibariyle dergilerin dünya genelinde geçerliliği kabul edilmiş makale denetleme ve yayımlama kurallarına uyma çabası içerisinde olduğu ortaya çıkarılmıştır.

  7. PC-3 Prostat Kanser Hücreleri Üzerinde İndosyanin Yeşili Kullanarak Yapılan Fotodinamik Terapinin AO/PI Boyama Testi Sonuçları

    Directory of Open Access Journals (Sweden)

    Mustafa Kemal RUHİ

    2017-06-01

    Full Text Available Fotodinamik terapi (FDT prostat kanseri tedavisinde henüz araştırma aşamasında olan sağaltıcı bir alternatiftir. FDT, ışığa duyarlı bir kimyasal maddenin (fotosensitizan ışık ile aktive edilmesi ve aktive olan kimyasalın kanserli bölgedeki hücre canlılığını baskılayıcı etkiye neden olması prensibine dayanmaktadır. Bu yeni tedavi yöntemi hem seçiciliği hem de yan etkilerinin azlığı nedeniyle alternatifler arasında ön plana çıkmaktadır. FDT’de kullanılan fotosensitizanın ışıksız ortamda sitotoksik olmaması ve vücuttan kolay atılabilmesi istenmektedir. Ayrıca herhangi bir fotosensitizanın yakın kızılaltı ışık ile aktive olması, bu dalgaboyunun deriye ve diğer dokulara daha fazla nüfuz etmesinden dolayı tercih sebebidir. Bu özelliklere sahip olan İndosiyanin Yeşili (ISY daha çok floresans özelliği ile ön plana çıkmış ve görüntüleme amaçlı olarak kullanılmıştır. Bu in vitro çalışmada ISY-FDT’nin farklı inkübasyon süreleri sonundaki etkisi AO/PI boyama yöntemi kullanarak ortaya konmuştur. Elde edilen sonuçlar ISY-FDT’nin hücre canlılığını baskıladığını göstermektedir.

  8. iÇME SUYU ARITIMINDA KiMYASAL MADDE KULLANIMI VE OPTİMİZASYONU

    Directory of Open Access Journals (Sweden)

    Ali BERKTAY

    1997-01-01

    Full Text Available Su ihtiyacının karşılanmasına yönelik olarak yüzeysel suların arıtılmasında kimyasal madde kullanımı gerekmektedir. Koagülasyon (pıhtılaştırma ve flokülasyon (yumuşaklaştırma işlemlerinde kullanılan kimyasal maddelerin optimum miktarlarının bulunması sağlık ve işletme ekonomisi açısından önemlidir.Bu çalışmada, içme suyu arıtımında kimyasal madde kullanımı, bunların optimum miktarlarının bulunması üzerinde durulmuş ve Konya içme suyu arıtma tesisinde kullanılan kimyasal maddelerin optimum miktarları belirlenmeye çalışılmıştır. Bunun için laboratuarda çeşitli şartlarda bir dizi jar-test deneyleri sürdürülmüş ayrıca giriş ve çıkış suyuna ait pH, sıcaklık ve bulanıklık ölçümleri yapılmıştır. Deneysel çalışmalardan elde edilen sonuçlara göre, hamsu bulanıklığını 5.0 NTU değerinin altına düşürmek için yaklaşık 35.0 mg/L alüminyum sülfat dozunun yeterli olabileceği belirlenmiştir. Koagülant yardımcısı olarak polielektrolit kullanımına devam edilmesinin yararlı olacağı ve ayrıca kimyasal madde kullanımında yapılacak optimizasyon ile kimyasal madde sarfiyatında yaklaşık % 15 tasarruf sağlanacağı sonucuna varılmıştır.

  9. Kompozit Membranlar Kullanılarak Kırmızı Çamurdan Metallerin Geri Kazanılması

    Directory of Open Access Journals (Sweden)

    Tuğba SARDOHAN KÖSEOĞLU

    2014-07-01

    Full Text Available Bu çalışmada, farklı yapılara sahip katyon değiştirici özellikleri olan kompozit membranlar (Poli N-etil anilin, Poli N-metil anilin, Polipirol ve Poli 2-flor anilin membran kullanılarak kırmızı çamur çözeltisinden Ti(IV, Fe(III ve Al(III iyonlarının geri kazanılması amaçlanmıştır. Kırmızı çamur, asit çözeltisi ile muamele edilerek metallerin çözeltiye geçmesi sağlanmış ve çözeltideki metallerin farklı katyon değiştirici kompozit membranlar kullanılarak Donnan diyaliz metodu (DD ile geri kazanım deneyleri yapılmıştır. Deney sonrasında her metal için akış (J ve geri kazanma faktörü (RF değerleri hesaplanmıştır. Bütün membranlar için elde edilen sonuçlar incelendiğinde, kırmızı çamur bileşiminde Al(III iyonunun, Ti(IV iyonundan daha fazla bulunmasına rağmen, Ti(IV (% 26-29 iyonunun, Al(III (% 21-25 iyonundan daha fazla oranda geri kazanılabildiği görülmüştür. Kırmızı çamur bünyesindeki metallerin ayrılmasında, metallerin değerliğinin, hidratlaşma çapının, iyonların mobilite hızının ve membran yapısının etkili olduğu sonucuna varılmıştır. Farklı membranlarda farklı akış değerlerinin olması da membran yapılarının farklılığı ile açıklanmıştır.

  10. Bazı Uçucu Yağların Myzus persicae ve Avcısı Chrysoperla carnea Üzerindeki Etkileri

    Directory of Open Access Journals (Sweden)

    Ali KAYAHAN

    2016-06-01

    Full Text Available Bu çalışmada, laboratuvar koşullarında farklı bitkisel uçucu yağların Şeftali yeşil yaprakbiti Myzus persicae (Sulz. (Hemiptera: Aphididae ve bu zararlının avcısı olan Chrysoperla carnea (Stephens (Neuroptera: Chrysopidae üzerindeki etkisi belirlenmiştir. Denemeler 25±1° C sıcaklığa, %60±5 ve 16:8 aydınlatma koşullarına sahip iklim odalarında gerçekleştirilmiştir. Yaprak biti bireyleri biber bitkileri (Capsicum annuum L. üzerinde üretilirken, avcılar bu afit ile beslenmiştir.  Bitkisel yağların etkileri püskürtme yöntemi ile araştırılmıştır. Kontrol uygulamalarında saf su kullanılmıştır. Uygulamadan 1., 3., 5. ve 7. günden sonra ölü ve canlı bireyler sayılmıştır. Bitkisel yağların etkisi Abbott formülü kullanılarak değerlendirilmiştir. Denemeler 5 tekerrürlü olarak yürütülmüştür. Elde edilen sonuçlara göre; karanfil, lavanta ve ardıcın M. persicae üzerindeki 7. gündeki etkisi sırasıyla %78.26, %69.57 ve %47.83 olarak bulunmuştur. Uygulanan tüm uçucu yağların C. carnea için zararsız olduğu görülmüştür.

  11. Peyzaj Planlamada Biyoklimatik Konfor Alanların Belirlenmesi: Cide Kıyı Şeridi Örneği

    Directory of Open Access Journals (Sweden)

    Mehmet Cetin

    2016-09-01

    Full Text Available Genellikle insanlar sıcaklık, yağış, nem ve rüzgâr gibi çevre şartlarının belirli aralıklarda olduğu durumlarda kendilerini daha sağlıklı ve dinamik hissederler. Bu değerlerin insanlar için uygun aralıklarda olması Biyoklimatik konfor olarak isimlendirilir. Biyoklimatik konfor uygun değer aralığında olmadığında insanlar o alanlarda rahatsız olur ve alandan uzaklaşmak isterler. Dolayısıyla turizm amaçlı olarak kullanılan alanlarda Biyoklimatik konfor oldukça önemlidir. Bu çalışmada, Kastamonu-Cide kıyı şeridinin Biyoklimatik konfor haritalamasının yapılması ve böylece benzer yapıda ki kıyı alanlarında yapılacak benzer çalışmalara altlık oluşturulması amaçlanmıştır. Bu amaçla, Cide’nin bulunduğu bölgenin iklim verilerinden; fizyolojik eşdeğer sıcaklık endeksine göre Biyoklimatik konfor haritaları üretilmiştir. Alanın Biyoklimatik konfor yapısını belirlemek için, iklimsel veriler meteoroloji istasyonundan toplanmıştır. Elde edilen veriler Rayman 1,2 vasıtasıyla değerlendirilmiş ve coğrafi bilgi sistemi (CBS yazılımları yardımıyla termal algı haritaları üretmek için kullanılmıştır. Çalışma sonucunda psikolojik eşit sıcaklık değerlerine göre, açık hava rekreasyon faaliyetleri için en uygun dönemler ve bölgeler termal algı haritaları vasıtasıyla tespit edilmiştir. Kısaca sonuç yazılmalıdır.

  12. Comparison of polyphenol oxidase activity in different parts of deep water pink shrimp (Parapenaeus longirostris by using L-DOPA substrate in Marmara Sea during the fishing season.

    Directory of Open Access Journals (Sweden)

    Şükran Çaklı

    2015-12-01

    Full Text Available Melanosis derin su pembe karidesinin pazar kaybı için önemli bir problemdir. Bunun sorumlusu olan polifenol oksidaz (PPO enzim aktivitesidir. PPO’nun özelliğini daha iyi anlamak ve oluşan aktiviteyi düşürme amacı için, ölüm sonrası derin su pembe karidesi türünün(Parapenaus longristris farklı dokularında polifenol oksidaz (PPO enzim aktivitelerinin tespiti çalışılmıştır. Aktivite analizleri yedi ayrı dokuda çalışılmıştır: kafa (seflahalotoraks+karapas, karapas, dış iskeletin abdomen bölgesi, yüzme bacakları, yürüme bacakları, uropodlar ve telson bölgelerinde ayrı ayrı analizleri yapılmıştır. Sonuçlar doğrultusunda derin su pembe karidesinde PPO aktivite dağılımının kafadan telsona doğru azaldığı tüm çalışma boyunca tespit edilmiştir. Ayrı dokularda yapılan dağılım incelemesinde %70 amonium sulfat çökeltmesi sonucunda en yüksek aktivite kafa ve abdomen arasında kalan bölgede görülmüştür. Fakat cinsiyetler arasında istatistiksel anlamda önemli bir fark görülmemiştir. Ayrıca PPO aktivite düzeylerinin kıyaslanması tüm av sezonu boyunca yapılmıştır. Türün önemi bu türün ekonomik değerinden gelmektedir ıve literatürde Marmara Denizinden avlanan türle ilgili PPO aktivitesi ile ilgili kaynağa rastlanmamıştır. Elde edilen veriler Marmara Ddenizinde bulunan erkek ve dişi karideslerin mevsimsel aktivite düzeylerinide göstermektedir

  13. SPEAKING ANXIETY SCALE FOR PROSPECTIVE TEACHERS: A VALIDITY AND RELIABILITY STUDY ÖĞRETMEN ADAYLARINA YÖNELİK KONUŞMA KAYGISI ÖLÇEĞİ: BİR GEÇERLİK VE GÜVENİRLİK ÇALIŞMASI

    Directory of Open Access Journals (Sweden)

    Oğuzhan SEVİM

    2012-06-01

    Full Text Available The purpose of this study is to develop the speaking anxiety scale that measures teacher candidates’ speaking anxiety. The sample of study is 338 teacher candidates who study in the social and natural sciences. The data of study were collected with speaking anxiety scale consisting of 35 items after a comprehensive literature review. It was made validity and reliability studies on the collected data and it was reached the last form of speaking anxiety scale consisting of 20 items. According to the analysis of data obtained from study, it was understood the scale developed is applicable. Bu çalışmada öğretmen adaylarının konuşma kaygılarının ölçülebilmesine yönelik bir konuşma kaygısı ölçeği geliştirmek amaçlanmıştır. Çalışma grubunu sosyal ve fen bilimleri alanlarında öğrenim gören 338 öğretmen adayı oluşturmaktadır. Araştırmanın verilerikapsamlı bir literatür taraması sonrasında hazırlanan 35 maddelik konuşma kaygısı ölçeğiyle toplanmıştır. Toplanan bu veriler üzerinde geçerlik ve güvenirlik çalışmaları yapılarak 20 maddeden oluşan konuşma kaygısı ölçeğinin son şekline ulaşılmıştır. Çalışmadan elde edilen verilerin analizine göre geliştirilen ölçeğin uygulanabilir olduğu sonucuna ulaşılmıştır.

  14. İŞGÖREN SEÇİMİNDE KULLANILAN KAYNAKLAR ÜZERİNE BİR ARAŞTIRMA: BARTIN ÖRNEĞİ

    Directory of Open Access Journals (Sweden)

    Ömer Keskin

    2016-06-01

    Full Text Available İşletmelerin etkin ve verimli çalışabilmesi için işgören ihtiyacının tam ve doğru olarak belirlenmesi gerekmektedir. Maddi kaynakların yanı sıra işgörenlerin gerekli bilgi, yetenek ve beceriye sahip olması işletmelerin başarısını etkilemektedir. İşletmenin amaçlarını benimseyecek ve işin gereklerini yerine getirebilecek, alanında etkin ve uzman işgörenlerin seçimi işletmelerin devamlılığını sağlaması açısından önemlidir. Bu çalışmanın amacı, Bartın il merkezinde farklı sektörlerde faaliyet gösteren işletmelerin işgören seçiminde kullandığı kaynakları ve kullanılan kaynaklar arasında farklılık olup olmadığını belirlemektir. Araştırma kapsamında 45 işletmeden yüz yüze görüşme ve anket yöntemi kullanılarak elde edilen veriler değerlendirilmiştir. Araştırma sonucunda, işgören seçiminde kullanılan yöntemlerin işletmelerin faaliyet alanına ve web sitesi olup olmaması durumuna göre anlamlı bir fark göstermediği belirlenmiştir. Anlamlı fark işletmelerin işgören seçiminde kullandıkları yöntemler ile işletmelerin faaliyet süresi arasında bulunmuştur.

  15. İŞKOLİKLİK VE KARİYER TATMİNİ

    Directory of Open Access Journals (Sweden)

    Esra ULUKÖK

    2016-12-01

    Full Text Available Çalışanların örgütsel taleplerden daha fazla çalışması ve kendini işe adaması olarak ifade edilenişkoliklik kavramı, hem çalışanlar hem de örgütler açısından önemli bir konu olarak görülmesinerağmen ülkemizde bu konuda yapılan çalışmaların yeterli olmadığı görülmektedir. Bu çalışmanıntemel amacı, işkoliklik ile kariyer tatmini arasındaki ilişkiyi ve çalışmanın kapsamını oluşturanKırıkkale Üniversitesi’nde görev yapmakta olan akademik personelin çeşitli demografikdeğişkenler açısından kariyer tatmini ve işkoliklik düzeylerini tespit etmektir. Bu kapsamda,işkolikliği ölçmek amacıyla, Schaufeli, Taris ve Bakker (2006 tarafından geliştirilen ve Doğan veTel (2011 tarafından türkçeye uyarlanan kompulsif çalışma ve aşırı çalışma olmak üzere 2boyuttan oluşan DUWAS ölçeği, kariyer tatminini ölçmek için ise Greenhaus vd. (1990 tarafındangeliştirilen 5 maddelik ölçek kullanılmıştır. Araştırmadan elde edilen bulgulara göre; işkoliklik veişkolikliğin boyutlarından aşırı çalışma ve kompulsif çalışma boyutu ile kariyer tatmini arasındaanlamlı bir ilişki tespit edilememiştir.

  16. Endüstriyel Futbolla Birlikte Değişen Haber Pratikleri: Eskişehirspor Örneği

    Directory of Open Access Journals (Sweden)

    Banu DAĞTAŞ

    2015-08-01

    Full Text Available Bu çalışmada, 2008 yılında Türkiye Süper Ligi’ne çıkan Eskişehirspor’la ilgili haber yapan spor muhabirlerinin, değişen haber pratikleri araştırılmıştır. Eskişehirspor’un Süper Lig’e çıkışı, endüstriyel futbolun dinamikleriyle birlikte kavramsallaştırılmış ve bu nedenle, endüstriyel futbolla ilgili literatür incelenmiştir. Çalışmanın amacı doğrultusunda; hem Eskişehirspor’un Süper Lig öncesi dönemindede, hem de Süper Lig sonrası döneminde muhabirlik yapan, altı gazeteciyle, yarı-yapılandırılmış derinlemesine görüşme yapılmıştır. Yapılan görüşmelerin doğrultusunda elde edilen veriler şu temalar altında toplanmıştır: Kulüple ilişkiler; mesleki koşullar (maddi-manevi koşullar, maç takibi koşulları, meslek-içi ilişkiler; haber içerikleri; haber kaynakları ve kulüp taraftarlığı. Kulüp taraftarlığı dışındaki tüm temalarla ilgili haber üretme pratiklerinin, Süper Lig öncesi ve Süper Lig sonrası dönemde önemli değişiklikler geçirdiği saptanmıştır.

  17. Ortaöğretim Öğrencilerinin Tarih Kavramına İlişkin Sahip Oldukları Metaforlar / Secondary School Students’ Metaphors about the History Concept

    Directory of Open Access Journals (Sweden)

    Ahmet Sait Candan

    2017-04-01

    Full Text Available Abstract A metaphor is a figure of speech that refers to one thing by mentioning another thing via comparison, fictionalizing and expression.  This study is revealing, in terms of metaphor concept, what the perceptions of the secondary school students with relate to “History” term are. Accordingly, comments of 160 students who are educating in secondary schools in Karabük city center are referred. In this research, the secondary school students’ perceptions about “History” term are tried to be determined via metaphors. The obtained data were analyzed with content analysis method by using the phenomenological pattern in terms of qualitative research method. As a result of this analysis, it has been revealed that metaphor is an effective factor in determining and expressing the perceptions of the secondary education students about “History” term. Öz Metafor bir şeyi başka bir şey ile benzetmeye, kurgulamaya, anlatmaya yarayan mecazlardır. Bu çalışma ortaöğretim öğrencilerinin “Tarih” kavramına ilişkin algılarının neler olduğunu metaforlar bağlamında ortaya koymaya yöneliktir. Bu doğrultuda Karabük il merkezinde bulunan ortaöğretim okullarında öğrenim gören 160 öğrencinin görüşlerine başvurulmuştur. Araştırmada çalışma grubundaki öğrencilerin “Tarih” kavramına yönelik algıları metaforlar üzerinden belirlenmeye çalışılmıştır. Elde edilen veriler, nitel araştırma yöntemi bağlamında olgubilim deseni kullanılarak içerik analizi tekniği ile analiz edilmiştir. Bu analiz sonucunda, ortaöğretim öğrencilerinin “Tarih” kavramına ilişkin sahip oldukları algıları belirlemede ve açıklamada metaforların etkin bir araç olduğu ortaya çıkmıştır.

  18. BELIEFS AND PRACTICES OF QASHQAI TURKS WITHIN THE CIRCLE OF BIRTH KAŞKAY TÜRKLERİNDE DOĞUM ÇEVRESİNDE GELİŞEN İNANÇ VE PRATİKLER

    Directory of Open Access Journals (Sweden)

    Mehmet KARAASLAN

    2011-09-01

    Full Text Available In this study, which deals with the birth traditions of The Qashqai, and beliefs and practices in this aspect, the data gained through approximately two-month studies in the field of Iran are used. During the field of study, based on the use of techniques such as participated observation and question and answer, Qashqai people, both have urban live and haven’t plucked their ties with nomadism in appropriately with their current social tissues, have been discussed with. These rituals and beliefs formed within the frame of birth are examined through the perspectives such as their functions, whether they have an equivalent in the ancient Turkish culture or not and their comparison of aspects similar to the other communities of the world of the Turks. Kaşkayların doğum gelenekleri ve bu çerçevedeki inanç ve pratiklerinin ele alındığı bu çalışmada İran sahasında yaklaşık iki ay süresince yapılmış olan saha çalışmasında elde edilen veriler kullanılmıştır. Katılımlı gözlem ve soru cevap gibi tekniklerin kullanılması sureti ile yapılan saha çalışması sırasında Kaşkayların şu anki sosyal dokusuna uygun olarak hem uzun süredir şehir hayatı yaşayan hem göçerlikle bağlantılarını tam olarak koparmamış Kaşkaylarla görüşülmüştür. Doğum çevresinde teşekkül etmiş bu ritüel ve inançlar; işlevleri, kadim Türk kültüründe bir karşılıklarının olup olmadığı ve Türk dünyasının diğer toplulukları ile benzeyen yönlerinin mukayesesi gibi bakış açılarıyla irdelenmiştir.

  19. Effects of 2-Phenoxyethanol on cuttlefish Sepia officinalis L. (Cephalopoda: Sepiidae.

    Directory of Open Access Journals (Sweden)

    Halil Şen

    2015-12-01

    Full Text Available Sepia officinalis üzerine 2-fenoksietanolün (2-PhOH etkisi incelenmiştir. 2-PhOH’ün farklı dozları (0,10; 0,15; 0,20; 0,25 ve 0,30 ml/L 15 litrelik şeffaf cam akvaryumun içinde bulunan ve sürekli havalandırılan 10 litre deniz suyunda (pH 7,68; O2 6,8 mg/L; sıcaklık 19,7°C ve tuzluluk ‰37 çözündürülmüştür. 2-PhOH uygulamalarından sonra sübyeler hemen içinde 450 litre iyi havalandırılmış deniz suyu bulunan polyester ayıltma tanklarına nakledilmiştir, burada 48 saat boyunca ölüm olup olmayacağı gözlenmiştir. Ortalama vücut ağırlığı 224,46 ± 56,20 gr (n=30 olan sübyelerden her deneme grubu için tek tek olacak şekilde 6 birey kullanılmıştır. Elde edilen sonuçlara göre, 0,10 ml/L 2-PhOH konsantrasyonunda ne anestetik etki nede ölüm gözlenmiştir, ama 0,15 ile 0,30 ml/L 2-PhOH konsantrasyonlarında %50’nin üzerinde ölüm olmuştur. Yaşama yüzdeleri 0,10 ml/Liçin %100, 0,15 ve 0,20 ml için %33,3 ve 0,25 ve 0,30 ml/L için %16,7 olarak hesaplanmıştır (P

  20. AKILLI KARTLAR İLE YAPILAN MAL VE HİZMET SATIŞLARININ TMS-18 HASILAT STANDARDI ÇERÇEVESİNDE MUHASEBELEŞTİRİLMESİ-RECOGNITION OF SOLD GOODS AND SERVICES BY SMART CARDS WITHIN TMS-18 REVENUE STANDARD

    Directory of Open Access Journals (Sweden)

    Abitter ÖZULUCAN

    2010-01-01

    Full Text Available Bu çalışmada;, önce akıllı kart / yemek çekleri sistemi tanıtılmakta, tarafların sağladıkları fayda ve maliyetler belirtilmekte ve gerçekleşen satış işleminin taraflarca kayda geçirilmesi hususu TMS 18 Hasılat standardı kapsamında ele alınmaktadır. Elde edilen hasılatın ölçümünde, sistemin işleyişinde temel unsur olan ve üye iş yeri tarafından yemek kartı tedavül eden işletmeye hizmet faturası karşılığında ödenen komisyonların, hasılatla doğrudan ilişkilendirilebilen bir gider niteliği taşıyıp taşımaması; bu türden giderlerin Tekdüzen Muhasebe Sistemi’nden farklı olarak, TMS 18 kapsamındaki ölçümünün ve muhasebeleştirilmesinin farklı olup olmadığının belirlenmesi amacıyla kaleme alınan bu çalışma, giriş ve sonuç bölümlerinin dışında dört bölümden oluşmaktadır.-The main part of the smart card system is sellers and while they are measuring of their revenue, they should associate the commissions with revenues to record at inception. So in this paper, after the smart card system is introduced, the advantages and disadvantages of this system are exposed and then how to recognise of the selling is considered within TMS 18, Revenues Standard. In other words, the reason that we conduct this paper can be expressed that the expense of the selling commissions which arise from the selling products with smart card whether should or should not deduct to revenue while the revenue is been measured.

  1. Geçmişten Günümüze Gündelik Yaşamda Kullanılan Matematik Üzerine: Teorik Değil Pratik

    Directory of Open Access Journals (Sweden)

    Emrullah Erdem

    2011-12-01

    Full Text Available Bu çalışmanın amacı, geçmişten günümüze matematik biliminin gündelik yaşamda nasıl kullanıldığını incelemektir. Bu amaçla matematiğin tarihi ile ilgili çeşitli kaynaklar taranarak yazılı ve yazısız toplumların kullandıkları matematik incelenmiş ve günümüzde günlük yaşamda kullanılan bu matematiğin bazı yansımaları üzerinde durulmuştur. Bu çalışmada etnografik araştırma yöntemi kullanılmıştır. Veriler, matematiğin tarihi ile ilgili çeşitli kaynaklar taranarak, katılımcı gözlem ve mülakat metotları kullanılarak toplanmıştır. Elde edilen verilerin analizinde geçmişte ve günümüzde gündelik matematik hesaplamaları yapılırken, genellikle dört işlemin kullanıldığı ve teorik matematikteki soyut sembol ve formüllerin kullanılmadığı saptanmıştır. Gündelik matematik hesaplamalarının özellikle ilköğretim öğrencileriyle gerçekleştirilecek matematik öğretiminde etkili olacağı düşünülmektedir.Anahtar Kelimeler: Matematik tarihi, gündelik matematik, kültür, etnik matematik

  2. HAVING A PEEK INTO THE ROOM OF HAROLD PINTER

    Directory of Open Access Journals (Sweden)

    Kadir ALKAYA

    2014-12-01

    Full Text Available Sessizliğin konuşma, konuşmanınsa bir anlaşamama olgusuna dönüştüğü Pinter'ın "the Room" adlı oyununa farklı bir açıdan bakılınca görülenlerin paylaşıldığı bir yazı. Küçük bir odada, iki kişilik bir toplumda karşılıklı çıkar elde etme olgusu etrafında birleştikleri iddia edilen iki insan arasındaki ilişkinin bir yorumu. Pinter'ın karakterlerine yüklediği görev nedeniyle "ne tam ispatlanabilecek ne de inkar edilebilecek" yorumlar. Marksist pencereden bakıldığında bu oda içerisindeki birlikteliğin Bert in (koca Rose üzerinde uyguladığı baskı, dış dünyaya kapalılığın getirdiği daha iyi olanı görmemişlikten doğan mevcudu kaybetme korkusuyla her şeyi beğenme durumu. Karı koca arasındaki bir ilişkiden çok, patron ve çalışanı arasındaki ilişkiye benzetilen bir ilişki. Rose'a geçmişindeki muhtemelen bugüne göre daha güzel olan durumunu hatırlatmak üzere gelen Riley'nin Bert tarafından öldürülüp bir anlamda tarihin susturulması. Sonuçta iki kişilik bu toplum ve bu toplumdaki baskı rejimi bir şekilde sona eriyor. Rose'un etrafında dönen olayları apolitik olmasından dolayı görememesi fiziksel bir körlüğe dönüşüyor, Bert ise en büyük desteğini kaybediyor.

  3. Güney Karadeniz'in Samsun kıyı sularında mesozooplankton faunasının bolluk ve dağılımına etki eden ekolojik faktörlerin ekometrik yönden incelenmesi (Türkiye.

    Directory of Open Access Journals (Sweden)

    Eda Deniz

    2015-12-01

    Full Text Available Karadeniz'in Samsun Kıyı Bölgesi mesozooplankton faunası Nisan 2012- Mart 2013 tarihleri arasında incelenmiştir. Belirlenen 4 istasyondan aylık olarak alınan su örneklerinde mesozooplankton faunasının tür kompozisyonu, bolluğu, dağılımı ve bunlara etki eden fiziko-kimyasal faktörler belirlenmiştir. Mesozooplankton bolluk verilerinden Bray-Curtis benzerlik matrisi oluşturulmuş ve örnek gruplarına birleştirici hiyerarşik kümeleme analizi, çok boyutlu ölçeklendirme analizi, benzerlik analizi (ANOSIM, benzersizlik analizi (SIMPER uygulanmıştır. Ayrıca gruplar arasındaki farklılıklardan sorumlu ve kommüniteyi yönlendiren türlerin çevresel değişkenler ile ilişkisinin incelemek amacıylada kanonik uyum analizi (CCA uygulanmıştır. Araştırmamızda holoplankton faunasında toplam 16 tür ve meroplanktonik organizmalar tespit edilmiştir. Mesozooplankton bolluk verilerinden elde edilen benzerlik matrisinin birleştirici hiyerarşik kümeleme analizi sonucu %64 benzerlik seviyesinde üç grup belirlenmiştir. Örnek grupları arasında benzerlik (ANOSIM, benzersizlik analizi (SIMPER ve tür bollukları ile çevresel parametreler arasında yapılan CCA analizi sonuçlarına göre türlerin dağılımına sıcaklık, tuzluluk, NH4-N, seki disk derinliği ve pH etkili olmuştur

  4. Maddenin tanecikli yapısının mikro ve makro boyutta anlaşılmasının sağlanması [Aiding comprehension of the particulate of matter at the micro and macro levels

    Directory of Open Access Journals (Sweden)

    Seda OKUMUŞ

    2014-04-01

    Full Text Available Bu araştırmada deneyler ve makro gösterim ile maddenin tanecikli yapısının anlaşılması sağlanmaya çalışılmıştır. Araştırmada tek denekli deneysel yöntem kullanılmıştır. Araştırmanın örneklemini Fen Bilgisi Öğretmenliği birinci sınıfında öğrenim gören 48 öğrenci oluşturmaktadır. Araştırmada veri toplama aracı olarak Maddenin Tanecikli Yapısı Testleri (MTYT kullanılmıştır. Testler açık uçlu sorulardan oluşmaktadır. Uygulama sürecinde araştırmanın amacını gerçekleştirmek üzere iki deney yapılmıştır. Deneylerden önce MTYT uygulanmış ve öğrencilerin deneyle ilgili ön bilgileri alınmıştır. Ardından deneyler yapılmış ve deneylerden sonra MTYT tekrar uygulanmış ve öğrencilerin tanecikli yapıyla ilgili anlamaları belirlenmiştir. Ayrıca birinci deney için deneyin ardından öğrencilerin tanecikli yapıyı anlamaları amacıyla makro boyutta gösterim yapılmış ve bu gösterimden sonra tekrar MTYT uygulanmıştır. Araştırmadan elde edilen bulgular, öğrencilerin ilk durumda kavramsal yanlış anlamalarının uygulama sonunda azaldığını göstermektedir. Ancak bazı noktalarda öğrencilerin sahip oldukları yanlış anlamaları devam ettirdikleri görülmüştür.

  5. Fen Ve Teknoloji Dersi Öğretmenlerinin SBS’de Yapılan Değişikliklerle İlgili Görüşlerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    MUSTAFA UZOĞLU

    2013-09-01

    Full Text Available Bu çalışma fen ve teknoloji öğretmenlerinin SBS’nin kaldırılması hakkındaki görüşlerini belirlemek amacıyla yapılmıştır. Veri toplama aracı olarak açık uçlu anketten yararlanılmıştır. Çalışmanın örneklemini 2012-2013 öğretim yılında Giresun İlinde görev yapan 51 fen ve teknoloji öğretmeni oluşturmaktadır. Açık uçlu anket formundan elde edilen sonuçlarda çalışmaya katılan fen ve teknoloji öğretmenlerinin birçoğu söz konusu sınavın kaldırılmasına karşı çıkmışlardır. Ayrıca öğretmenler sınav kaldırıldığında öğrencilerin yerleştirilmesinde sıkıntıların çıkabileceğini ifade etmişlerdir. Diğer yandan fen ve teknoloji öğretmenlerinin ortaöğretim kurumlarına öğrenci seçmek için yapılan sınavların sayısının ve şeklinin sürekli değişmesinden dolayı endişelendikleri dikkati çekmektedir. Fen ve teknoloji öğretmenleri bu durumun öğrencilerde güven kaybına, motivasyon düşüklüğüne, karamsarlığa bıkkınlığa, gelecek endişesine, adaptasyon sorununa neden olabileceğini ifade etmişlerdir.

  6. Model Referans Uyarlanabilir Kontrole Dayalı Bulanık Kontrol Kullanımı ile DC Motor Sürücülerde Hız Kontrolünün Analiz ve Benzetimi

    Directory of Open Access Journals (Sweden)

    Ghazanfar SHAHGHOLIAN

    2016-09-01

    Full Text Available Bu makalede, model referans uyarlamalı kontrol (MRAC ve model referans bulanık uyarlanabilir kontrol (MRFAC için geleneksel performans sunulmuştur. Çalışmanın amaçları: a sistemin tanımlı referans model hızı ile motor hızının uyumunun arttırılması, b yükleme değişimi ve bozuklukları durumunda gürültünün azaltılması ve c sistemin kararlılığının arttırılması. Böylece, model referans uyarlamalı kontrol yerine uyarlanabilir olmayan veya geleneksel kontrol uygulanır.Ayrıca bulanık kontrolör, PI kontrolör gibi klasik kontrolörlerin yerine kullanılmıştır. Uyarlanır olmayan kontrolün işletimi ve model referans bulanık kontrol ve geleneksel uyarlanabilir kontrol, dc motor hızının türetilmesi ve ayarlanmasında çalışılmıştır. Ardından bunlar birbirleriyle karşılaştırılmıştır. Model referans ve bulanık kontrolör, tüm sistemin kararlılık güvencesine dayanarak tasarlanmıştır. Simülasyon, sabit ve değişken yükler ile yapılmıştır. Elde edilen sonuçlara göre, uyarlanabilir kontrol, uyarlanabilir olmayana göre daha gözdedir. Ayrıca bulanık uyarlanabilir kontrol geleneksel uyarlanabilir kontrolden daha tatmin edicidir.Simülasyonlar, Matlab-Simulink kullanılarak yapılmıştır

  7. Pleurotus sajor-caju Mantar Türünün Kontrollü Atmosferde Muhafazası

    Directory of Open Access Journals (Sweden)

    Nilgün Halloran

    2015-02-01

    Full Text Available Araştırma, P. sajor-caju mantar türünün soğukta muhafazasında optimum atmosfer bileşimini belirlemek amacı ile yürütülmüştür. Denemede %0, %5, %10 ve %15 CO2 içeren ortamların her birinde O2 konsantrasyonu %21, %2.5, %1 ve %0 olarak değişecek şekilde 20 farklı atmosfer bileşiminin etkileri incelenmiştir. 5 oC sıcaklık ve %85-90 oransal nem içeren ortamda yürütülen çalışmada, 12 günlük muhafaza süresince 3’er gün ara ile kesme kuvveti, şapka rengi, nemlenme ve koku oluşum durumları ile genel görünüşün dikkate alındığı kalite puanlaması yapılmıştır. Araştırmada elde edilen verilere göre %5 CO2+%21 O2, %10 CO2+%0 O2 ve sürekli azot uygulamaları değerlerine göre 12 günlük muhafaza süresi ile daha iyi sonuç vermiştir. İncelenen tüm kriterler dikkate alındığında, P. sajor-caju mantar türü için optimum atmosfer bileşiminin %10 CO2+%0 O2, %15 CO2+%0 O2 olduğu ve bu türün KA’de muhafazasında O2’in mümkün olduğunca düşük düzeyde tutulması gerektiği belirlenmiştir.

  8. Yapı Malzemesi Olarak Denizli Civarında Çıkartılan Kayraktaşlarının Özellikleri

    Directory of Open Access Journals (Sweden)

    Saffet Yağız

    2011-03-01

    Full Text Available Denizli ili çevresinde işletilen doğaltaş ocaklarında, farklı yapıtaşları çıkarılmaktadır. Bunlardan en yaygın olanlar, traverten, kireçtaşı ve kayrak taşı (şist ocaklarıdır. Denizli ilinin kuzey doğusunda, Çal, Bekilli ve Baklan üçgeninde, Mendere masifinin bir üyesi olan kayraktaşları bölgenin önemli doğaltaş kaynaklarındandır. Bu çalışmanın amacı, bölgede işletilen kayrak taşlarının yapıtaşı olarak kullanılabilirliklerinin araştırılmasıdır. Amacı gerçekleştirmek için, bölgede bulunan taş ocakları ve sahalarda jeolojik çalışmalar yapılarak, kayaçların özelliklerini temsil eden örnekler alınmıştır. Kayaç örneklerinde, petrografik, mineralojik (XRD, kimyasal (XRF analizler ve jeomekanik deneyler (tek eksenli sıkışma dayanımı, Schmidt sertlik değeri, ağırlıkca su emme, etkili gözeneklilik, doluluk oranı, eğilme dayanımı, sonik hızı, elastisite modülü, doğal ve doygun birim hacim ağırlık yapılarak elde edilen bulgular kayaçların yapıtaşı olabilirlikleri açısından değerlendirilmiştir. Kayaçlarda yapılan deney ve analizler, uluslararası doğal taş standard ve metotlarına uygun olarak gerçekleştirilmiştir. Sonuç olarak, işletilen kayrak taşları özelikleri itibariyle, binaların iç ve dış cephelerinde, açık mekanlarda ve çevre düzenlemelerinde yapıtaşı ve kaplama malzemesi olarak kullanılabilirler.

  9. Inconel 718 süper alaşımının farklı gerilme ve sıcaklıklarda yüksek sıcaklık sürünme davranışının incelenmesi

    Directory of Open Access Journals (Sweden)

    Ergün Subaşı

    2016-04-01

    Full Text Available Bu çalışmada, havacılıkta yaygın olarak kullanılan Inconel 718 süper alaşımının sürünme davranışına sıcaklık ve gerilmenin etkileri incelenmiştir. Deneyler; 750°C, 800°C sıcaklıklarında ve 200-350MPa gerilme aralığında gerçekleştirilmiştir. Deneysel çalışma sonuçlarından, gerilme üssü (n, sürünme hızı (έ ve aktivasyon enerjisi (Q hesaplanmıştır. Hesaplanan sonuçlara göre; sürünme hızlarının artan gerilme ile arttığı, ayrıca sıcaklığın artmasıyla birlikte sürünme hızları çok daha fazla artmaktadır. Aynı şekilde, artan gerilme ile birlikte aktivasyon enerjisi artmaktadır. Deney sonuçlarından elde edilen gerilme üssü değerlerine göre; etkin deformasyon mekanizmasının dislokasyon sürünmesi olduğu tespit edilmiştir. Inconel 718 süper alaşımının kopma sürünme ömrünü tahmin etmek için, Larson Miller grafiği çizilmiştir. Bu grafikle, Inconel 718’in yüksek sıcaklık sürünme ömürleri hesaplanabilir.

  10. DENİZLİ İL MERKEZİ YERLEŞİM ALANININ JEOLOJİK, JEOTEKNİK KENT BİLGİ SİSTEMİ (JEO-KBS

    Directory of Open Access Journals (Sweden)

    Halil KUMSAR

    2004-04-01

    Full Text Available Yerleşim yeri seçimi projelerinin ilk aşamasında yapılan jeolojik ve jeoteknik çalışmalarda üretilen veriler kentleşmenin temel ve ilk aşamasıdır. Bu çalışmalardan elde edilen sonuçlarla üretilen mühendislik jeolojisi haritaları ise imar planlarını ve yapılaşmayı yönlendirmektedir. Denizli Belediyesi Yerleşim Alanlarının Jeolojik, Jeoteknik ve Hidrojeolojik Özellikleri adlı projede üretilen verilere ilişkin jeolojik ve jeoteknik kent bilgi sistemi JEO-KBS bu çalışmada oluşturulmuştur. Geliştirilen JEO-KBS sisteminde topoğrafik, imar, mahalle haritaları sayısallaştırılmıştır. Arazide ve laboratuarda yapılan jeoteknik deneyler, jeofizik ölçümler ve jeolojik bilgiler için veri taban oluşturulmuş ve bu veri tabanındaki veriler JEO-KBS sisteminde değerlendirilerek Denizli merkezi yerleşim alanları için mühendislik jeolojisi haritaları oluşturulmuştur. JEO-KBS sistemi içinde sayısal harita üzerinde istenilen bir noktada jeolojik ve jeoteknik bilgilere grafik ortamında çok kısa sürede ulaşmak ve bu verileri uygulamaya aktarmak mümkündür. Belediyelerin bu tür kent bilgi sistemleri yardımıyla kentin gelişimini kontrol etmeleri ve yeni değerlendirmeler yapmaları açısından geliştirilen JEO-KBS sistemi önemli katkı sağlamaktadır.

  11. Liderlik Oryantasyon Ölçeğinin Türkçeye Uyarlanması

    Directory of Open Access Journals (Sweden)

    Kenan ÖZCAN

    2012-11-01

    Full Text Available Örgüt iklimi örgütsel yapı ve yönetimin bir sonucudur. Çalışanların örgütün yapısı ve yöneticilerin liderlik davranışlarına dair algıları örgüt iklimi hakkında bir fikir vermektedir. Örgütsel iklime dair olumsuz algılar örgütte dengesiz, olumlu algılar ise dengeli bir yönetim yapısı bulunduğunu göstermektedir. Bu çalışma örgütsel yapı hakkında bilgi veren Thompson (2005 tarafından geliştirilen “Liderlik Oryantasyon Ölçeğinin” Türkçeye uyarlanmasını amaçlamaktadır. Ölçeğin orijinal halinde 32 madde ve dört alt boyut bulunmakta ve Türkçeye uyarlanan şekli de aynı formu korumuştur.  Ölçeğin Türkçeye uyarlanması sürecine,  Açımlayıcı Faktör Analizi (AFA için 300 ve Doğrulayıcı Faktör Analizi (DAF için 234 öğretmen katılmıştır. Ölçeğin uyarlanmasıyla ülkemizde yapılacak araştırmalarla elde edilen bulguların, aynı ölçekle farklı kültürlerde yapılan/yapılacak olan araştırma bulgularıyla karşılaştırılabilmesine olanak sağlayacağında, ölçeğin Türkçeye uyarlanmasının önemli olduğu söylenebilir. Anahtar sözcükler: örgüt iklimi, liderlik, örgüt yönetimi

  12. Kompleks İntihar Olgusunda Kan Lekesi Model Analizi İle Olay Yerinin Yeniden Yapılandırılması

    Directory of Open Access Journals (Sweden)

    Murat Nihat Arslan

    2017-08-01

    Full Text Available İki veya daha fazla yöntemin eş zamanlı ya da peşi sıra uygulanması kompleks intihar olarak adlandırılmaktadır. Tek başına kullanıldığında da sonuca ulaşılabilecek iki farklı yöntemin intihar amaçlı kullanılması ölme güdülenmesindeki kararlılığı göstermektedir. 40 yaşındaki erkek olgumuz kurusıkıdan dönüştürülmüş bir silah ile kalbine ateş etmiş ve bu sırada kendini asmıştır. Otopside elde edilen bulgular, olay yeri inceleme raporundan alınan bilgiler, vücuttaki ve olay yerindeki kan lekeleri olay orijininin intihar olduğunu düşündürmüştür. Kompleks intihar olgularında olayın orijinini ortaya çıkarma çalışmaları otopsi masasına geldikten sonra değil, olay yeri incelemesinde, hatta ceset ilk görüldüğü andan itibaren başlamalıdır. Olay yerinin multidisipliner olarak ele alınması, ortamda bulunabilecek her nesnenin/ delilin olayın çözümünde yardımının olabileceğinin akılda tutulması orijin tayininin kolaylıkla yapılmasını sağlayacaktır. Benzer şekilde otopsi yapılacak olan bir cesedin, varsa elbiseleri üzerindeki, yoksa vücudu üzerindeki kan lekelerinin kan lekesi model analizi yöntemleri ile dikkatli bir şekilde incelenmesi ve belgelendirilmesi de orijin tayininde faydalı bilgiler verebilmektedir.

  13. KAPLAMASIZ SEMENTİT KARBÜR KESİCİ TAKIMLARDA TAKIM-TALAŞ ARA YÜZEY SICAKLIĞININ DENEYSEL OLARAK ARAŞTIRILMASI

    Directory of Open Access Journals (Sweden)

    Kasım HABALI

    2005-01-01

    Full Text Available Malzemelerde talaş kaldırma sırasında açığa çıkan ısının takım-talaş ara yüzeyinde oluşturduğu sıcaklığın takım ömrü ve iş parçasının yüzey kalitesi üzerinde bir etkisinin olduğu bilinmekte ve bu sıcaklığın ölçülebilmesi için kullanılacak yöntemler sürekli olarak araştırılmaktadır. Bu çalışmada, takım/iş parçası ısıl çift yöntemi ile takımtalaş ara yüzey sıcaklığının ölçülebilirliği araştırılmıştır. Özellikleri iyi bilinen AISI 1040 çeliği üzerinde yapılan talaş kaldırma deneylerinde, kesme hızı ve ilerleme parametrelerine bağlı olarak takım-talaş ara yüzey sıcaklığının değişimi incelenmiştir. Elde edilen grafiklerden, kesme hızının sıcaklık üzerinde daha etkili bir parametre olduğu görülürken, ilerlemenin etkisinin daha az olduğu görülmüştür.

  14. AISI 316Ti Paslanmaz Çeliğin İşlenebilirlik Karakteristiklerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Yunus Kayır

    2012-01-01

    Full Text Available Bu çalışmada, üniversal torna tezgahında işlenebilirlik deneyleri yapılmıştır. İş parçasının tornalanması sırasında kesme kuvvetleri ölçülmüştür. Kesme kuvvetlerinin ölçülmesinde, standart bir dinamometre kullanılmıştır. Dinamometrenin üniversal torna tezgahına uygun bir şekilde bağlanması için, bir bağlama aparatı tasarlanarak imalatı yapılmıştır. Yapılan işlenebilirlik deneylerinde, AISI 316Ti paslanmaz çelik malzeme, TiAlN kaplamalı, farklı kesici takım uç yarıçapına sahip karbür uçlar kullanılarak tornalanmıştır. Takım uç yarıçapının kesme kuvvetlerine ve yüzey pürüzlülüğüne etkisi araştırılmıştır. Deneylerden elde edilen kesme kuvvetleri ve işlenen yüzeylerin yüzey pürüzlülükleri değerlendirilmiştir. Değerlendirmeler sonucunda, ilerleme miktarı artıkça, kesme kuvvetlerinin arttığı, takım uç yarıçapının büyümesi ile de yüzey pürüzlülüğünün düştüğü görülmüştür.

  15. CNC Frezelemede Yüzey Pürüzlülüğüne Etki Eden Parametrelerin Matematiksel Olarak Modellenmesi

    Directory of Open Access Journals (Sweden)

    Engin Nas

    2012-01-01

    Full Text Available Bu çalışmada; AISI 1050 çeliği CNC freze tezgâhında yüzey frezeleme işlemine tabi tutularak, yüzey pürüzlülüğünü etkileyen, kesme hızı, ilerleme hızı, kesici uç sayısı ve kesme derinliği gibi parametreler deneysel olarak araştırılmıştır. Parametreler için farklı kombinasyonlar oluşturularak dört farklı deney yapılmıştır. Yapılan deneylerde çelik ve küresel grafitli dökme demirlerin işlenmesinde kullanılan PVD yöntemiyle kaplanmışkesici takımlar kullanılmıştır. Kesici takımlarla beraber belirlenen parametreler kullanılarak elde edilen yüzey pürüzlülük değerleri ölçülmüş ve ölçülen yüzey pürüzlülük değerleri ile parametreler arası ilişkiler eğri uydurma algoritmaları kullanılarak matematiksel olarak modellenmiştir. Matematiksel modeller belirleme katsayılarına (R2 göre değerlendirilmiş, en ideal olanları teorik çalışmalar için önerilmiştir. Çalışmanın sonucunda; farklı parametre değerlerine göre yüzey pürüzlülüğündeki değişimlerden bahsedilmiş ve her bir deney için önerilen matematiksel modellere maddeler halinde yer verilmiştir.

  16. İMALATTA SU JETİ UYGULAMALARININ DEĞERLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Faruk MENDİ

    1999-02-01

    Full Text Available İmalat işlemlerinde su jetlerinin kullanılması oldukça yakın bir geçmişe dayanmaktadır. Ancak su jetleriyle kesilerek işlenebilen malzeme çeşitlerinin artması, kesme işlemlerinde arzu edilen sonuçların elde edilebilmesi, tekniğin verim ve güvenirliliğinin artmasıyla, özellikle son zamanlarda imalat teknolojisinde aranılan bir işlem olmuştur. Saf su jetleri ahşap, plastik, alüminyum, bakır gibi yumuşak malzemelerin kesilmesinde kullanılmaktadır. Aşındırıcı su jetleri ise; titanyum, inconel, cam, seramikler gibi oldukça sert olan malzemelerin kesilmesinde kullanılmaktadır. Söz konusu bu malzemelerin klasik talaş kaldırma yöntemleriyle kesilmesi imkansızdır. Kullanılan su jeti sisteminin basıncı, uygulama şekline göre 100Mpa-400Mpa, arasında değişmektedir. Aşındırıcı su jeti ile frezeleme, aşındırıcı su jeti ile kesme işlemlerinde kullanılan jet basıncı 400Mpa iken, su jeti ile yüzeyin dövülerek dayanım kazandırılması işleminde kullanılan jet basıncı, yaklaşık olarak 100Mpa'dır. Aşındırıcı su jeti ile kesme işleminde, suya abrasifin karışması olayı ile kesmedeki erozyon işlemi henüz tam olarak anlaşılamamıştır. Bu incelemede, su jeti sistemlerinin prensipleri ile DIN tanımı 16 MnCr 5 E olan malzemeyle yapılan çalışmalara ait sonuçlar verilmiştir.

  17. Mengen Peynirinden Laktik Asit Bakterilerinin İzolasyonu, Moleküler Tanımlanması ve Bazı Starter Kültür Özelliklerinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Aylin AKOĞLU

    2016-12-01

    Full Text Available Çalışmada 50 adet Mengen peyniri örneğinden toplam 117 adet laktik asit bakterisi izole edilmiş ve laktik asit bakteri florası % 44.5 Enterococcus spp., % 29.9 Lactobacillus spp., % 25.6 Lactococcus spp. olarak belirlenmiştir. Elde edilen izolatların asidifikasyon kapasiteleri ile proteolitik aktiviteleri tespit edilmiş, en iyi asidifikasyona ve proteolitik aktiviteye sahip 22 adet suş 16S rDNA dizi analizi ile tanımlanmıştır. Tanımlaması yapılan suşların 15’i (% 63 Enterococcus spp., 5’i (% 21, Lactococcus spp., 1’i (% 4 Lactobacillus spp. ve 1’i (% 4 Weissella spp. olarak belirlenmiştir. 15 adet Enterococcus spp. izolatından; 9’u (% 60 Enterococcus faecium, 4’ü (% 26.7 Enterococcus faecalis ve 2’si (% 13.3 Enterococcus durans olarak; 5 adet Lactococcus spp. izolatından, 3’ü (% 60 Lactococcus lactis subsp. lactis, 2’si (% 40 Lactococcus garvieae olarak tanımlanmıştır. Lactobacillus spp. ve Weissella spp. olarak tanımlanan suşların ise sırasıyla Lactobacillus casei ve Weissella viridescens olduğu tespit edilmiştir. Tanımlanan suşlar içerisinden aynı anda hem düşük proteolitik aktivite hem de yüksek asidifikasyon aktivitesi özelliği gösteren bir adet Lactococcus lactis subsp. lactis suşu, Enterokoklar arasından bir adet Enterococcus faecalis, bir adet Enterococcus faecium ve iki adet Enterococcus durans suşu en iyi starter kültür özelliklerine sahip suşlar olarak belirlenmiştir.

  18. Aykırı Değer Varlığında Cox Regresyon Analizi için Yeni Bir Yaklaşım

    Directory of Open Access Journals (Sweden)

    Nesrin ALKAN

    2017-08-01

    Full Text Available Aykırı değerin varlığı Cox regresyonun en önemli varsayımlarından olan orantılı hazard varsayımının ihlal olmasına ve doğru olmayan tahminlerin ortaya çıkmasına neden olur. Çünkü aykırı değerler, modelin parametrelerinin tahminleri üzerinde güçlü bir etkiye sahiptirler. Bu nedenle veri kümesinde aykırı değerlerin olması araştırmacılar için bir problemdir. Bu çalışmada, aykırı değerlerden dolayı orantılı hazard varsayımının ihlal edilmesi sonucu ortaya çıkan problemin çözümü farklı bir bakış açısıyla ele alınmıştır. Buna göre aykırı değer problemi bir kayıp değer problemi gibi düşünülüp çoklu değer atama yöntemi kullanılarak çözülmüştür. Sonuç olarak Cox regresyon analizinin orantılı hazard varsayımı tehlike altında ise kayıp veri problemlerinde üstün bir performans gösteren çoklu değer atama yöntemi ile elde edilen tahminler kullanılarak problemin çözülmesi önerilmektedir.

  19. Okul Yöneticisi ve Öğretmen Görüşlerine Göre Okul Yöneticiliğinin Meslekleşmesinin Değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    Sait AKBAŞLI

    2012-11-01

    Full Text Available Bu çalışmada okul müdürlerin, müdür yardımcılarının, öğretmenlerin okul yöneticiliği seçimi, yetiştirilmesi (hizmet öncesi ve hizmet içi, özlük haklarıyla ilgili görüşlerini belirlemek amaçlanmıştır. Çalışma sürecinde, yöneticiliğin meslekleşmesiyle ilgili  alanyazın taraması yapılmış ve daha sonra okul yöneticisi ve öğretmenlere 26 maddelik bir ölçek uygulanmıştır. Araştırmanın evrenini, Konya ilindeki merkez ilçelerdeki (Karatay, Meram, Selçuklu  ilköğretim okullarında 2010/2011 eğitim öğretim yılında görev yapmakta olan okul yöneticileri ve öğretmenler oluşturmaktadır. Araştırmanın örneklemi ise, Konya ilindeki ilköğretim okullarında 2010/2011 eğitim öğretim yılında görev yapmakta olan ve tesadüfi (random yöntemle seçilmiş, 418  okul yöneticisi ve öğretmendir. Çalışma tesadüfi şekilde seçilen örneklem grubu üzerinde yürütülmüştür. Bu yolla elde edilen veriler analiz edilmiştir, ayrıca okul yöneticilerinin seçilme, atanma-yetiştirilme ve görev-özlük alt boyutları incelenmiş ve bunlara yönelik önerilerde bulunulmuştur.

  20. Temel Tepki Öğretimi-TTÖ (Pivotal Response Treatment-PRT İle Gerçekleştirilen Etkililik Araştırmalarının Betimsel Analizi

    Directory of Open Access Journals (Sweden)

    Özlem TOPER-KORKMAZ

    2013-01-01

    Full Text Available Temel Tepki Öğretimi (TTÖ Amerika Ulusal Otizm Merkezi (NAC, 2009 tarafından yayınlanmış olan Ulusal Standartlar Raporun’da otizmli çocukların eğitimde kullanılan bilimsel dayanaklı uygulamalardan bir tanesi olarak kabul edilmektedir. TTÖ hem uygulamalı davranış analizi ilkelerine dayanan hem de doğal bir öğretim yöntemidir. Yöntem öğrenci merkezli ve aile eğitimi esaslı olup çocuklara belli temel davranışları kazandırmayı ve buna bağlı olarakta hedeflenmeyen başka alanlarda da ilerlemeler sağlanacağını savunur. Bu çalışmada TTÖ’ne yönelik bir alan yazın çalışması amaçlanmış ve bu amaçla 1995 ile 2011 yılları arasında TTÖ ile gerçekleştirilmiş olan 16 etkililik araştırmasına ulaşılarak bu araştımalar betimsel olarak analiz edilmiştir. Elde edilen bulgular TTÖ’nün okul öncesi ve ilköğretim dönemindeki otizm spektrum bozukluğu gösteren çocuklara ifade edici dil becerilerinin kazandırılmasında, sosyal becerilerin ve oyun becerilerinin öğretiminde etkili olduğunu göstermektedir Pivotal Response Treatment (PRT is one of evidence based treatments identified in the US National Autism Center's National Standards Report published in 2009. PRT is a comprehensive instructional model based on developmental approach and applied behavior analysis principles to provide learning opportunities for supporting children in their natural environments. PRT is a student-centered and parent-training based procedure and advocates that if children achieve some pivotal behaviors, it provides positive effects on untargeted behaviors and also if these pivotal behaviors are achieved once, results will be common and generalizable. The purpose of this study is, by using descriptive analysis, to review the sixteen effectiveness studies of PRT published in 1995-2011. Results of review showed that PRT is an effective procedure on language skills, social skills and play skills of preschool and

  1. THE ANALYSIS OF COMMON VERBS WHICH ARE USED IN KÜL TİGİN MONUMENT AND KUTADGU BİLİG IN TERMS OF VERB-COMPLEMENT RELATIONS KÜL TİGİN ABİDESİ VE KUTADGU BİLİG’DEKİ ORTAK FİİLLERİN TAMLAYICI İLİŞKİSİ AÇISINDAN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Talat DİNAR

    2010-07-01

    Full Text Available Kül Tigin Monument and Kutadgu Bilig which take place among the main sources of Turkish language are fairly significant language memorials both in terms of their contents and reflecting the characteristics of language of their era. In this study, the common verbs which are used in these two significant works are tried to be identified in terms of the similarities and the differences of verb-complement relations. For this purpose; in both of these two works, the verbs which have the unity of denotation or similarity are identified and verb-complement relations of these verbs which can be used in both of these two works are evaluated with their examples in the first chart. However; in the second chart; in order to be seen collectively, the common verbs and their complements in these two works, are given without examples. In conclusion part, the input datas are evaluated Türk dilinin ana kaynakları arasında yer alan Kül Tigin Abidesi ve Kutadgu Bilig hem içerik olarak hem de dönemlerinin dil özelliklerini yansıtmaları bakımından oldukça önemli dil yadigârlarıdır. Bu çalışmada, bu iki önemli eserimizde kullanılan ortak fiillerin, fiil tamlayıcı ilişkisi açısından gösterdiği benzerlikler ve farklılıklar tespit edilmeye çalışılmıştır. Bu amaç doğrultusunda her iki eserde, anlam ortaklığı veya benzerliği bulunan fiiller tespit edilmiş ve bu fiillerin her iki eserde de alabildiği tamlayıcılar örnekleriyle birlikte 1. tabloda değerlendirilmiştir. 2. tabloda ise bu iki eserdeki ortak fiillerin alabildiği tamlayıcıların toplu halde görülebilmesi için fiiller ve tamlayıcıları örneksiz olarak verilmiştir. Sonuç bölümünde ise elde edilen veriler değerlendirilmiştir.

  2. Homojen Karışımlı Sıkıştırma Ateşlemeli (HCCI bir motorun tek-bölgeli modelleme yöntemi kullanılarak analizi

    Directory of Open Access Journals (Sweden)

    Halit Yaşar

    2016-12-01

    Full Text Available HCCI motorların modellenmesinde sıfır-boyutlu modeller yaygın olarak kullanılmaktadır. Bu modeller tek veya çok bölge içerebilirler. Bununla birlikte, en basit yaklaşım yanmış ve yanmamış gazı içeren tek bölge yaklaşımıdır. Bu tip sıfır-boyutlu modellerde yanma olayı Wiebe fonksiyonu ile modellenmektedir. Bu makalede, HCCI prensibine göre çalışan tek silindirli bir Ricardo Hydra motoru tek bölge yaklaşımı kullanılarak modellenmiştir. Analiz çalışmalarında SPICE (Simulated Petrol Internal Combustion Engine yazılımının modifiye edilmiş bir versiyonu olan TRICE yazılımı kullanılmıştır. Yanma analizlerinde, HCCI yanma modellerinde standart Wiebe fonksiyonu kullanımının maksimum silindir basıncının yüksek olarak tahmin edilmesi sonucunu doğurması nedeniyle, standart Wiebe fonksiyonunun modifiye edilmiş bir şekli olan Double-Wiebe fonksiyonu kullanılmıştır. Analizler, n-Heptan-Toluen karışımı için üç hava fazlalık katsayısı değerinde gerçekleştirilmiş ve elde edilen sonuçlar bir Avrupa Komisyonu Marie Curie destek programı (FP-6 projesi kapsamında Shell Araştırma Merkezine ait motor test laboratuvarında ölçülen deneysel verilerle karşılaştırılmıştır.

  3. Yeni Tesis Mandalina Bahçesinde Malç Tekstili Uygulamasının Yabancı Ot Kontrolü ve Mandalina Gelişimine Etkileri

    Directory of Open Access Journals (Sweden)

    Yasin Emre Kitiş

    2017-07-01

    Full Text Available Bu çalışma, malç tekstili adını verdiğimiz materyalin, yeni tesis edilen turunçgil bahçelerinde yabancı ot kontrolü amacıyla, konvansiyonel polietilen malç naylonu ve çiftçi koşullarında yaygın olarak uygulanan mekanik ve kimyasal mücadele ile kıyaslamalı olarak etkisinin belirlenmesi amacıyla doktora tez çalışmasının bir bölümü olarak yürütülmüştür. Yeni tesis mandalina bahçesinde üç yıl süreyle (2004-2005-2006 yürütülen çalışmada, iki farklı kalınlıkta polietilen malç, üç farklı kalınlıkta malç tekstili, biçme ve herbisit (glyphosate uygulamaları yapılmıştır. Uygulamaların yabancı otların yoğunluğu ve kaplama alanına, kültür bitkisinin boy, gövde kalınlığı ve yaprak alanına etkileri incelenmiştir. Çalışmanın sonuçları genel olarak değerlendirildiğinde, yabancı otlu kontrole oranla biçme uygulaması %23,4, kimyasal mücadele %88,4, polietilen malç %99,6, malç tekstili uygulamaları %100 oranında yabancı otları kontrol etmiştir. Kültür bitkisinin boyu, gövde çapı ve yaprak alanındaki en yüksek artış herbisit ve malç uygulamalarından elde edilmiştir. Malç uygulamalarının toprak sıcaklığı ve nemini muhafaza ettiği belirlenmiştir.

  4. Farklı Su Sıcaklıklarında Tutulan Pullu Sazan (Cyprinus carpio’da Çörek Otu (Nigella sativa Yağının Oksidatif Stres ve Bazı Antioksidan Parametrelere Etkisi

    Directory of Open Access Journals (Sweden)

    Serpil Mişe Yonar

    2017-09-01

    Full Text Available Bu çalışmada; farklı su sıcaklıkları uygulanmış pullu sazan (Cyprinus carpio’da malaondialdehit (MDA ve glutatyon (GSH düzeyi ile glutatyon-S-transferaz (GST enzim aktivitesine çörek otu yağının etkisi araştırılmıştır. 20, 24 ve 28°C’ de tutulan balıklara çörek otu yağı (10 mg/kg yem uygulanmıştır. Kontrol grubu olarak 24°C’de tutulan balıklar seçilmiştir. Uygulama 10 gün devam etmiş ve bu sürenin sonunda balıklardan karaciğer ve böbrek örnekleri alınmıştır. Çalışma sonucuna göre 20°C ve 28°C’deki balıkların MDA düzeyinin önemli oranda arttığı, GSH düzeyi ile GST aktivitesinin düştüğü tespit edilmiştir. Bu gruplarda çörek otu yağı uygulamasıyla MDA düzeyinin istatistiksel olarak önemli düzeyde düştüğü, GSH düzeyi ile GST aktivitesinin önemli oranda yükseldiği belirlenmiştir. Elde edilen sonuçlara göre, balıklarda sıcaklık farklılıklarından kaynaklanan strese karşı çörek otu yağı antioksidan olarak kullanılabilir.

  5. Heavy Metal Deposition in Sediments from the Delta of the Gediz River (Western Turkey: A Preliminary Study.

    Directory of Open Access Journals (Sweden)

    Hatice Parlak

    2015-12-01

    Full Text Available Gediz Nehri Deltası (Batı Türkiye sedimentlerinde ağır metal birikimi. Bir Ön Çalışma: Gediz Nehri bölgede tarımsal açıdan önemli olduğu kadar deltası da Dünya Doğal Yaşamı Koruma Federasyonu tarafından Önemli Kuş sahası olarak değerlendirilmiştir. Bunun yanı sıra, Gediz Deltası 1998 yılından beri Ramsar alanı olarak koruma altındadır. Öte yandan Gediz Nehri’nin tarımsal, evsel ve endüstriyel atıklar ile yoğun bir şekilde kirlendiği rapor edilmektedir. Bu ön araştırmada Gediz Deltasından toplanmış sediment örneklerinde bazı ağır metaller (As, Pb, Cd, Ni, Cu, Co ve Cr analiz edilerek kirliliğin etkisi tayin edilmeye çalışılmıştır. Elde edilen sonuçlara göre, As, Cu, Cd, Co, Ni ve Pb için bir kirlilik riski olmadığı sonucuna varılabilir. Bununla beraber, arıtma tesisi olmasına rağmen özellikle deri sanayinin atık sularının döküldüğü kanalın birleştiği yer olan istasyon 2 ve 3’de yüksek Cr içeriği saptanmıştır (2565.5 ppm maksimum

  6. Yeni Bir Öğretmen Yetiştirme Yaklaşımı Olarak Göreve Başlatma Programı

    Directory of Open Access Journals (Sweden)

    Betül BALKAR

    2014-08-01

    Full Text Available Bu araştırmanın amacı, aday öğretmenlerin eğitiminde kullanılan Göreve Başlatma Programı (GBP’nın Türkiye’de uygulanabilirliğine ilişkin aday öğretmenlerin ve okul yöneticilerinin görüşlerinin incelenmesidir. Bu amaçla Gaziantep ilindeki okul öncesi ve ilköğretim kurumlarında görev yapan 9 aday öğretmen ve 10 okul yöneticisi ile odak grup görüşmeleri yapılmıştır. Odak grup görüşmelerinde GBP’nin amaçlar ve hedefler, tasarım ve uygulama aşamalarına ilişkin sorular sorulmuştur. Elde edilen verilerin analizinde içerik analizi kullanılmıştır. Araştırmanın sonucunda; aday öğretmenlerin ve okul yöneticilerinin, GBP’nin adaylık eğitimi programı olarak kullanılabileceğini ve kullanılmasının yararlı olacağını düşündükleri tespit edilmiştir. Aday öğretmenler ve okul yöneticileri, aday öğretmenlerin GBP kapsamında özellikle sınıf yönetimi ve etkili iletişim alanlarında yardım almaları gerektiğini düşünmektedirler. Araştırmanın bulgularına dayalı olarak, mevcut adaylık eğitimi programının sorunlarının belirlenerek bu sorunların çözümüne yönelik GBP gibi farklı alternatiflerin incelenmesi önerilmektedir. Aday öğretmenlerin mesleki gelişim süreçlerinde daha yoğun bir etkileşimle çalışılmasını sağlayabilecek mentorlük sistemi aday öğretmenlere sunulmalıdır.

  7. 2-Aminopiridin Türevleri ile Sülfonamit İçeren Maleamik Asit Türevinin Proton Transfer Tuzları ve Cu(II Komplekslerinin Sentezi, Karakterizasyonu ve İnsan Eritrosit Karbonik Anhidraz İzoenzimleri Üzerindeki Etkilerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Halil İLKİMEN

    2016-12-01

    Full Text Available Bu çalışmada, ilk olarak 3-aminobenzensülfonamit (mabs ile maleik anhidritin (mal tepkimesinden sülfonamit içeren maleamik asit türevi (E-4-okso-4-(3-sülfamoyilfenilaminobüt-2-enoik asit (Hmabsmal bileşiği sentezlenmiştir. Daha sonra Hmabsmal bileşiği ile 2-aminopiridin türevlerinin [2-amino-3-metilpiridin (2a3mp (1; 2-amino-4-metilpiridin (2a4mp (2; 2-amino-5-metilpiridin (2a5mp (3 veya 2-amino-6-metilpiridin (2a6mp (4] proton transfer tuzları hazırlanmıştır. 1 ve 3 tuzlarının Cu(II (5 ve 6 geçiş metal kompleksleri sentezlenmiştir. Proton transfer tuzlarının yapısı elementel analiz, 1H-NMR, 13C-NMR, FT-IR, UV-Vis metotları ile aydınlatılmıştır. Amorf halde elde edilen geçiş metal komplekslerinin yapıları ise elementel analiz, ICP-OES, FT-IR, UV-Vis, termal analiz, manyetik duyarlılık ve molar iletkenlik sonuçları dikkate alınarak önerilmiştir. Ayrıca, sentezlenen maddelerin insan eritrosit hCA I ve hCA II izoenzimleri üzerindeki inhibisyon etkilerini belirlemek üzere in vitro çalışmalar yapılmıştır. Yeni sentezlenen maddelerin izoenzimlerin esteraz aktivitesini inhibe ettiği tespit edilmiştir. Özellikle 5 ve 6 bileşikleri kayda değer inhibisyon etkisine sahiptirler. Bu maddelerin inhibisyon değerlerinin kontrol bileşiği asetazolamit (AAZ değerleri ile kıyaslanabilir büyüklükte olduğu tespit edilmiştir.

  8. ÇELİK LİFLİ BETONLARIN DARBE DİRENCİNE AGREGA MAKSİMUM BOYUTUNUN ETKİSİ

    Directory of Open Access Journals (Sweden)

    Şemsi YAZICI

    2008-03-01

    Full Text Available Bu çalısmada çelik lifli betonların darbe direncine, agrega maksimum dane boyutunun etkisi incelenmistir. Çalısmada maksimum dane boyutu 10 mm, 15 mm, 20 mm ve 25 mm olan kireç tası kökenli kırma agrega kullanılarak, 8 farklı lifsiz-çelik lifli beton üretilmistir. Üretilen lifli-lifsiz betonlarda; su/çimento oranı 0.50, çimento dozajı 400 kg/m3 olarak sabit tutulmustur. Lifli betonlarda hacimce % 1.0 oranında, narinligi 65 olan, iki ucu çengelli çelik lif kullanılmıstır. Üretilen betonlardan hazırlanan 150 mm ayrıtlı küp örnekler üzerinde, 28 günlük standart kür sonunda tek eksenli basınç, yarmada çekme ve ultra ses deneyleri yapılarak, betonların mekanik özellikleri belirlenmistir. Ayrıca, çalısma kapsamında üretilen betonların darbe testleri ACI 544.3R-93 'ce önerilen darbe deney düzenegi kullanılarak gerçeklestirilmistir. Darbe testleri için 150 mm çaplı 300 mm yükseklikli örnekler hazırlanarak 28 gün kür edildikten sonra, çapı 150 mm yüksekligi 64 mm olacak sekilde kesilerek özel diskler hazırlanmıs ve bu diskler üzerinde darbe testleri yapılmıstır. Deneylerden elde edilen sonuçlar lif varlıgı ve agrega maksimum boyutunun degisimine baglı olarak degerlendirilmistir.

  9. Swarm's absolute magnetometer experimental vector mode, an innovative capability for space magnetometry

    DEFF Research Database (Denmark)

    Hulot, Gauthier; Vigneron, Pierre; Leger, Jean-Michel

    2015-01-01

    readings of the magnetic eld. Since launch, these ASMs provided very high accuracy scalar eld data, as nominally required for the mission, together with experimental vector eld data. Here, we compare geomagnetic eld models built from such ASM-only data with models built from the mission's nominal 1Hz data......, combining ASM scalar data with independent uxgate magnetometer vector data. The high level of agreement between these models demonstrates the potential of the ASM's vector mode for data quality control and as a stand alone magnetometer, and illustrates the way the evolution of key eld features can easily...

  10. Ankara’daki Üniversite ve Halk Kütüphanelerinde Çalışan Kütüphanecilerin İş Doyumları Üzerine Bir Araştırma =A Research on Job Satisfaction of Librarians Employed at University and Public Libraries in Ankara

    Directory of Open Access Journals (Sweden)

    Yılmaz, Bülent

    2010-04-01

    Full Text Available Kişinin yaptığı işten hoşnut olması anlamına gelen iş doyumu genelde ve kütüphanecilik alanı açısından işteki başarı ve verimliliği etkileyen, aynı zamanda insanın yaşamdan doyum almasına önemli katkıda bulunan çok boyutlu bir olgudur. Bu çalışmada, öncelikle iş doyumu hakkında genel ve kütüphanecilik temelli kuramsal bilgi verilmiştir. Daha sonra yapılan araştırma sonuçları değerlendirilmiş ve konu ile ilgili öneriler sunulmuştur. Bu çalışmaya konu olan araştırma Ankara'da bulunan üniversite ve halk kütüphanelerinde çalışan kütüphaneciler üzerinde gerçekleştirilmiştir. Ankara'daki on üniversite kütüphanesinden 69, altı halk kütüphanesinden 20 olmak üzere toplam 89 kütüphaneciye Mayıs 2009 tarihinde anket uygulanmıştır. Anket için Spector'un "İş Doyumu Ölçeği" temel alınmıştır. Araştırmada elde edilen sonuçlara göre, üniversite ve halk kütüphanelerinde çalışan kütüphanecilerin genelde iş doyumları arasında istatistiksel olarak anlamlı bir fark bulunmadığı, ancak, bazı unsurlar arasında anlamlı farklılıklar olduğu saptanmıştır.Job satisfaction, which signifi es an individual's happiness in his/her occupation, is a multidimensional case that aff ects success and productivity at work, in general terms and in the fi eld of librarianship. This article off ers primarily general information on job satisfaction and librarianship-based theoretical information. It also evaluates the conclusions of a questionnaire and off ers related suggestions. The research focused on the librarians employed at university and public libraries in Ankara. A questionnaire was administered in May 2009 to 69 university librarians and 20 others employed by public libraries, bringing the total to 89 professional men and women. The questionnaire has been based on the Spector's "Job Satisfaction Survey". According to the conclusions that may be derived from the research

  11. Tarım İşletmelerinde Buğday Tohumu Kullanımı ve Sorunları: Burdur ve Isparta İlleri Örneği

    Directory of Open Access Journals (Sweden)

    Hülya Gül

    2015-09-01

    Full Text Available Çalışmanın temel hedefi Isparta-Burdur illerinde buğday üretimindeki tohum kullanım yapısının tespiti ve üretimin geliştirilmesidir. Araştırmada kullanılan birincil veriler, bölgede buğday yetiştiriciliği yapan işletmelerden anket yöntemi ile elde edilmiştir. Buğday yetiştiriciliği yapan 150 işletmeden elde edilen veriler 2011 üretim dönemine aittir. Buğday üretiminde işletme genel ortalamasında işletmecilerin karşılaştığı sorunların başında ürün fiyatının düşük olması, girdi fiyatlarının yüksekliği gelmektedir. İşletmecilerin buğday üretiminin geliştirilmesinin, üretimde kullanılan mazot, ilaç, gübre gibi girdi maliyetlerinin düşürülmesi ile sağlanabileceğini ifade etmişlerdir. Buğday tarımında tohum ilaçlaması bölgede işletmelerin %97,3’ünde yapılmaktadır. Buğday tarımında üretim sonrası buğday ürününün depolama durumu ise görüşülen işletmelerin %52,7’sinde söz konusudur. İşletmelerin %74,7’si yetiştirdiği buğday çeşidini bilmektedir. İşletmelerin %52’sinde de sertifikalı tohum kullanımının olduğu saptanmıştır. Sertifikalı tohum kullanım oranı Isparta ilinde daha yüksektir (%69,3. İstatistikî olarak da iller arasında sertifikalı tohum kullanımında farklılık bulunmaktadır. Bölgede işletmelerin sertifikalı tohum kullanımı konusunda yeterli bilgiye sahip olmadığı saptanmıştır. Dolayısıyla bu konuda yayımcılar tarafından üreticiye bilgi aktarımı gerekmektedir.

  12. SIKIŞTIRMA ORANI DEĞİŞİMİNİN BUJİ İLE ATEŞLEMELİ MOTORLARDA YAKIT TÜKETİMİNE ETKİSİ

    Directory of Open Access Journals (Sweden)

    Yakup SEKMEN

    2002-02-01

    Full Text Available Günümüz ekonomik koşulları ve enerji kaynaklarının büyük bir hızla tükenmekte olması, mevcut enerji kaynaklarının en verimli şekilde kullanılmasını zorunlu hale getirmiştir. Bu nedenle otomotiv endüstrisinde yakıt tüketimini azaltmak üzere değişik yük ve hız şartlarında motorlardan talep edilen gücün çevreyi en az kirleterek ve mümkün olan en ekonomik şekilde alınabilmesine yönelik yapılan çalışmalar artan hızla devam etmektedir. Teknolojinin gelişimine paralel olarak gerçekleştirilen bu çalışmalar sayesinde motorların tasarım ve işletme parametreleri değişik çalışma şartlarına göre optimize edilerek yakıtın en verimli şekilde kullanılmasına çalışılmaktadır. Motorun çalışma şartlarına göre sıkıştırma oranının değiştirilmesine yönelik yapılan çalışmalarla olumlu sonuçlar elde edilmiştir. Kısmi yüklerde yanma veriminin, yakıt ekonomisinin ve emisyonların iyileştirilmesi için sıkıştırma oranının artırılması, motorun yüksek yük ve düşük hız koşullarında ise olası vuruntu ve sert çalışmayı önlemek için sıkıştırma oranının bir miktar azaltılması gerekmektedir. Bu çalışmada, buji ile ateşlemeli değişken sıkıştırma oranlı motorlar konusunda yapılan araştırmalar, yakıt ekonomisi, motor çıkış gücü ve termik verim açısından incelenmiştir. Kısmi ve orta yük şartlarında değişken sıkıştırma oranlı motorlarla yapılan deney sonuçlarına göre motor gücünün arttığı, özgül yakıt tüketiminin azaldığı, yakıt ekonomisinde özellikle kısmi yüklerde %30'a varan iyileşmeler elde edildiği ve ayrıca bazı egzoz emisyon değerlerinde ciddi azalmalar sağlandığı tespit edilmiştir.

  13. HM-CFRP ile güçlendirilmiş çelik I kirişlerin eğilme davranışlarının YSA analizi ile incelenmesi

    Directory of Open Access Journals (Sweden)

    Elif Ağcakoca

    2016-08-01

    Full Text Available Köprülerde kullanılan, çelik kompozit kirişler gerek kesit kayıplarından, gerekse artan trafik yüklerinden dolayı mevcut kesitleri yetersiz kalabilmektedir. Çözüm olarak kesitin yenisi ile değiştirilmesi ya da güçlendirilmesi tavsiye edilmektedir. Günümüzdeki teknolojik gelişmeler sayesinde karbon fiberlerin içinde yüksek rijitliğe sahip High moduluscarbon fiber-reinforced polimer(HM-CFRP gibi güçlendirme malzemeleri üretilmekte ve bu malzemeler yine yüksek elastik modüle sahip çelik yapı elemanlarının güçlendirilmesinde kullanılmaktadır. Böylece polimer malzeme ile güçlendirilen çelik yapı elemanlarının rijitlik ve dayanımında mukavemet kazanması sağlanmaktadır. Ancak çelik, epoksi ve fiber takviyeli malzemeden oluşan güçlendirilmiş kirişlere ait deneysel çalışmalar zaman ve parasal yönden ekonomik olmamaktadır. Bu yüzden deney hazırlık aşaması zor olan durumlarda, numerik modeller hazırlanıp doğrulanarak parametrik çalışmalar yürütülebilmektedir. Bu çalışmadaki numerik model, deneysel çalışma ile doğrulanmış daha sonra parametrik çalışmalar yapılmış ve YSA ile test edilmiştir. Çalışmanın numerik modellemesinde ABAQUS sonlu eleman modeli kullanılmış gerek malzeme gerekse geometrik bakımdan doğrusal olmayan analizler yapılmıştır. YSA tabanlı modelinin performansı ile ABAQUS programından elde edilen sonuçlar değerlendirildiğinde YSA tekniği kullanılarak I kesitli Çelik- Betonarme kompozit kirişlerin HM- CFRP ile onarım ve güçlendirilmesinde daha hızlı, güvenilir ve ekonomik sonuçlar elde edilebileceği görülmüştür.

  14. Ciddi Düzeyde Otizm Spektrum Bozukluğu Olan Çocuklar ile Annelerinin Ebeveyn-Çocuk Etkileşimlerinin Ebeveyn ve Çocuk Davranışları Açısından İncelenmesi

    Directory of Open Access Journals (Sweden)

    Gökhan Töret

    2015-04-01

    Full Text Available Bu araştırmada, ciddi düzeyde otizm spektrum bozukluğu olan çocuklar (n=40 ile annelerinin etkileşimsel davranışlarının incelenmesi amaçlanmıştır. Çalışma grubunda yer alan annelerin çocukları ile etkileşimlerinin görüntü kaydı alınmış, kaydedilen görüntü kayıtları Ebeveyn Davranışını Değerlendirme Ölçeği-Türkçe Versiyonu (EDDÖ-TV; Diken, 2009 ve Çocuk Davranışını Değerlendirme Ölçeği-Türkçe Versiyonu (ÇDDÖ- TV; Diken, 2009 uygulanarak analiz edilmiştir. Elde edilen bulgular ışığında, ciddi düzeyde otizm spektrum bozukluğu (CDOSB olan çocuk annelerinin çocuklarına yönelik etkileşimlerinde yüksek düzeyde yönlendirici etkileşim stiline sahip oldukları belirlenirken, duygusal ifade edici olma ve yanıtlayıcı etkileşim stiline sahip olma düzeylerinin ise düşük düzeyde olduğu bulgularına ulaşılmıştır. CDOSB olan çocukların anneleri ile olan etkileşimlerinde, düşük düzeyde dikkat ve başlatma etkileşim stiline sahip oldukları bulguları elde edilmiştir. Yapılan analizler doğrultusunda ortaya çıkan bulgular, erken çocukluk döneminde OSB olan çocuklar ve ebeveynlerinin etkileşimsel davranışları ile OSB olan çocuklara yönelik müdahale uygulamalarına olası yansımaları bağlamında alan yazında var olan ilgili araştırmalar çerçevesinde tartışılmıştır This study explored 40 Turkish mothers’ interaction styles and interactive engagement behaviors with their children with severe autism spectrum disorder. Participating mothers’ interactions with their children with severe autism spectrum disorder were recorded and video recordings of the interactions were analyzed using the Turkish Version of Maternal Behavior Rating Scale (TV-MBRS; Diken, 2009 and the Turkish Version of Child Behavior Rating Scale (TV-CBRS; Diken, 2009. Study findings indicated that mothers of children with severe autism spectrum disorder displayed higher rates

  15. Umbelliferae Familyasından Bazı Önemli Kültür Türlerinin Isparta Ekolojik Koşullarında Tarımsal ve Teknolojik Özelliklerinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Sevil KESKİN

    2016-04-01

    Full Text Available Anason (Pimpinella anisum L., dereotu (Anethum graveolens L., kimyon (Cuminum cyminum L., kişniş (Coriandrum sativum L., rezene (Foeniculum vulgare Mill. dünyada ve ülkemizde kültürü yapılan çok değerli tıbbi ve aromatik bitkilerdir. Bu araştırmada; anason, kimyon, kişniş, rezene ve dereotu türlerine ait çeşitlerin ve populasyonların Isparta ekolojik koşullarında bazı tarımsal ve teknolojik özelliklerinin belirlenmesi, uçucu yağ, sabit yağ ve petroselinik asit kaynağı olarak değerlendirme olanaklarının araştırılması amaçlanmıştır. Tarla ve laboratuvar araştırmalarından elde edilen sonuçlara göre, en yüksek tohum verimi anasonda “Yeşilova” populasyonundan (47.01 kg/da, dereotunda “Akşehir” populasyonundan (77.75 kg/da, kimyonda “Egebir09” çeşidinden (97.00 kg/da, kişnişte “Erbaa” çeşidinden (82.85 kg/da ve rezenede “Denizli” populasyonundan (63.66 kg/da elde edilmiştir. En yüksek uçucu yağ oranı anasonda “Burdur” populasyonunda (%3.60, dereotunda “Burdur” populasyonunda (%3.73, kimyonda “Türkmen09” çeşidinde (%2.13, kişnişte “Gamze” çeşidinde (%0.47 ve rezenede “Burdur” populasyonunda (%3.13 tespit edilmiştir. En önemli ana uçucu yağ bileşeni anasonda trans-anetol (%95.56-95.88, dereotunda D-karvon (%37.87-67.76, kimyonda a-thujenal (%30.90-42.52, kişnişte linalool (%81.85-88.94 ve rezenede trans-anetol (%79.67-89.13 olarak bulunmuştur. En yüksek sabit yağ oranı anasonda “Burdur” populasyonunda (%30.17, dereotunda “Burdur” populasyonunda (%21.24, kimyonda “Egebir09” çeşidinde (%29.03, kişnişte “Erbaa” çeşidinde (%25.42 ve rezenede “Denizli” populasyonunda (%23.67 belirlenmiştir. En yüksek petroselinik asit oranı ise anasonda “Çardak” populasyonunda (%63.37, dereotunda “Burdur” populasyonunda (%87.28, kimyonda “Türkmen09” çeşidinde (%60.18, kişnişte “Erbaa” çeşidinde (%79.89 ve

  16. TKT 7-11 sonuçlarına göre üstün yetenekli öğrencilerin yetenek alanlarının analizi [An analysis of gifted students’ capabilities according to the results of TKT 7-11 test

    Directory of Open Access Journals (Sweden)

    Şenol SEZER

    2014-10-01

    Full Text Available Tarama modelinde gerçekleştirilen araştırmanın amacı, Bilim ve Sanat Merkezine devam etme hakkı kazanan, üstün yetenekli ve üstün zekâlı öğrencilerin, TKT 7-11 sonuçlarına göre yetenek alanlarının analizidir. Araştırmanın evreni 2007- 2013 yılları arasında, Giresun Bilim ve Sanat Merkezi’ne devam etme hakkı kazanan 243 öğrenciden oluşmaktadır. Örneklem alınmamış, evrenin tamamına ulaşılmaya çalışılmıştır. Araştırmanın verileri, üstün yetenekli öğrencilerin, TKT 7-11 testinde yer alan sorulara verdikleri yanıtlardan elde edilmiştir. Çalışma grubunun TKT 7-11 testinde yer alan sorulara verdiği yanıtlardan elde edilen verilerin frekans, yüzde, ortalama ve standart sapma puanları analiz edilmiştir. Değişkenlere ilişkin puanlar arasındaki farklılıkları belirlemede, bağımsız t-testinden ve ANOVA’dan yararlanılmıştır. Üstün yetenekli öğrenciler, TKT 7-11 testinde yer alan soruların %80’ini doğru yanıtlamıştır. Öğrencilerin TKT 7-11 testinde yer alan sorulara verdikleri yanıtlara göre yetenek alanları, ayırt etme yeteneği, akıl yürütme yeteneği, sayı yeteneği, dil yeteneği, şekil-uzay yeteneği şeklinde sıralanmaktadır. Bağımsız t-testi sonuçlarına göre, araştırmaya katılan öğrencilerin yetenek alanlarına ilişkin puanlar arasında; cinsiyet ve yerleşim yeri değişkenleri açısından akıl yürütme yeteneği alt boyutunda, istatistiksel olarak anlamlı farklılıklar görülmektedir. Yaş değişkeni açısından ise dil yeteneği, akıl yürütme yeteneği ve şekil-uzay yeteneği ve sayı yeteneği alt boyutlarında istatistiksel olarak anlamlı farklılıklar görülmektedir.

  17. Bilingual Dictionaries for Communication in the Domain of Economics: Function-Based Translation Dictionaries

    DEFF Research Database (Denmark)

    Nielsen, Sandro

    2015-01-01

    With their focus on terms, bilingual dictionaries are important tools for translating texts on economics. The most common type is the multi-fi eld dictionary covering several related subject fi elds; however, multi-fi eld dictionaries treat one or few fi elds extensively thereby neglecting other fi...... varieties such as British, American and international English to indicate syntactic options and restrictions on language use. Secondly, translators need to know the meaning of domain-specifi c terms to properly understand the differences in the structure of the domains in the cultures involved. Finally...... elds in contrast to single-fi eld and sub-fi eld dictionaries. Furthermore, recent research shows that economic translation is not limited to terms so lexicographers who identify and analyse the needs of translators, usage situations and stages in translating economic texts will have a sound basis...

  18. Orff Yaklaşımı İle Yapılan Okul Öncesi Müzik Eğitiminin Öğrencilerin Sosyal Becerilerinin Gelişimine Etkileri The Influences Of Orff Preschool Music Education Approach On The Improvement Of Social Skills Of Students

    Directory of Open Access Journals (Sweden)

    Bahar GÜDEK

    2013-03-01

    ştırmanın amacı, Orff yaklaşımı ile yapılan okul öncesimüzik eğitiminin öğrencilerin sosyal becerilerinin gelişimine etkilerininincelenmesidir. Araştırmanın çalışma grubunu, 2009-2010 eğitimöğretimyılında Samsun ili, Canik Yavuz Selim Yatılı İlköğretim BölgeOkulu, okul öncesi 6 yaş grubu öğrencileri arasında deney ve kontrolgrupları için rasgele seçilen 40 kişi oluşturmuştur. AraştırmadaAvcıoğlu (2005 tarafından geliştirilen „Sosyal Becerileri DeğerlendirmeÖlçeği (4-6 yaş‟ın “Kişiler Arası İletişim Becerileri, Akran Baskısı İleBaşa Çıkma Becerileri, Sözel Açıklama Becerileri, Kendini Kontrol EtmeBecerileri, Hedef Belirleme Becerileri, Dinleme Becerileri, GörevleriTamamlama Becerileri, Sonuçları Kabul Etme Becerileri” başlıklarıaltındaki dokuz alt ölçeği alınarak, 40 öğrencinin her biri için müzikeğitimi öncesi ve sonrasında çocukların okul öncesi öğretmenleritarafından doldurulmuştur. Uygulanan ön test aşamasından sonradeney grubu öğrencileri ile 10 hafta boyunca; Pazartesi ve Çarşambagünleri 60‟ar dakika, Orff Schulwerk yaklaşımı ile okul öncesi müzik,hareket ve dans eğitimi verilmiştir. Kontrol grubunu oluşturanöğrencilere müzik eğitimi verilmemiş, bu öğrenciler okuldaki geneleğitimlerine devam etmişlerdir. Tüm çalışmaların sonunda, deney vekontrol grupları için son testler uygulanmıştır. Elde edilen verilerinişlenmesi sonucunda; Orff Schulwerk yaklaşımı ile verilen okul öncesimüzik eğitiminin, bu eğitimin verilmediği okul öncesi 6 yaş grubuçocuklara göre “Kişiler Arası İletişim, Kızgınlık Davranışlarını KontrolEtme ve Değişikliklere Uyum Sağlama, Sözel Açıklama, AmaçOluşturma, Görevleri Tamamlama Becerileri” sosyal becerilerinin dahafazla geliştikleri saptanmış ve elde edilen sonuçlara dayanarak çeşitliönerilerde bulunulmuştur.

  19. Konut Transformasyonu Bağlamında Lefke’deki CMC Evlerinin Zaman İçerisindeki Dönüşümü / The Gradual Transformation of CMC Houses in Lefke within the Context of Housing Transformation

    Directory of Open Access Journals (Sweden)

    Çağla Beyaz

    2017-06-01

    artlarına, ihtiyaca, siyasete, çevresel faktörlere, iklime, coğrafyaya, kültürel etkenlere göre form değiştirdiği yapılan araştırmalarda görülmektedir. Tüm bu etkenlerin ışığında, Lefke Bölgesi, CMC evleri özelinde uygun tekniklerle yapılan alan çalışmasından elde edilen verilerin biraraya getirilmesiyle, konutların dönüşümü ortaya konmuştur. Yapılan alan çalışması için, her kategoriden birer örnek ele alınarak analizi yapılmış, zaman içerisindeki dönüşümü ve bu dönüşümlere etki eden çevresel faktörler tespit edilmiştir. Alan çalışması kapsamında, tüm bu verilerin toplanması için gerekli olan görüşmeler, fotoğraf çekimleri, rölöve çıkarma ve arşiv araştırma teknikleri kullanılmıştır. Çalışmanın genelinden elde edilen sonuçta; Endüstri Devrimi’nin etkisiyle oluşan hızlı gelişme ile birlikte dini, kültürel, ekonomik, siyasal ve mimari gibi koşullar farklı biçim ve değerlerle şekillenmiştir. Bu şekillenen koşullarla birlikte, dünyada gözlemlenen ve kentleri etkileyen değişim ve dönüşümler Kıbrıs Adası’nı da etkilemiştir. Lefke Bölgesi’nde, CMC’nin kurulmasıyla birlikte buna paralel dört kategoriden oluşan ve ilk kez teraslı olarak üretilen konutların ve onların yakın çevrelerinin, bölgeye olan olumlu ve olumsuz etkileri oldukça dikkat çeker. Bu konutların, günümüze gelene kadar olan dönüşümleri buna etki eden faktörler tespit edilerek sonuçlandırılmıştır.

  20. ACE Cycle in Programming Education by Using Visualization [Programlama Eğitiminde Görselleştirme ile ACE Döngüsü

    Directory of Open Access Journals (Sweden)

    İbrahim Çetin

    2014-12-01

    atanmıştır. Deney grubunda PACE döngüsü kontrol grubunda ise ‘geleneksel öğretim’ uygulanmıştır. Öğretim sürecinden önce ve sonra nicel ve nitel yöntemler kullanılarak veri toplanmıştır. Elde edilen sonuçlara göre kontrol ve deney gruplarının başarı ve tutum puanları arasında anlamlı bir fark bulunamamıştır. Fakat sadece bu sonuca bağlı olarak PACE döngüsünün etkililiği yeterince değerlendirilemez. Nitel veriden elde edilen bulgular kontrol grubundaki öğrencilerin verilen öğretimi yenilikçi bir ortam olarak tanımladıklarını göstermektedir. Bu da ‘geleneksel öğretim’ ortamı tarifinin bağlamsal olarak değişebileceğine işaret eder. Öğrencilerin öğretim ortamı algısı ve deneyimleri çalışmanın sonuçlarını etkilemiş olabilir.

  1. Temettuat Defterine Göre Mut'un Sosyo-Ekonomik ve Demografik Yapısı (1844-1845 Socıo-Economıc And Demographıc Structure Of Mut Accordıng To Temettuat Defter (1844-1845

    Directory of Open Access Journals (Sweden)

    Ahmet GEÇER

    2012-12-01

    ılan sosyo-ekonomik tarihi araştırmalarında, defter koleksiyonları önemli bir yere sahiptir. Tapu Tahrir defterleri, Mühimme defterleri, Temettuat defterleri, bu defter koleksiyonlarının en önemlilerindendir. Çalışmamızda, Konya vilayetine bağlı, İçel sancağının, Mut kazasına ait temettuat defteri incelenmeye çalışılmıştır. Bu amaca yönelik olarak Başbakanlık Osmanlı Arşivinden, 10498 defter numaralı Mut’a ait, toplam 154 sayfa temettuat defteri önce transkripsiyon edilip tablolar oluşturulmuştur. Temettuat defterinde olduğu gibi, köyler ayrı ayrı alınarak oluşturulan bu tablolar Microsoft Excel programında hazırlandığından ve uzun listeler halinde olduğundan burada verilememiştir. Tablolama işleminden elde edilen veriler; İdarî Yapı, Nüfus, İsimler, Nüfusun Ekonomik Faaliyet Kolları ve Sosyal Durumu, Virgi-yi Mahsusa, Tarımsal Üretim Yapısı, Arazi Çeşitleri, Hayvan Çeşitleri ve Vergilendirilmeleri, Elde Edilen Gelirlerin Dağılımı ara başlıkları altında değerlendirilerek, araştırmamızın konusu olan Mut kazasının sosyo-ekonomik ve demografik yapısına dair bilgiler verilmeye çalışılmıştır. Defterdeki veriler değerlendirilirken, defterde olmayan ancak kolay anlaşılması için zaman zaman, Vergilendirme Bölümü, Kazançlar Bölümü gibi ifadeler kullanılmıştır. Bu bölümler defterdeki tasnife göre yapılmıştır. Mut Temettuat defterinde, her hane reisinin ismi, mesleği, her bir hanenin tarımsal üretimden sağladığı kazanç ve bu kazanç üzerinden ödediği aşar vergisi, bu verginin tarımsal faaliyetlere dağılımı, işlenen toprak miktarı, tarımsal işletme büyüklüklerinin yanında sosyo-ekonomik tarihe ışık tutacak önemli bilgiler bulunmaktadır. Bu bilgilerle birlikte dönemin diğer kaynakları göz önüne alındığında Mut’un sosyo-ekonomik yapısı tam anlamıyla ortaya konulmuş olacaktır.

  2. VİRAL PAZARLAMANIN SOSYAL PAYLAŞIM SİTELERİNE ÜYE OLAN KULLANICILAR ÜZERİNDEKİ ETKİSİNİ İNCELEYEN PİLOT BİR ÇALIŞMA - A PILOT STUDY ON EFFECTS OF VIRAL MARKETING ON SOCIAL WEB SITES USERS

    Directory of Open Access Journals (Sweden)

    Serpil ÜNAL

    2012-11-01

    Full Text Available Özet:İnternet kullanımının artması sonucunda önemi artansosyal paylaşım siteleri ile ilginç iletilerin kişiler ya da gruplararasında paylaşımından yararlanan “viral pazarlama”pazarlama literatürüne giren yeni kavramlar arasındadır.Tüketiciler, genellikle arkadaşlarından gelen bir elektronikposta mesajını en güvenilir kaynak olarak gördüklerindenviral kampanyaların sosyal paylaşım sitelerindeki dolaşımıkolaylaşmaktadır. Viral pazarlama, ağızdan ağza iletişiminelektronik şekli olarak tanımlanabilir. Dijital teknolojininyararları sonucunda gelişmiş ve ağızdan ağza iletişimin kritikbir elektronik versiyonu olarak da adlandırılabilir.Bu çalışmanın ana amacı viral pazarlama uygulamalarınınetkinliğini ölçmektir. Araştırma İzmir ili içerisinde çeşitli yaş,meslek ve gelir grubundaki 236 kişi üzerinde viral pazarlamauygulamalarına yönelik yüz yüze anket çalışması ilegerçekleştirilmiştir. Yapılan araştırma sonucundakatılımcıların sosyal paylaşım siteleri içerisinde en çokfacebook ve msn’i kullandıkları, viral kampanyalar içindekomik şakalardan daha fazla etkilendikleri görülmüştür.Ayrıca katılımcıların yaklaşık %64’ünün viralkampanyalardan etkilenerek alışveriş yapması ve %72’sinin debu kampanyaları başkaları ile paylaşmaları araştırmasonucunda elde edilen önemli bir bulgudur. Yapılanistatistiksel analiz sonuçlarına göre, 18-28 yaş dilimindekikatılımcıların, meslek dilimlerinden öğrenci ve serbest meslekgruplarının ve gelir dilimleri daha yüksek olan bireylerin diğergruplara kıyasla e-postalardan daha fazla etkilenerek alışverişyaptıkları saptanmıştır. Kısacası, belirli gruplar için viralpazarlama uygulamalarının oldukça uygun olabileceğiaraştırma sonucunda elde edilen bir bulgudur. Sosyalpaylaşım sitelerinin Türkiye’de kullanımı giderek yaygınlaştığıiçin, viral pazarlama daha

  3. Türkçeyi Yabancı Dil Olarak Öğrenenlerin Konuşma Kaygılarının Değerlendirilmesi An Evaluation of Speaking Anxiety for Learners of Turkish as A Foreign Language

    Directory of Open Access Journals (Sweden)

    Muhammed Eyyüp SALLABAŞ

    2012-09-01

    şısındakilere sözlü olarak aktarmasına konuşma denmektedir. Konuşma dilin anlatma boyutu içinde yer almakta ve kendini ifade etmenin temel aracını oluşturmaktadır. Sözlü anlatım hem toplum için hem de bir beceri olarak dil eğitiminde önemli bir yere sahiptir. Hakkında en az çalışılan konuşma becerisinin yabancılara Türkçe öğretimi alanında da çalışılması oldukça önemlidir. Bu çalışmada Türkçeyi yabancı dil olarak öğrenenlerin Türkçe konuşmaya yönelik kaygıları belirlenmeye ve çeşitli değişkenler bakımından değerlendirilmeye çalışılmıştır. Çalışma, tarama modeliyle gerçekleştirilmiştir. Araştırmaya Ankara Üniversitesi Türkçe Öğretim Merkezi Taksim Şubesinde öğrenim gören C Seviyesinde (Yüksek Türkçe bulunan 68 öğrenci katılmıştır. Araştırmaya temel teşkil eden veriler, Özdemir tarafından geliştirilen “Konuşma Kaygısı Ölçeği” ve “Kişisel Bilgi Formu” aracılığıyla toplanmıştır. Araştırmanın amaçları doğrultusunda toplanan veriler, verilerin özelliklerine uygun analiz teknikleri ve SPSS - 16.0 programı kullanılarak çözümlenmiş; bulgular, tablolar hâlinde sunulmuş ve yorumlanmıştır. Elde edilen verilerin iki değişken arasındaki anlamlılığını test etmek için verilere t testi uygulanmıştır. Elde edilen değerlerin ikiden fazla değişken arasındaki anlamlılığını test etmek için tek yönlü varyans analizi (ANOVA kullanılmıştır. Çalışmada, Türkçenin zor bir dil olmadığını düşünenlerin zor olduğunu düşünenlere göre anlamlı düzeyde kaygı düzeylerinin düşük olduğu, diğer değişkenlerin anlamlı farklılık oluşturmadığı tespit edilmiştir.

  4. "The Foreign Language Classroom is Like an Airplane" Metaphorical Conceptualizations of Teachers’ Beliefs

    Directory of Open Access Journals (Sweden)

    Volkan İnceçay

    2015-04-01

    üzerinde bir etkisinin olup olmadığı da ayrıca incelenmiştir. Bu yapılırken, katılımcılardan çalışma boyunca belirttikleri metaforlar üzerinde yansıtıcı bir şekilde düşünmeleri istenmiştir. Araştırmada veriler metafor tamamlama, yarı-yapılandırılmış görüşme ve takip amaçlı gönderilen elektronik postalarla toplanmıştır. Elde edilen verilerin nitel analizinin sonucunda hizmet öncesi İngilizce öğretmenlerinin mesleğe başlamadan önce tabula rasa olmadıkları ve metafor kullanımının örtülü bilgilerin gün yüzüne çıkarılmasında etkili bir yöntem olduğu belirlenmiştir. Bunun yanı sıra gerçek sınıf ortamında elde edilen öğretim tecrübesinin çalışmada yer alan hizmet öncesi İngilizce öğretmenlerinin okul deneyimi başlamadan önce ifade ettikleri metaforlar üzerinde bir derece etkili olduğu belirtilebilir. Anahtar Sözcükler: Hizmet öncesi öğretmen eğitimi, pedagojik formasyon programları, okul deneyimi, metafor analizi, var olan inançlar, örtülü bilgi

  5. Müzik Öğrencilerinin Piyano Dersine Yönelik Tutumları The Attitudes Of Students Towards The Piano Lesson In Professional Music Education

    Directory of Open Access Journals (Sweden)

    Elmas GÜN

    2013-03-01

    ımından önemli olduğudüşünülmektedir.Araştırmanın evrenini, Türkiye’deki Eğitim Fakülteleri’nin MüzikEğitimi Anabilim Dalları ile Güzel Sanatlar ve Spor Liseleri MüzikBölümü son sınıf öğrencileri oluşturmaktadır. Örneklem ise;Pamukkale Üniversitesi, Muğla Üniversitesi Eğitim Fakülteleri MüzikEğitimi Anabilim Dalı ile Denizli ve Muğla Güzel Sanatlar ve SporLiseleri Müzik Bölümü son sınıf öğrencileri olarak belirlenmiştir.Araştırma ile ilgili veriler TUFAN ve GÜDEK (2008 tarafındangeliştirilen “Piyano Dersine Yönelik Tutum Ölçeği” aracılığıylatoplanmıştır. Araştırma verileri, SPSS 17 paket programı yardımıylafrekans, yüzde ve bağımsız örneklem t-testi kullanılarak analizedilmiştir. Çalışmada, elde edilen sayısal veriler tablolaştırılarakyorumlanmış ve piyano dersine yönelik tutumlar belirlenmiştir.Araştırmadan elde edilen bulgularına göre, Güzel Sanatlar ve SporLiseleri son sınıf öğrencilerinin piyano dersine yönelik tutumlarının,Müzik Eğitimi Anabilim dalı son sınıf öğrencilerin tutumlarına göredaha olumlu olduğu saptanmıştır. Bunun yanında cinsiyet ve mezunolunan lise türü değişkenlerine göre öğrencilerin tutumları arasındaanlamlı fark saptanmadığı sonucuna ulaşılmıştır.

  6. Değerleri Kazandırmasındaki Etkililik Açısından Resmi Ve Örtük Program İle Okul Dışı Etmenlerin Öğrenci Görüşleri Doğrultusunda Değerlendirilmesi Evaluation Of Curriculum, Hidden Curriculum And Out-Of-School Sources In Terms Of Their Efficacy For Gaining Values Based On Student Views

    Directory of Open Access Journals (Sweden)

    Etem YEŞİLYURT

    2012-12-01

    üzeyinde öğrenim gören öğrenciler oluşturmaktadır. “Benzeşik örnekleme yöntemi” kullanılarak belirlenen araştırmanın örneklemini, altı ilköğretim okulunda öğrenim gören 526 öğrenci oluşturmaktadır. Araştırmanın verileri Fer ve Kuş (2009 tarafından geliştirilen „İlköğretim Programlarında Yer Alan Değerleri Kazanma Yolları Anketi‟ ile toplanmıştır. Verilerin çözümlenmesinde frekans, yüzde, aritmetik ortalama ve standart sapma teknikleri kullanılmıştır. Elde edilen bulgulardan hareketle şu genel sonuçlara ulaşılmıştır. Kişisel ve evrensel değerler ile milli değerlerin öğrencilere kazandırılmasında resmi ve örtük program ile okul dışı etmenlerin üçünün de çok etkili olduğu tespit edilmiştir. İstatistiksel açıdan aralarında fazla bir fark olmamasına rağmen, değerlerin kazandırılmasında birinci derecede okul dışı etmenlerin, ikinci derecede resmi programın, üçüncü derecede ise örtük programın daha etkili olduğu sonucu ortaya çıkmıştır. Değerlerin kazandırılması yollarında da benzer bir sonuca varılmıştır. Elde edilen başka bir sonuç ise, resmi ve örtük program ile okul dışı etmenlerin milli değerlerin öğrencilere kazandırılmasında daha yüksek düzeyde etkili olduğudur. Ayrıca ulaşılan sonuçlar doğrultusunda çeşitli öneriler geliştirilmiştir.

  7. The Impact of the Use of Information Technologies on Turkish

    Directory of Open Access Journals (Sweden)

    Deniz Gezgin

    2016-01-01

    alışma grubunu, 2014-2015 öğretim yılında Trakya Üniversitesi Eğitim Fakültesi Formasyon Programında öğrenim gören 84 Türk Dili ve Edebiyatı öğretmeni adayı oluşturmaktadır. Çalışmanın tematik çerçevesi araştırmacılar tarafından gerçekleştirilen alan yazın taraması ve uzman görüşleri doğrultusunda belirlenmiştir. Uygulama sürecinde öğretmen adaylarından, BT kullanımın Türkçeye etkileri ile ilgili görüşlerini kompozisyon şeklinde yazmaları istenmiştir. Görüşme sonucunda elde edilen verilerin çözümlenmesinde betimsel analiz tekniği ve betimsel istatistiklerden yararlanılmıştır. Ayrıca öğretmen adaylarının görüşlerini yansıtmak için doğrudan alıntılar yapılmıştır. Araştırmada elde edilen bulgulara göre öğretmen adaylarının görüşleri, BT kullanımının Türkçeye olumsuz etkileri olduğu yönündedir. Özellikle İngilizce kelimelerin kullanımı, yazım ve noktalama işaretlerinin göz ardı edilmesi ve yazımda kural dışı kısaltma kullanımı boyutları açısından olumsuz görüş bildirmişlerdir. Bundan sonraki araştırmacılar için, BT’nin bilinçli kullanımının sağlanmasına yönelik çalışmalar yapılması önerilebilir. Ek olarak, BT’nin olanaklarından yararlanılarak yapılabilecek bu çalışmalarla dilin kurallarının iletişimdeki önemi ve gerekliliğine ilişkin bir farkındalık oluşturulabilir.Anahtar Sözcükler: Bilişim teknolojileri, dil, Türkçe

  8. Öğretmenlerde A Tipi Kişilik, Stres Kaynakları, Öz Yeterlik ve İş Doyumu Type A Personality, Stress Resources, Self Efficacy And Job Satisfaction Among Teachers

    Directory of Open Access Journals (Sweden)

    Hikmet YAZICI

    2013-09-01

    şkilidir. Farklı değişkenlere bağlı olarak öğretmenlerin iş doyumu üzerinde de araştırmalar yapılmaktadır. Bu çalışmanın temel amacı, öğretmenlerdeki iş doyumunun kişilik özellikleri, stres kaynakları ve öz-yeterlik inançları ile ilişkilerini incelemektir. Araştırma kapsamında yaş, cinsiyet, medeni durum, çalışılan kurum türü ve idarecilik deneyimi gibi değişkenlerle iş doyumu arasındaki ilişkiler de ele alınmaktadır. Araştırma, 2012-2013 eğitim-öğretim yılında, Trabzon ilindeki özel ve resmi eğitim kurumlarında görev yapan 689 öğretmen (Kadın= 346, Erkek= 343 üzerinde yapılmıştır. Araştırmada veri toplama aracı olarak, Kişisel Bilgi Formu, İş Doyumu Ölçeği, Stres Kaynakları Ölçeği, A Tipi Kişilik Ölçeği ve Genel Öz-yeterlik Algısı Ölçeği kullanılmıştır. Araştırmadan elde edilen bulgulara göre; A tipi kişilik özellikleri, stres kaynakları ve öz yeterlik inançları öğretmenlerin iş doyumlarını anlamlı düzeyde açıklamaktadır. Bunun yanı sıra yaş ve çalışılan kurum türü değişkenleri de iş doyumunu anlamlı düzeyde yordamaktadır. Araştırmadan elde edilen sonuçlar, literatür bulguları doğrultusunda tartışılmış ve önerilerde bulunulmuştur.

  9. Bilişim Teknolojileri Öğretmen Adaylarının E-Kitap ve Etkileşimli E-Kitap Kavramına İlişkin Metaforik Algıları

    Directory of Open Access Journals (Sweden)

    Seda Özer

    2015-04-01

    Full Text Available Öz Bu araştırmanın amacı bilişim teknolojileri öğretmen adaylarının e-kitap ve etkileşimli kitaba ilişkin algılarını metafor analizi yoluyla incelemektir. Araştırmanın çalışma grubunu, 2013-2014 öğretim yılı Bahar döneminde Fırat Üniversitesi, Eğitim Fakültesi, Bilgisayar ve Öğretim Teknolojileri Eğitimi lisans programına devam eden (1., 2. ,3. ve 4. sınıf öğretmen adayı oluşturmaktadır. Katılımcılardan “E-kitap …… gibidir. Çünkü…..” ve “Etkileşimli e-kitap …… gibidir. Çünkü…..”  ifadelerini metafor kullanarak doldurmaları istenmiştir. Bilişim teknolojileri öğretmen adaylarından elde edilen bu veriler içerik analizi yöntemi kullanılarak incelenmiştir. Elde edilen veriler doğrultusunda bilişim teknolojileri öğretmen adaylarının e-kitaba yönelik geçerli 153, etkileşimli kitaba yönelik geçerli 151 metafor geliştirdikleri görülmüştür. Araştırmanın bulguları ışığında öğretmen adayları e-kitaba ilişkin olumlu ve olumsuz metaforlar üretirlerken, etkileşimli kitaba yönelik sadece olumlu metaforlar ürettikleri ve etkileşimli e-kitap kullanımını daha cazip gördükleri söylenebilir. Salt metin formatı dışında sunulan etkileşimli kitapların öğrenme sürecinde kullanımının önemi yine bu araştırma sonuçlarıyla desteklenmiştir. Araştırma sonucunda bilişim teknolojileri öğretmen adaylarının e-kitaba ilişkin geliştirdikleri metaforlar arasında ilk sırayı “kolay taşınabilir” metaforu almaktadır. Bu özellik e-kitabın avantajları arasında sayılmaktadır. Öğrencilerin etkileşimli kitaba yönelik geliştirilen metaforları arasında ise ilk sırayı “birden çok duyuya hitap eder” metaforu almıştır. Çoklu ortam materyalleri ile öğrenme ortamının desteklenmesinin öğrenciler için önemi, bu çalışmada vurgulanmıştır. Anahtar Sözcükler: E-kitap, etkileşimli kitap, metafor

  10. İlköğretim Öğrencilerinin Okuma Tutumları, Yazma Eğilimleri İle Türkçe Dersindeki Akademik Başarıları Arasındaki İlişki Correlation Amongst Reading Attitudes, Writing Dısposıtıons and Academic Success of Elementary Students in Turkish Course

    Directory of Open Access Journals (Sweden)

    Gökhan BAŞ

    2012-09-01

    ştırmanın problem cümlesini, ise, “İlköğretim öğrencilerinin okumaya yönelik tutumları, yazma eğilimleri ile Türkçe dersindeki akademik başarıları arasında anlamlı bir ilişki var mıdır?” sorusu teşkil etmektedir. Çalışmaya Niğde ilindeki ilköğretim okullarından toplam 474 öğrenci katılmıştır. Araştırmaya katılan öğrenciler seçkisiz örnekleme yöntemi ile belirlenmiştir. Yapılan bu çalışmada araştırma sorularına yanıt arayabilmek için gerekli olan veriler Okumaya İlişkin Tutum Ölçeği (Ünal, 2006 ve Yazma Eğilimi Ölçeği ile (Piazza ve Siebert, 2008 toplanmıştır. Araştırmada ilişkisel tarama modeli benimsenmiş olup araştırmada elde edilen verilerin çözümlenmesinde Pearson momentler çarpımı korelasyon katsayısı analiz tekniği ile çoklu regresyon analizi tekniği kullanılmıştır. Araştırmada elde edilen bulgulara göre, öğrencilerin okumaya ilişkin tutumları, yazma eğilimleri ile Türkçe dersindeki akademik başarıları arasında anlamlı ve pozitif yönde ilişkiler saptanmıştır. Ayrıca, öğrencilerin okumaya ilişkin tutumları ile yazma eğilimlerinin de Türkçe dersindeki akademik başarıyı anlamlı bir şekilde yordadığı bulunmuştur. Okumaya ilişkin tutumların Türkçe dersindeki akademik başarının yaklaşık olarak %45’ini ve yazma eğiliminin ise Türkçe dersindeki akademik başarının yaklaşık olarak %41’ini açıkladığı görülmüştür. Ayrıca, okumaya ilişkin tutumun yazma eğiliminin %66’sını açıkladığı anlaşılmıştır.

  11. Türk Dil Kurumu Kütüphanesi Yz. A. 210 Numarada Kayıtlı Lügat Mecmuası Üzerine Bir Değerlendirme An Assessment On Dictıonary Corpus Registered On Yz. A 210 Turk Dil Kurumu Library

    Directory of Open Access Journals (Sweden)

    Mustafa ARSLAN

    2013-03-01

    ştir. Bu sözlükler başka nüshalarıyla karşılaştırılarak çeşitli ihtilaflı bilgiler düzeltilmeye çalışılmıştır. Mecmua içerisindeki sözlüklerin hemen tamamı, eğitim amaçlı yazılmış satır arası tabir edilen sözlüklerdir. Yine bu sözlüklerden bazılarının Farsça gramer ihtiva eden bölümleri bulunmaktadır. Mecmua içerisindeki sözlüklerin çoğunluğunda müellif adı ve telif tarihi kayıtlı değildir. Üzerinde durduğumuz mecmua ile ilgili kütüphane ve katalog kayıtlarında tavsif, eser sayısı, adlandırma, varak sayısı vb. yönlerden çeşitli eksikliklerin ve hataların olduğu saptanmıştır. Kataloglama çalışmaları sırasında sözlüklerin bazı bölümlerinin ayrı bir eser gibi değerlendirildiği, bazı sözlüklerin ise hiç kayda girmediği tespit edilmiştir. Yapılan incelemeden elde dilen sonuçlar doğrultusunda mecmuanın eser kadrosu ve bu eserlerin özellikleri yeniden değerlendirilmiştir. Elde edilen bilgilerin, kütüphane kayıtlarındaki eksik ve hatalı bilgilerin düzeltilmesine ve bu alanda çalışma yapan araştırmacılara fayda sağlayacağı düşünülmektedir.

  12. Library Highway: Library Professionals as Agents of Changes=Kütüphane Geçidi: Değişim Temsilcileri Olarak Kütüphane Çalışanları

    Directory of Open Access Journals (Sweden)

    Jurgita Rudzıonıene

    2013-10-01

    alışan uzmanlar arasından seçilmiştir ve buna bağlı olarak deneysel bir çalışma gerçekleştirilmiştir. Araştırma ilgi ve iletişim alanında faaliyet gösteren sosyal bir kurum özelliği taşıyan kütüphanelerin modernleşme sürecinden kaynaklı olarak kütüphanecilerin mesleki ve kişisel değişikliklerine dikkat çekmektedir. Araştırma yöntemi olarak nicel araştırma yöntemi kullanılmış; oluşturulan bir anket ile kütüphanelerde çalışan kütüphanecilerin çalışmalarındaki değişiklikler ölçümlenmiştir. Araştırma, Litvanya halk kütüphanelerinde 10 yıldan fazla süredir çalışan kütüphanecilerinden gerçek gözlem ile elde edilen verilerin sonuçlarını yansıtmaktadır. Araştırma kapsamında elde edilen veriler Litvanya’da Bill & Melinda Gates Vakfı tarafından düzenlenen “Bibliotekos pažangai” (Yenilik için Kütüphaneler yarışması sonuçlarına göre en iyi 5 halk kütüphanesinden toplanmıştır. Genel olarak araştırma, kütüphanelerin seçimi, iş deneyimine sahip kütüphanecilerin belirtilen kütüphanelerden seçimi nicel çalışmanın yürütülmesi amacıyla anketin uygulanması aşamalarından oluşmaktadır. Araştırma sonuçları halk kütüphanecilerinin bilgi teknolojilerinin gelişiminden doğan mesleki ve kişisel değişikliklerini göstermektedir ve kütüphanecileri değişimin temsilcileri olarak betimlemektedir.

  13. İlköğretim 4. ve 5. Sınıf Öğrencileri Arasındaki Zorbalık Olaylarının Çeşitli Değişkenlere Göre İncelenmesi (Rize İli Örneği Study of Bullying Circumstances Between 4th and 5th Grade Students of Primary Education According to Various Variables (Rize Province Example

    Directory of Open Access Journals (Sweden)

    Yücel ÖKSÜZ

    2012-09-01

    şkin (2002 tarafından geliştirilen “Akran Zorbalığı Anketi” kullanılmıştır. Ayrıca derinlemesine inceleme yapabilmek için 10 öğrenci ile araştırmacılar tarafından geliştirilen 3 açık uçlu soru kullanılarak mülakat yapılmıştır. Verilerin analizinde betimsel istatistikler ve Kay-kare testi kullanılmıştır. Mülakatlardan elde edilen veriler ise nitel araştırma teknikleri kullanılarak analiz edilmiştir. Elde edilen bulgulara göre öğrencilerin büyük çoğunluğunun zorbalık uyguladığı ya da kendilerinin zorba davranışlara maruz kaldığı belirlenmiştir. Öğrencilerin en sık karşılaştıkları zorbalık türünün sözel zorbalık sonrasında fiziksel zorbalık olduğu, hem okul içinde hem de okul dışında daha çok “bir erkek öğrenci” ya da “bir grup erkek öğrenci” ve kendilerinden daha büyük olanlar tarafından zorbalığa maruz kaldıkları, zorbalık olaylarıyla karşılaştıklarında özelikle bir yetişkinden yardım istedikleri veya bu duruma karşılık verdikleri ve “bedensel ve zihinsel jimnastik” ve “bilimsel farkındalık” kategorisindeki sosyal kulüplerin daha çok zorba kurban öğrenciler tarafından tercih edildiği tespit edilmiştir.

  14. Swiss Albino Farelerde Fenpiroksimat (Akarisit’ın Teşvik Ettiği Biyokimyasal Değişime Karşı Fındığın Koruyucu Rolü

    Directory of Open Access Journals (Sweden)

    Kültiğin ÇAVUŞOĞLU

    2017-02-01

    Full Text Available Özet. Fenpiroksimat Tetranychidae, Eriophyiidae ve Tarsonemidae ailelerindeki önemli fitofag akarlarına karşı mücadelede kullanılan pirazol bir akarisittir. Bu çalışmanın amacı, Swiss albino farelerde seçilen biyokimyasal parametreler üzerine Fenpiroksimat akarisitinin toksisitesini değerlendirmek ve bu biyokimyasal değişimlere karşı fındığın koruyucu rolünü araştırmaktır. Fareler rastgele bir (1 kontrol ve üç (3 uygulama olmak üzere toplam dört (4 gruba ayrılmıştır. Deneysel periyodun sonunda, tüm fareler hafif eter anestezisi altında bayıltılmış, biyokimyasal analiz ve ölçümler için kan örnekleri ile karaciğer ve böbrek dokuları elde edilmiştir. Serum Aspartat Aminotransferaz (AST, Alanin Aminotransferaz (ALT, Kan Üre Nitrojen (BUN ve kreatinin seviyeleri ölçülmüş, elde edilen dokularda ise Malondialdehit (MDA ve Glutatyon (GSH seviyeleri analiz edilmiştir. Sonuçta, kontrol grubu ile karşılaştırıldığında Fenpiroksimat uygulanan farelerde GSH seviyelerinde önemli bir azalma (p<0.05, AST, ALT, BUN, kreatinin ve MDA seviyelerinde ise önemli bir artış (p<0.05 görülmüştür. Fenpiroksimat uygulama grubu ile karşılaştırıldığında, Fenpiroksimat ile birlikte fındık uygulaması GSH seviyelerinde tekrar önemli bir artışa (p<0.05, AST, ALT, BUN, kreatinin ve MDA seviyelerinde ise önemli bir azalmaya (p<0.05 neden olmuştur. Sonuç olarak, fındık ile beslemenin Fenpiroksimat tarafından teşvik edilen biyokimyasal hasara karşı önemli bir koruma sağladığı söylenebilir.Anahtar Kelimeler: Albino fare, fenpiroksimat, oksidatif stres, serum parametresi Abstract. Fenpyroximate is a pyrazole acaricide with selective activity against important phytophagous mites in the families’ Tetranychidae, Eriophyiidae, and Tarsonemidae. The goal of this study was to evaluate the toxicity of Fenpyroximate acaricide on selected biochemical parameters in Swiss albino mice. And

  15. CBS Kullanılarak Kıbrıs’ta Fırtına Riski Duyarlılık Analizi Storm Risk Sensitivity Analysis In Cyprus Using GIS

    Directory of Open Access Journals (Sweden)

    Emre ÖZŞAHİN

    2012-12-01

    ılda ortalama 2685 kişi etkilenirken, ekonomik olarak 14.340 milyon dolar zarar yaşanmıştır. Bu afetler içerisinde ise en büyük ekonomik zararı fırtınalar meydana getirmiştir. Yıllık ortalama 0.10 olarak yaşanan fırtınalardan çeşitli yıllarda 40 kişi etkilenirken, 10 milyon dolar ekonomik zarar yaşanmıştır.Bu çalışmada Kıbrıs’taki ülke ekonomilerine çok ciddi manada zarar veren fırtınalar, Coğrafi Bilgi Sistemleri (CBS yöntem ve tekniklerinden yararlanılarak meydana getirebileceği risk kapsamında analiz edilecektir. Acaba Kıbrıs adasında fırtına riskinin boyutları nasıldır? Adadaki hangi alanlar risk altındadır? Bu risk hangi yerleşmeleri en fazla etkileyecektir? Bu kapsamda yapılması gerekenler nelerdir? şeklindeki araştırma sorularına yanıtlar aranacaktır. Çalışmada değişik ölçeklerde ve farklı kaynaklardan elde edilen faktör haritalarından yararlanılmıştır. Bu haritalardan elde edilen jeoloji, jeomorfoloji, eğim, bakı, yağış, akarsuya uzaklık, yeraltı suyu, toprak ve arazi kullanım özelliklerine ait veriler koşullara bağlı ağırlıklı çakıştırma yöntemi ile birleştirilerek, taşkın risk alanları belirlenmiş ve haritalanmıştır.Çalışmanın zarar analizi sonuçlarına göre Kıbrıs’ta, geçmiş yıllarda yaşanmış, günümüz ve gelecekte yaşanabilecek fırtına değerleri geleceğe doğru 24.514.7 oranında artmaktadır. Fırtına risk analizi sonucuna göre ise adanın % 51.19’unun risk altında, % 27.51’ininde risk altında olmadığı anlaşılmıştır. Adada en riskli alanlar Lefkoşa yerleşim merkezi çevresidir. Riskin en az olduğu alanlar ise Girne ve Limasol çevreleri ile Trodos Dağları civarıdır. Bu kapsamda öncelikli olarak multidisipliner bir bilim anlayışıyla daha kapsamlı planlamaların yapılması ve halkın konu hakkında bilinçlendirilmesi gerekmektedir.

  16. Hindistan’da Yabancı Dil Olarak Türkçe Öğrenen Genç-Yetişkinlerin Öğrenme Geçmişlerinin Bazı Değişkenlere Göre İncelenmesi The Investigation Of Learning Histories Of Young-Adult Turkish As A Foreign Language Learners In India According To Some Variables

    Directory of Open Access Journals (Sweden)

    Adem İŞCAN

    2012-12-01

    ışılmıştır. Öğrencilerin bildikleri dillerin dağılımı gösterilmiştir. Yabancı dil olarak Türkçe öğrenen Hindistan’daki öğrencilerin bildikleri yabancı diller sıralamasında Türkçenin durumuna yer verilmiştir.Çalışma betimsel araştırma yöntemlerinden tekil tarama tekniği (ilişkisiz kullanılmıştır. Araştırmanın evrenini Hindistan’da Türkçe öğrenen yabancı uyruklu 110 öğrenci oluşturmaktadır. Araştırmadaki veriler, Buran’ın (2008 “Kırgızistan’daki Dillerin Edinilme ve Öğrenilme Süreçleri” konusunda yapmış olduğu çalışmadaki verilerden esinlenerek araştırmacılar tarafından oluşturulan anket yoluyla toplanmıştır.Araştırmada elde edilen veriler SPSS 16.0 veri analizi programında çözümlenmiştir. Çalışmadan elde edilen bulgulara göre Hindistan’da Türkçenin İngilizceden sonra en çok öğrenilmek istenen yabancı dil olduğu görülmüştür. Ayrıca öğrencilerin dil geçmişleri incelendiğinde Hintçe ve İngilizce dışında en az iki yabancı dil daha bildikleri ortaya çıkmaktadır. Yabancı dil öğrenme sürecini yönlendiren etmenler vardır. Bu etmenler arasında biyolojik koşulları, bilişsel ve duygusal etkenleri, öğretim metodu, sosyal ve çevresel etkenleri sayabiliriz. Bu etkenler ışığında bakıldığında Hindistan’da dil öğretiminin bu etkenlerden olumlu olarak etkilendiği sonucu çıkmaktadır. Bu durum aslında stratejik olarak gelişen Hindistan’ın dil öğrenme konusunda ne kadar ileride olduğunun göstergesidir.

  17. Dichlorvos’un (DDVP Allium cepa L. Kök Ucu Meristem Hücrelerinde Mitoz Bölünme ve Kromozomlar Üzerine Etkileri

    Directory of Open Access Journals (Sweden)

    Hatice Soykan

    2014-06-01

    Full Text Available Özet. Çalışmamızda, DDVP’nin A. cepa’da kök uzunluğu, kök sayısı, mitoz bölünme ve kromozomlar üzerine olan etkileri araştırılmıştır. DDVP’nin 2ml/L, 4ml/L, 6 ml/L dozları 12, 24 ve 48 saat olmak üzere üç farklı süre ile A. cepa bitkisinin köklerine uygulanmıştır. Uygulama sonucu her soğandaki kökler sayılmış ve kök uzunlukları ölçülmüştür. Yapılan değerlendirmeler sonucu kontrol gruplarına göre uygulama gruplarının kök sayısının süreye bağlı olarak azalma gösterdiği görülmüştür. Uygulama gruplarının kök uzunlukları kontrol grupları ile karşılaştırıldıklarında uzunluğun genellikle doz ve süreye bağlı olarak azalma gösterdiği belirlenmiştir. Mikroskobik gözlemler sonucu elde edilen veriler tablolara aktarılmış ve SPSS 12.0 programında yapılan istatistiksel analizler ile sonuçlar değerlendirilmiştir. Elde edilen verilere göre DDVP’nin A.cepa bitkisinin köklerinde mitotik indeksi azalttığı saptanmıştır. Mitotik indeksin azalması süre artışına bağlı bir paralellik gösterirken, doz artışına bağlı bir paralellik göstermemektedir. İnsektisitin A.cepa bitkisinin köklerine uygulanması sonucu kromozomlarda hasarlar meydana gelmiştir. En fazla gözlenen kromozom hasarları yapışkanlık, yanlış kutuplaşma ve fragment oluşumudur. Bundan başka anafaz köprüsü ve mikronükleus oluşumları da görülmüştür. Abstract. In our study, effects of DDVP on A.cepa root length, root number, mitosis and chromosomes are determined.  Different doses of DDVP (2ml/L, 4 ml/L, 6 ml/L were applied to A. cepar oots with three different application periods (12h, 24h, 48h. Roots of tubers were counted and root lengths were measured after applications. Our results show that root numbers of application groups are decreased correlated with application time. When root length of application groups with control group is compared, root length decrease

  18. Seviye Belirleme Sınavlarının Matematik Öğretiminde Karşılaşılan Sorunlara Etkisine İlişkin Öğretmen Görüşleri The View of Mathematics Teachers about Problems Encountered Due to Level Determination Exam

    Directory of Open Access Journals (Sweden)

    İsmail ŞAN

    2013-07-01

    Full Text Available The purpose of this study was determining the views ofmathematics teachers about problems encountered at teaching processdue to the Level Determination Exam. The work group of this study isconstituted of 17 mathematics teachers. In the light of the obtaineddata 4 themes were determined. These themes are declining of academicsuccess and the level of reaching educational goals, increasing the levelof behavioral problems and positive participation to courses. Accordingto the results, Level Determination Exam causes not only decreasing ofsuccess, level of reaching educational goals and positive attendance tocourses but also increasing behavioral problems. The results show thatLDE increases students’ stress level and behavioral problems, makesharder to rise math literate students, clustering the subjects whetherbeing asked or not at LDE. According to results using “Exam BasedLearning Method” until repealing Level Determination Exam, preparingin service education program about mathematics literacy formathematics teachers and cooperation between applied mathematiciansand mathematics teachers about developing exam may help teachers todecrease the problems. Bu çalışmanın amacı, seviye belirleme sınavlarının matematik öğretiminde ne tür sorunlara yol açtığına dair öğretmen görüşlerinin neler olduğunu tespit etmektir. Bu amaçla bağlantılı olarak 21 maddelik bir açık uçlu yazılı anket formu araştırmacı tarafından hazırlanmış ve araştırmacının ulaşabildiği matematik öğretmenlerinden 17 tanesi ankete cevap vermiş olup bu anketler değerlendirmeye alınmıştır. Güvenirlik için araştırmacı ve alan uzmanı tarafından yapılan kodlamalar üzerinde iki kodlayıcı arasında uyuşum yüzdesi % 82 olarak hesaplanmıştır. Bu oran veri analizi açısından güvenirliğin sağlandığını göstermektedir. Elde edilen bulgular ışığında genel başarı düzeyinde düşüş, kazanımlara ulaşma d

  19. Sosyal Bilgiler Öğretmen Adaylarının, Okul Yöneticilerinde Olması Gereken Demokratik Tutum ve Davranışlara İlişkin Algıları Social Studies Teacher Candidates Perceptions of School Principals Should not Have Democratic Attitudes and Behaviours

    Directory of Open Access Journals (Sweden)

    Erol KOÇOĞLU

    2013-07-01

    ırmaktır. Çocuğa bu kimliği kazandırmada öğretmenlere büyük görev düşmektedir. Özellikle demokratik birey yetiştirmeyi temele alan sosyal bilgiler dersi öğretmenlerinin sorumluluğunu bir kat daha arttırmaktadır. Eğitim fakültelerinde de öğrenim gören öğretmen adaylarının bu bilinçle yetiştirilmesi gerekir.Bu çalışmanın amacı, ilköğretim okullarında görev yapan okul yöneticilerinde olması gereken demokratik tutum ve davranışların sosyal bilgiler öğretmen adaylarının görüşleri doğrultusunda değerlendirilmesidir. Okullarda demokratik bir yönetim biçimi, idarecilerde demokratik kişiliklerin var olmasına dayanır. İdarecilerde olması gereken demokratik kişilik, okul yöneticilerinin tutum ve davranışlarını etkilemektedir. Yapılandırmacı öğrenme kuramının uygulandığı ülkemizdeki her eğitim kademesinde görev yapan yönetici veya idareci vasfını taşıyan bireylerin her türlü davranışı okulda yer alan bireyler için model teşkil edip, bireylerin okula bakış açısı üzerinde etkili olmaktadır. Sosyal bilgiler öğretmen adaylarının görüşleri doğrultusunda okul yöneticilerinde olması gereken demokratik anlamdaki niteliklerin değerlendirilmesi çalışmanın temelini oluşturmaktadır. Çalışma da nitel araştırma yöntemi kullanılmış olup, çalışma sonucunda elde edilen veriler içerik analizi tekniği ile analiz edilip, elde edilen veriler sayısallaştırılarak sunulmuştur. Sosyal bilgiler öğretmen adaylarının, okul yöneticilerinde olması gereken demokratik tutum ve davranışlara ilişkin görüşleri, yedi maddelik yapılandırılmış görüşme formuyla belirlenmiştir. Görüşme formunda yer alan açık uçlu sorular uzman görüşü alınarak hazırlanmıştır.

  20. Determination of the Relative Positions of Three Planes: Action Research

    Directory of Open Access Journals (Sweden)

    Tuba Ada

    2016-07-01

    bir ders planının ve öğretim ortamının nasıl sağlanacağını araştırmaktır. Bu amaca ulaşabilmek için araştırmacıların hazırladığı plan dahilinde eylem araştırması yaklaşımı kullanılmıştır. Uygulamanın 1. aşamasında öğretmen adaylarına üç düzlemin denklemleri verilerek düzlemlerin birbirine göre konumlarının belirlenmesi istenmiştir. Bu aşamada öğretmen adayları düzlemlerin birbirine göre konumunu ikişer ikişer düzlem denklemlerini inceleyerek tek yönlü belirlemeye çalışmıştır. Uygulamanın ikinci aşamasında üç bilinmeyenli üç denklemden oluşan lineer denklem sistemlerinin çözümünü bulmaları ve bu çözümü geometrik olarak yorumlamaları istenmiştir.  Bu aşamada ise öğretmen adaylarının bir kısmı denklem sistemini çözdüğü ancak geometrik olarak yorumlayamadığı gözlemlenmiştir. Üçüncü aşamada ise üç düzlemin birbirine göre konumunun görselleştirmesi ve düzlem denklemlerini kullanarak bu düzlemlerin birbirlerine göre konumlarını gözlemleyebilmeleri için bilgisayar cebir sistemlerinden Maple programı kullanılmıştır. Bu aşamada öğretmen adayları düzlem denklemlerinin oluşturduğu denklem sistemlerinin çözüm kümesi ile Maple da elde edilen üç boyutlu görselleri ilişkilendirmişlerdir. Uygulamadan elde edilen bulgulara göre hazırlanan planın matematik öğretmen adaylarının üç düzlemin birbirine göre konumunun görselleştirmesinde olumlu etkisi olmuştur.Anahtar kelimeler: Uzayda düzlemler, analitik geometri, Maple, eylem araştırması

  1. Öğretmen Adaylarının Özyeterlik Algılarının Karşılaştırılması: Müzik, Resim ve Beden Eğitimi Comparison Of Self Efficacy Perceptions Of The Teacher Candidates: Music, Art And Physical Education

    Directory of Open Access Journals (Sweden)

    Hatice EKİNCİ

    2013-03-01

    niversitesi Eğitim FakültesiMüzik, Resim ve Beden Eğitimi Anabilim Dalları’ndaki öğretmenadaylarının özyeterlik algılarını belirlemeyi ve özyeterlik algılarının sınıf,bölüm ve cinsiyet değişkenleri bakımından ilişkilendirmeyiamaçlamaktadır.Müzik, Resim ve Beden Eğitimi Anabilim Dalları’ndaki öğretmenadaylarının özyeterlik algılarının belirlenmesi, meslek yaşamlarındaetkili ve yeterli bir performans sergilemeleri açısından önemlidir. Ayrıcaaraştırmanın, elde edilen sonuçlara yönelik önerileri sunulmasıbakımından önem taşıdığı düşünülmektedir.Araştırma, Mehmet Akif Ersoy Üniversitesi Eğitim FakültesiMüzik, Resim ve Beden Eğitimi ABD’daki Lisans II, III. ve IV. sınıflardaöğrenim gören toplam 224 öğretmen adayı üzerinde yapılmıştır.Araştırmada veri toplama aracı olarak, Tschannen-Moran ve Hoy(2001 tarafından geliştirilen ve Türkçe için geçerlik ve güvenirlikçalışması Çapa, Çakıroğlu ve Sarıkaya (2005 tarafından yapılan veöğretmenlerin öz yeterliklerini nasıl algıladıklarını betimlemeye çalışan,“Öğretmen Özyeterlik Ölçeği” kullanılmıştır.Veriler SPSS (versiyon 20.0 ( SPSS Inc., Chicago, USAkullanılarak analiz edilmiştir. Araştırma bulgularının çözümlenmesindefrekans, yüzde, korelasyon ve manova istatistikleri kullanılmıştır.Araştırmadan elde edilen bulgulara göre, Müzik, Resim ve BedenEğitimi ABD’daki öğretmen adaylarının cinsiyet, sınıf ve bölümdeğişkenlerine göre özyeterlik düzeyleri arasında anlamlı farklılıkbulunmamaktadır. Bunun yanı sıra öğretmen adaylarının % 75oranında kendilerini özyeterli buldukları tespit edilmiştir.

  2. VİRAL PAZARLAMANIN SOSYAL PAYLAŞIM SİTELERİNE ÜYE OLAN KULLANICILAR ÜZERİNDEKİ ETKİSİNİ İNCELEYEN PİLOT BİR ÇALIŞMA - A PILOT STUDY ON EFFECTS OF VIRAL MARKETING ON SOCIAL WEB SITES USERS

    Directory of Open Access Journals (Sweden)

    Serpil ÜNAL

    2011-07-01

    Full Text Available Özet:İnternet kullanımının artması sonucunda önemi artansosyal paylaşım siteleri ile ilginç iletilerin kişiler ya da gruplararasında paylaşımından yararlanan “viral pazarlama”pazarlama literatürüne giren yeni kavramlar arasındadır.Tüketiciler, genellikle arkadaşlarından gelen bir elektronikposta mesajını en güvenilir kaynak olarak gördüklerindenviral kampanyaların sosyal paylaşım sitelerindeki dolaşımıkolaylaşmaktadır. Viral pazarlama, ağızdan ağza iletişiminelektronik şekli olarak tanımlanabilir. Dijital teknolojininyararları sonucunda gelişmiş ve ağızdan ağza iletişimin kritikbir elektronik versiyonu olarak da adlandırılabilir.Bu çalışmanın ana amacı viral pazarlama uygulamalarınınetkinliğini ölçmektir. Araştırma İzmir ili içerisinde çeşitli yaş,meslek ve gelir grubundaki 236 kişi üzerinde viral pazarlamauygulamalarına yönelik yüz yüze anket çalışması ilegerçekleştirilmiştir. Yapılan araştırma sonucundakatılımcıların sosyal paylaşım siteleri içerisinde en çokfacebook ve msn’i kullandıkları, viral kampanyalar içindekomik şakalardan daha fazla etkilendikleri görülmüştür.Ayrıca katılımcıların yaklaşık %64’ünün viralkampanyalardan etkilenerek alışveriş yapması ve %72’sinin debu kampanyaları başkaları ile paylaşmaları araştırmasonucunda elde edilen önemli bir bulgudur. Yapılanistatistiksel analiz sonuçlarına göre, 18-28 yaş dilimindekikatılımcıların, meslek dilimlerinden öğrenci ve serbest meslekgruplarının ve gelir dilimleri daha yüksek olan bireylerin diğergruplara kıyasla e-postalardan daha fazla etkilenerek alışverişyaptıkları saptanmıştır. Kısacası, belirli gruplar için viralpazarlama uygulamalarının oldukça uygun olabileceğiaraştırma sonucunda elde edilen bir bulgudur. Sosyalpaylaşım sitelerinin Türkiye’de kullanımı giderek yaygınlaştığıiçin, viral pazarlama daha

  3. Cinsel Saldırı Olguları İçin Düzenlenen Adli Psikiyatrik Raporların İncelenmesi

    Directory of Open Access Journals (Sweden)

    Ender Şenol

    2016-12-01

    Full Text Available Amaç: Cinsel suçlar, tüm dünyada her yaş grubundaki insanı tehdit eden toplumsal bir sorundur. Cinsel suçların, mağdurda birçok ruhsal hastalığa zemin hazırladığı bilinmektedir. Bu çalışmada, Ruh Sağlığı ve Hastalıkları Anabilim Dalı Erişkin Adli Kurul’da raporları düzenlenen cinsel saldırı mağdurlarının demografik özellikleri, suç konusu olayların özellikleri ve düzenlenen raporların sonuçları değerlendirilerek literatürdeki diğer çalışmalarla karşılaştırılması amaçlandı. Yöntem: Adli Makamlar tarafından 2012 – 2014 yılları arasında … Ruh Sağlığı ve Hastalıkları Anabilim Dalı Erişkin Adli Kurul’a rapor düzenlenmesi nedeniyle dosyası ile birlikte gönderilen olgulara ait kayıtlar; olguların demografik özellikleri, rapor istem makamı, olayın türü ve tarihi, saldırgana ait bilgiler, olguların muayene bulguları ile düzenlenen raporların sonucu açılarından retrospektif olarak incelenerek, elde edilen veriler Windows için SPSS 18 istatistik programı ile değerlendirildi. Bulgular: 01 Ocak 2012 – 31 Aralık 2014 tarihleri arasında rapor düzenlenen 311 olgunun 12’si (%3,9 erkek, 299’u (%96,1 kadındı. Olay tarihindeki yaşları 6 ila 89 arasında ve ortalaması 26,58+12,22 idi. Raporların %37’sinin (n=115 Ağır Ceza Mahkemeleri tarafından istendiği görüldü. Gerçekleştiği beyan edilen cinsel saldırıların %56,9’u (n=177 nitelikli olup, mağdurların %80,7’sinin (n=251 kendisinin şikâyetçi olduğu, saldırganların tümünün erkek olduğu, bunların %70,1’inin (n=218 mağdurun çevresindeki kişilerden olduğu tespit edildi. Olay sonucunda olguların %61,4’ünde (n=191 bir, %34,1’inde (n=106 ise birden fazla psikiyatrik bozukluk meydana geldiği saptandı. Sonuç: Cinsel saldırı mağdurlarında tespit edilen ruhsal rahatsızlıklar ile cinsel saldırıların her yaş grubundaki başta kadın ve çocuklara karşı,

  4. Cerebellar gray matter differentiates children with early language delay in autism.

    Science.gov (United States)

    D'Mello, Anila M; Moore, Dorothea M; Crocetti, Deana; Mostofsky, Stewart H; Stoodley, Catherine J

    2016-11-01

    Early language delay (ELD) is one of the earliest indicators of autism spectrum disorder (ASD), and predicts later cognitive and behavioral outcomes. We aimed to determine the neural correlates of ELD in autism, and examine the relationships between gray matter (GM), age of first word/phrase, and core ASD symptoms. We used voxel-based morphometry to examine whole-brain differences in GM in 8-13 year old children with autism (n = 13 ELD; n = 22 non-ELD) and 35 age-matched typically developing (TD) children. Multiple regression analyses examined the relationships between GM, age of first word/phrase, and autism diagnostic observation schedule (ADOS) scores. Composite age of first word/phrase negatively correlated with GM throughout the cerebellum. Both ASD groups (ELD and non-ELD) had reduced GM in right cerebellar Crus I/II when compared to TD children. Left cerebellar Crus I/II was the only region in the brain that differentiated ELD and non-ELD children, with ELD children showing reduced GM relative to both non-ELD and TD groups. Group×score interactions converged in left Crus I/II, such that the non-ELD group showed poorer ADOS scores with increasing GM, whereas the ELD group showed poorer ADOS scores as GM decreased. Reduced GM in right cerebellar Crus I/I was related ASD diagnosis, while children with ELD showed additional reduced GM in left Crus I/II. These findings highlight the importance of specific cerebellar networks in both ASD and early language development, and suggest that bilateral disruption in cerebellar regions that interconnect with fronto-parietal networks could impact language acquisition in ASD. Autism Res 2016, 9: 1191-1204. © 2016 International Society for Autism Research, Wiley Periodicals, Inc. © 2016 International Society for Autism Research, Wiley Periodicals, Inc.

  5. Öğretmen Adaylarında Okula Yabancılaşma Pre-service Teachers' School Alienation

    Directory of Open Access Journals (Sweden)

    Öznur ATAŞ

    2013-09-01

    sense of school alienation. Bu araştırmada öğretmen adaylarının çeşitli boyutlardaki okula yabancılaşma algılarının ve yabancılaşma düzeylerini etkileyen değişkenlerin belirlenmesi amaçlanmıştır. Araştırmada, bu amaca yönelik olarak betimsel tarama modeli uygulanmıştır. Araştırmanın evrenini Atatürk Üniversitesi Kazım Karabekir Eğitim Fakültesi öğrencileri oluşturmaktadır. Araştırmanın örneklemini ise 2011-2012 öğretim yılında Atatürk Üniversitesi Kazım Karabekir Eğitim Fakültesinin çeşitli bölüm ve sınıflarında öğrenim gören 680 öğrenci oluşturmaktadır. Araştırma verileri Fakülte Yabancılaşma Ölçeği ile elde edilmiştir. Elde edilen veriler SPSS programında çözümlenmiştir. Öğretmen adaylarının okula yabancılaşma düzeylerinin cinsiyet ve bölüm seçme kararı değişkenlerine göre farklılaşıp farklılaşmadığının belirlenmesinde t-testi; bölüm, sınıf, öğretim elemanlarıyla ilişki, sınıf arkadaşlarıyla ilişki ve sosyal etkinliklere katılım değişkenlerine göre farklılaşıp farklılaşmadığını belirlemek için tek yönlü varyans analizi (ANOVA kullanılmıştır. Araştırmadan elde edilen bulgulara göre, erkek öğrenciler kız öğrencilere kıyasla; bölümünü başkalarının etkisiyle seçenler kendi isteğiyle seçenlere göre okula daha fazla yabancılaşmışlardır. Ayrıca Ortaöğretim Fen ve Matematik Alanları Eğitimi Bölümü ve son sınıf öğrencilerinin daha fazla yabancılaşma duygusu yaşadıkları ortaya çıkmıştır. Öğretim elemanlarıyla ve sınıf arkadaşlarıyla zayıf düzeyde ilişkisi olan ve sosyal etkinliklere hiç katılmayan öğrencilerin okula daha fazla yabancılaştıkları bulunmuştur. Sonuç olarak; bu araştırmaya göre öğretmen adaylarının cinsiyetleri, bölüm seçme kararları, öğretim elemanlarıyla ve sınıf arkadaşlarıyla ilişki düzeyleri ve sosyal etkinliklere katılım s

  6. Öğretmenlerin Basılı Sayfa ve Ekrandan Okuma Tercihleri İle Eğitimde Elektronik Metin Kullanımına Yönelik Görüşleri On-Printed Page And Screen Reading Preferences Of Teachers’ With Their Views On The Use Of Electronic Text In Education

    Directory of Open Access Journals (Sweden)

    Abdullah DAĞTAŞ

    2013-03-01

    nceveriler kodlanmış, ardından verileri genel düzeyde açıklayan kategoriler(temalar belirlenmiştir. Kategorilerin belirlenmesinde ilgili alanyazın,mülâkat soruları ve öğretmenlerin sorulara verdikleri cevaplardanyararlanılmıştır. Verilerin çözümlenmesi sonucu, altı ana kategorialtında on iki alt kategori tespit edilmiş, bu alt kategorilere ait kodlaraltında da elde edilen bulgular sıralanmıştır. Elde edilen bulgularadayanarak öğretmenlerin büyük bir çoğunluğu, genelde bir metniekrandan okumaktan ziyade basılı sayfadan okumayı tercih etmektedir.Ayrıca öğretmenler, eğitimde elektronik metin kullanımına yönelik hemolumlu hem de olumsuz görüşlere sahiptir.

  7. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus ...

  8. The Origin and Structure of the Magnetic Fields and Currents of AGN Jets

    Directory of Open Access Journals (Sweden)

    Denise Gabuzda

    2017-02-01

    Full Text Available This paper reviews observational evidence obtained to date about the overall structure of the magnetic fields in the jets of Active Galactic Nuclei (AGN. Because they are sensitive to the line-of-sight magnetic-field component, Faraday rotation observations of AGN jets provide an effective tool for searching for toroidal jet magnetic fields, whose line-of-sight component changes systematically across the jet. Transverse Faraday rotation measure (RM gradients providing direct evidence for helical/toroidal magnetic fields have been reliably detected in nearly 40 AGN on parsec scales. Helical magnetic fields are believed to form due to the combined action of the rotation of the central black hole and accretion disk, and these observations demonstrate that at least some of this helical field survives to distances well beyond the Very Long Baseline Interferometry (VLBI core. Observations of reversals in the direction of the transverse RM gradients in a number of AGN provide evidence for a“return”magnetic field forming a nested helical-field structure with oppositely directed azimuthal components in the inner and outer regions of the helical magnetic field. The collected data now provide firm evidence for a predominance of inward jet currents on parsec scales and outward currents on scales greater than a few tens of parsecs. This suggests a global pattern of magnetic fields and currents with an inward current near the jet axis and an outward current farther from the jet axis, with these currents closing in the accretion disk and far out in the radio lobes, forming a self-consistent set of fields and currents together with the implied nested helical-field structure.

  9. Electric Field Structures in Thin Films: Formation and Properties

    DEFF Research Database (Denmark)

    Cassidy, Andrew; Plekan, Oksana; Balog, Richard

    2014-01-01

    by combining layers of different spontelectric materials. This is demonstrated using the spontelectric materials nitrous oxide, toluene, isoprene, isopentane, and CF2Cl2. These yield a variety of tailored electric field structures, with individual layers harboring fields between 107 and 108 V/m. Fields may......A newly discovered class of molecular materials, so-called “spontelectrics”, display spontaneous electric fields. Here we show that the novel properties of spontelectrics can be used to create composite spontelectrics, illustrating how electric fields in solid films may be structured on the nanoscale...

  10. Elotuzumab plus lenalidomide/dexamethasone for relapsed or refractory multiple myeloma: ELOQUENT-2 follow-up and post-hoc analyses on progression-free survival and tumour growth.

    Science.gov (United States)

    Dimopoulos, Meletios A; Lonial, Sagar; White, Darrell; Moreau, Philippe; Palumbo, Antonio; San-Miguel, Jesus; Shpilberg, Ofer; Anderson, Kenneth; Grosicki, Sebastian; Spicka, Ivan; Walter-Croneck, Adam; Magen, Hila; Mateos, Maria-Victoria; Belch, Andrew; Reece, Donna; Beksac, Meral; Bleickardt, Eric; Poulart, Valerie; Sheng, Jennifer; Sy, Oumar; Katz, Jessica; Singhal, Anil; Richardson, Paul

    2017-09-01

    The randomized phase III ELOQUENT-2 study (NCT01239797) evaluated the efficacy and safety of elotuzumab + lenalidomide/dexamethasone (ELd) versus lenalidomide/dexamethasone (Ld) in relapsed/refractory multiple myeloma. ELd reduced the risk of disease progression/death by 30% versus Ld (hazard ratio [HR] 0·70). Median time from diagnosis was 3·5 years. We present extended 3-year follow-up data. Endpoints included progression-free survival (PFS), overall response rate (ORR) and interim overall survival (OS). Exploratory post-hoc analyses included impact of time from diagnosis and prior lines of therapy on PFS, and serum M-protein dynamic modelling. ORR was 79% (ELd) and 66% (Ld) (P = 0·0002). ELd reduced the risk of disease progression/death by 27% versus Ld (HR 0·73; P = 0·0014). Interim OS demonstrated a trend in favour of ELd (P = 0·0257); 1-, 2- and 3-year rates with ELd versus Ld were: 91% versus 83%, 73% versus 69% and 60% versus 53%. In patients with ≥ median time from diagnosis and one prior therapy, ELd resulted in a 53% reduction in the risk of progression/death versus Ld (HR 0·47). Serum M-protein dynamic modelling showed slower tumour regrowth with ELd. Adverse events were comparable between arms. ELd provided a durable and clinically relevant improvement in efficacy, with minimal incremental toxicity. © 2017 John Wiley & Sons Ltd.

  11. Extended line defects in BN, GaN, and AlN semiconductor materials: Graphene-like structures

    Science.gov (United States)

    Camacho-Mojica, Dulce C.; López-Urías, Florentino

    2016-05-01

    The extended line defect (ELD) mimicking grain boundaries in two-dimensional systems is theoretically investigated in BN, GaN, and AlN semiconductor materials with a single layer honeycomb structure. The ELD consists of octagonal-square membered rings. Density functional calculations of the electronic density of states, scanning tunneling microscopy and transmission electron microscopy image simulations are analyzed. Our results revealed that the ELDs are stable in all considered monolayers. In addition, electronic density of states calculations demonstrated that in gap states are emerged when ELD is incorporated into the honeycomb structures. Finally, results on armchair nanoribbons with bare-edges and hydrogenated edges are discussed.

  12. Career concerns incentives: An experimental test

    DEFF Research Database (Denmark)

    Koch, Alexander; Morgenstern, Albrecht; Raab, Philippe

    2009-01-01

    Holmström's (1982/99) career concerns model has become a workhorse for analyzing agency issues in many elds. The underlying signal jamming argument requires players to use information in a Bayesian way, which is difficult to directly test with eld data: typically little is known about the informa......Holmström's (1982/99) career concerns model has become a workhorse for analyzing agency issues in many elds. The underlying signal jamming argument requires players to use information in a Bayesian way, which is difficult to directly test with eld data: typically little is known about...

  13. Attitudes of nursing staff towards involvement in medical end-of-life decisions: a national survey study.

    Science.gov (United States)

    Albers, Gwenda; Francke, Anneke L; de Veer, Anke J E; Bilsen, Johan; Onwuteaka-Philipsen, Bregje D

    2014-01-01

    To investigate nursing staff attitudes towards involvement and role in end-of-life decisions (ELDs) and the relationships with sociodemographic and work-related characteristics. Survey study among nationally representative Dutch research sample consisting of care professionals. Nursing staff working in hospitals, home care, nursing homes or homes for the elderly were sent ELD-questionnaire. 66% (n=587). Most respondents had been involved in ELD. Three quarters wanted to be involved in whole ELD process; 58% agreed that decisions to withhold/withdraw treatment ought to be discussed with the nurses involved; 64% believed patients would talk rather to nurses than physicians; 72% thought physicians are usually prepared to listen to nurses' opinions. Hospital and highly educated nursing staff indicated relatively more often that they want to be involved in ELD. Majority of nursing staff want to be involved in ELD. Work setting and educational level are determining factors in attitudes of nursing staff regarding involvement in ELD. Awareness on the important role nurses have and want to have in ELD should be raised, and taken into account in trainings on end-of-life care for nurses and physicians and development of guidelines for communication about ELD between patients, nursing staff and physicians. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  14. Y Kuşağı Turistlerin Destinasyon İmaj Algıları Üzerine Bir Araştırma A Research On Generation Y Tourists Perceptions Of Destination Image

    Directory of Open Access Journals (Sweden)

    Aslı ALBAYRAK

    2013-07-01

    şağı turistlerin tatil yerlerine karar vermeleri üzerine destinasyon imajını oluşturan faktörlerin etkisini saptamak ve Y kuşağı turistlerin yapısal özellikleri ile destinasyon algıları arasındaki ilişkiyi inceleyerek söz konusu kuşak için destinasyon pazarlamasına ilişkin önerilerde bulunmak amacıyla yapılmıştır.Çalışmada nicel araştırma yöntemlerinden anket tekniğinden yararlanılmış, İstanbul’da bu kuşağı temsil eden ve kota örnekleme yöntemiyle belirlenen 384 kişiyle yüz yüze anket çalışması yapılmıştır. Elde elde verilerin analizinde betimsel istatistik, t-testi ve Anova Analizi kullanılmıştır.Araştırmanın sonuçlarına göre destinasyon imajı katılımcıların cinsiyetlerine, eğitim durumlarına ayrıca gelir düzeylerine göre farklılık göstermektedir. Diğer yandan, Y Kuşağı turistlerinin dinlenme, eğlenme ve yeni yerler görme isteği ile hareket ettikleri, kalite ve lüks bir tatili uygun fiyata arayan bireylerden oluştuğu söylenebilir.Turistik satın alma süreci birçok faktörün etkisiyle şekillenmektedir. Bu süreci etkileyen faktörlerden birisi de destinasyon imajıdır. En genel tanımıyla destinasyon imajı bireylerin bir yer hakkındaki genel algılarıdır ve bu algılar yaş, eğitim, gelir, kültür gibi bir çok faktörden etkilenmektedir. Geçmişte turistlerin destinasyon tercihleri ile ilgili çeşitli çalışmalar yapılmış ve bu çalışmalarda genel olarak turistlerin yaş, eğitim, kültür, gelir gibi özelliklerinin destinasyon imaj algıları üzerine etkileri incelenmiştir ancak farklı kuşakların destinasyon imaj algıları ile ilgili herhangi bir çalışmaya rastlanmamıştır. Bu nedenle bu çalışma sonucunda elde edilen sonuçların turizm pazarlamacılarına katkı sağlayabileceği düşünülmüştür.

  15. Bazı Üvez Türlerinde Değişik Katlama Süreleri ve Ekim Zamanlarının Çimlenme Oranına Olan Etkileri

    Directory of Open Access Journals (Sweden)

    A Gezer

    2009-04-01

    Full Text Available Bu çalışmada, Akçaağaç Yapraklı Üvez [Sorbus torminalis (L. Crantz], Dişbudak Yapraklı Kuş Üvezi ( Sorbus aucuparia L. ve Ak Üvez ( Sorbus persica Hedl.'de beş farklı katlama işlemi kombinasyonu [90 gün oda sıcaklığında kuru saklama (işlem 1, 60 gün sıcak-ıslak + 30 gün soğuk-ıslak katlama (işlem II, 30 gün sıcak-ıslak + 60 gün soğuk-ıslak katlama(işlem III, 15 gün sıcak-ıslak+ 75 gün soğuk-ıslak katlama (işlem IV, 90 gün soğuk-ıslak katlama (işlem V] ve dört farklı ekim zamanının (15 ekim-15 aralık 2003, 15 şubat-15 nisan 2004 tohumun çimlenme oranına olan etkileri incelenmiştir. Ayrıca, orman yetiştirme çalışmaları açısından önem taşıyan bazı tohum özellikleri de belirlenmiştir. Katlama işlem kombinasyonları laboratuar ve iklimlendirme dolabında; ekim zamanı işlemleri ise Eğirdir Orman Fidanlığı'nda gerçekleştirilmiştir. Katlama ve ekim zamanı denemeleri “Tesadüf Parselleri Deneme Deseni” ne uygun olarak kurulmuştur. Bunlardan katlama denemesi 4, ekim zamanı denemesi ise 3 yinelemeli olarak uygulanmıştır. Tohumlara uygulanan katlama işlem kombinasyonları ve ekim zamanı işlemleri sonucunda elde edilen çimlenme verileri “SPSS İstatistik Paket Programı”nda değerlendirilmiştir. Yapılan Varyans Analizi ve Duncan Testi sonuçlarına göre; ekimden önce uygulanan değişik katlama işlem kombinasyonlarının çimlenme oranları arasında anlamlı (P<0.001 farklılıklar ortaya çıkmıştır. Buna göre; Katlama işlemi kombinasyonlarında en yüksek çimlenme oranları (%64,9 ve %56,8 işlem V ve işlem IV'den elde edilmiştir. Diğer 3 katlama işlem kombinasyonlarından çok düşük çimlenme oranı elde edilmiştir. Aynı şekilde ekim zamanı işlemleri arasında da çimlenme oranları bakımından anlamlı (P<0.001 farklılıklar tespit edilmiştir. Uygun ekim zamanı tespit denemesinde, en yüksek çimlenme oranları (%68,811 ve %39

  16. Phases, levels and circles in policy development: the cases of higher education and environmental quality assurance

    NARCIS (Netherlands)

    Huitema, D.; Jeliazkova, Margarita I.; Westerheijden, Donald F.

    2002-01-01

    This article examines parallel developments in the 1elds of quality assurance in higher education and in environmental policy. Starting from empirically grounded analytical frameworks for the two 1elds separately, Fischer’s framework of policy argumentation is overlaid on both to gain deeper

  17. PREVALENCE OF RICE BLAST AND VARIETAL

    African Journals Online (AJOL)

    search-screening site grown to an improved vari- ety, Tox 3050, was heavily blasted. There was no blast incidence at Damongo. in Upper East. Region, there was severe incidence of blast in farmers' fields at Bawku and PVS nurseries and farmers' fields at Nyorigu. There was no blast at. Manga, Navrongo, Tono, Sandema, ...

  18. Supercooling across first-order phase transitions in vortex matter

    Indian Academy of Sciences (India)

    ... larger when is lowered at constant compared to the case when is lowered at constant . We discuss the effect of isothermal field variations on metastable supercooled states produced by field-cooling. This path dependence is not a priori applicable to metastability caused by reduced diffusivity or hindered kinetics.

  19. Pharmacogenetics of psychotropic drugs

    National Research Council Canada - National Science Library

    Lerer, Bernard

    2002-01-01

    ... of pharmacogenetics with substance dependence and brain imaging, and consider the impact of pharmacogenetics on the biotechnology and pharmaceutical industries. This book defines the young field of pharmacogenetics as it applies to psychotropic drugs and is, therefore, an essential reference for all clinicians and researchers working in this findings field. Bernard ...

  20. Comment on magnetism and superconductivity in rutheno cuprates ...

    Indian Academy of Sciences (India)

    The magnetoresistance (MR) is negative above the Ru magnetic ordering temperature at 135 K. Below the Ru magnetic ordering temperature, MR displays a positive peak at low fields and becomes negative at higher fields for Ru-1212. For Ru-1222, MR remains negative both above and below the ordering temperature.

  1. Evaluation of the performance of different firefly algorithms to the ...

    African Journals Online (AJOL)

    Researchers have shown interest in utilizing metaheuristic methods to solve complex optimization problems in real life applications. In this paper, three alternatives of firefly algorithms are applied to solve the nonlinear ELD problem. A comparative study is carried out on the solution of ELD problem using those recent ...

  2. Of light, of MEMS: Optical MEMS in telecommunications and beyond

    Indian Academy of Sciences (India)

    The burst of the Internet bubble in 2000 has severely quenched the pace of development in the optical MEMS field. However, it is now clear that this field is again set to move forward as not only telecommunication but many other industries are benefiting from its application. We describe in this paper some of our latest ...

  3. Parametric instabilities in magnetized bi-ion and dusty plasmas

    Indian Academy of Sciences (India)

    The excitation of low frequency modes of oscillations in a magnetized bi-ion or dusty plasma with parametric pumping of the magnetic field is analysed. The equation of motion governing the perturbed plasma is derived and parametrically excited transverse modes propagating along the magnetic field are found.

  4. Electric field generated solitons, disclinations and vortical flows in ...

    Indian Academy of Sciences (India)

    We present the results of optical studies on the instabilities in a substrate-free nematic 8CB film, subject to an in-plane electric field. The initial director field involves a -1/2 strength disclination loop, separating the central pseudoisotropic zone from the splay-bend (SB) birefringent boundary. Three regimes of sample ...

  5. Bianchi type-V string cosmological models in general relativity

    Indian Academy of Sciences (India)

    Bianchi type-V string cosmological models in general relativity are investigated. To get the exact solution of Einstein's field equations, we have taken some scale transformations used by Camci et al [Astrophys. Space Sci. 275, 391 (2001)]. It is shown that Einstein's field equations are solvable for any arbitrary cosmic scale ...

  6. Mirrorless lasers

    Indian Academy of Sciences (India)

    Abstract. Experimental realization of mirrorless lasers in the last decade have resulted in hectic activity in this field, due to their novelty, simplicity and ruggedness and their great potential for application. In this article, I will review the various developments in this field in roughly chronological order, and discuss some possible ...

  7. Star products from commutative string theory

    Indian Academy of Sciences (India)

    A boundary-state computation is performed to obtain derivative corrections to the Chern–Simons coupling between a -brane and the RR gauge potential -3. We work to quadratic order in the gauge field strength , but all orders in derivatives. In a certain limit, which requires the presence of a constant -field ...

  8. Chandrasekhar–Kendall functions in astrophysical dynamos

    Indian Academy of Sciences (India)

    Some of the contributions of Chandrasekhar to the field of magnetohydrodynamics are highlighted. Particular emphasis is placed on the Chandrasekhar–Kendall functions that allow a decomposition of a vector field into right- and left-handed contributions. Magnetic energy spectra of both contributions are shown for a new ...

  9. Coupled Atom-Polar Molecule Condensate Systems: A Theoretical Adventure

    Science.gov (United States)

    2014-07-14

    proportional to the laser �eld and the free-bound FC factor. Simultaneously, a series of laser �elds of (molecular) Rabi frequency i (i 2) are applied to...experimental e¤orts focused mainly on solid 4He [53]. The interest in the formation of supersolid in continuous (as oppose to lattice ) ultracold atom models

  10. Renormalized energy-momentum tensor of λΦ4 theory in curved ...

    Indian Academy of Sciences (India)

    Divergenceless expression for the energy-momentum tensor of scalar field is obtained using the momentum cut-off regularization technique. We consider a scalar field with quartic self-coupling in a spatially flat (3+1)-dimensional Robertson–Walker space-time, having arbitrary mass and coupled to gravity. As special cases ...

  11. Dynamics of cascade three-level system interacting with the ...

    Indian Academy of Sciences (India)

    For the semiclassical model, it is found that if the atom is initially in the middle level, the time-dependent populations of the upper and lower levels are always equal. This dynamical symmetry exhibited by the classical field is spoiled on quantization of the field mode. To reveal this non-classical effect, a Euler matrix formalism ...

  12. Probing magnetochirality

    Indian Academy of Sciences (India)

    Magnetochiral anisotropy refers to the phenomenon that when light is passed through a chiral medium placed in an external magnetic field, the refractive index, or equivalently, the absorption encountered by the light differs depending on whether it travels parallel or antiparallel to the magnetic field. It is a very small effect, ...

  13. A high-order finite-difference linear seakeeping solver tool for calculation of added resistance in waves

    DEFF Research Database (Denmark)

    Amini Afshar, Mostafa; Bingham, Harry B.; Read, Robert

    potential ow forward-speed hydrodynamic problems; namely the steady, radiation and diraction problems. The near-eld formulation of the wave drift force has also been implemented, and development is under way to include far-eld methods. This paper presents validation results based on analytical solutions...

  14. What Our Hands Say: Exploring Gesture Use in Subgroups of Children with Language Delay

    Science.gov (United States)

    O'Neill, Hilary; Chiat, Shula

    2015-01-01

    Purpose: The aim of this study was to investigate whether children with receptive-expressive language delay (R/ELD) and expressive-only language delay (ELD) differ in their use of gesture; to examine relationships between their use of gesture, symbolic comprehension, and language; to consider implications for assessment and for the nature of…

  15. Concept of multipole magnetic field rotation in ECRIS

    Indian Academy of Sciences (India)

    ... the feasibility of achieving a rotating magnetic multipole field is discussed to some extent. And it is seen that it is not beyond the capability of the scientific community in the present scenario of the advanced technology. Presently, it can be achieved for lesser field and slightly larger size of the multipole electromagnet and ...

  16. Connections between quantum chromodynamics and condensed ...

    Indian Academy of Sciences (India)

    Recently some of the analyses that originated in condensed matter physics have found applications in QCD. Using examples we discuss some of the connections between the two fields and show how progress can be made by exploiting this connection. Some of the challenges that remain in the two fields are quite similar.

  17. Microwave absorption studies of MgB 2 superconductor

    Indian Academy of Sciences (India)

    Microwave absorption studies have been carried out on MgB2 superconductor using a standard X-band EPR spectrometer. The modulated low-field microwave absorption signals recorded for polycrystalline (grain size ∼ 10m) samples suggested the absence of weak-link character. The field dependent direct microwave ...

  18. The labelling and reporting of euthanasia by Belgian physicians: a study of hypothetical cases

    NARCIS (Netherlands)

    Smets, T.; Cohen, J.; Bilsen, J.; van Wesemael, Y.; Rurup, M.L.; Deliens, L.

    2012-01-01

    Background: Belgium legalized euthanasia in 2002. Physicians must report each euthanasia case to the Federal Control and Evaluation Committee. This study examines which end-of-life decisions (ELDs) Belgian physicians label 'euthanasia', which ELDs they think should be reported and the physician

  19. Theory of non-hermitian localization in one dimension: Localization ...

    Indian Academy of Sciences (India)

    We recall some basic aspects of the pinning of flux lines in a superconducting cylindrical shell subjected to a depinning magnetic field, as well as its description by the quantum mechanics of a disordered ring with an imaginary vector potential proportional to the depinning field (N Hatano and D R Nelson, Phys. Rev. B56 ...

  20. Invasive Plants Field and Reference Guide: An Ecological Perspective of Plant Invaders of Forests and Woodlands

    Science.gov (United States)

    Cynthia Huebner; Cassandra Olson; Heather Smith

    2005-01-01

    There are many field guides available about invasive plants and their identification. The purpose of this particular field guide is to give a scientific synthesis of what is known about the behavior of such species in managed, disturbed, and pristine forested systems in addition to key information for accurate identifi...

  1. Nonlinear wave propagation through a ferromagnet with damping in ...

    Indian Academy of Sciences (India)

    We investigate how dissipation and nonlinearity can affect the electromagnetic wave propagating through a saturated ferromagnet in the presence of an external magnetic field in (2+1) dimensions. The propagation of electromagnetic waves through a ferromagnet under an external magnetic field in the presence of ...

  2. Radial oscillations of neutron stars in strong magnetic fields

    Indian Academy of Sciences (India)

    The eigen frequencies of radial pulsations of neutron stars are calculated in a strong magnetic field. At low densities we use the magnetic BPS equation of state (EOS) similar to that obtained by Lai and Shapiro while at high densities the EOS obtained from the relativistic nuclear mean field theory is taken and extended to ...

  3. Environmental liability and nature protection areas Will the EU Environmental Liability Directive actually lead to the restoration of damaged natural resources?

    NARCIS (Netherlands)

    Broek, G.M. van den

    2009-01-01

    The EU Environmental Liability Directive (ELD) requires remedial measures when environmental damage to protected species and natural habitats occurs. Thus, the ELD offers a minimum level of protection to natural resources in its Article 2. In order to finance the restoration of environmental damage

  4. On Bianchi-I cosmic strings coupled with Maxwell fields in bimetric ...

    Indian Academy of Sciences (India)

    Axially symmetric Bianchi-I model is studied with source cosmic cloud strings coupled with electromagnetic field in Rosen's bimetric theory of relativity and observed that there is no contribution from cosmic strings and Maxwell fields in this theory.

  5. A combinatorial wind field model

    DEFF Research Database (Denmark)

    Soleimanzadeh, Maryam; Wisniewski, Rafal; Sloth, Christoffer

    2010-01-01

    This report is the deliverable 2.4 in the project Distributed Control of Large-Scale Oshore Wind Farms with the acronym Aeolus. The objective of this deliverable is to provide an understanding of the wind eld model and dynamic variations superimposed on the mean eld. In this report a dynamical mo...

  6. Trends in End-of-Life Decision Making in Patients With and Without Cancer

    NARCIS (Netherlands)

    Pardon, K.; Chambaere, K.; Pasman, H.R.W.; Deschepper, R.; Rietjens, J.; Deliens, L.

    2013-01-01

    Purpose: Because of cancer's high symptom burden and specific disease course, patients with cancer are more likely than other patients to face end-of-life decisions that have possible or certain life-shortening effects (ELDs). This study examines the incidence of ELDs in patients with cancer

  7.  Topological quantum field theory: 20 years later

    DEFF Research Database (Denmark)

    Reshetikhin, Nicolai

    2008-01-01

    This article is an overview of the developments in topological quantum field theory, and, in particular on the progress in the Chern–Simons theory.......This article is an overview of the developments in topological quantum field theory, and, in particular on the progress in the Chern–Simons theory....

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    On the invariance properties of the Klein–Gordon equation with external electromagnetic field · N D Sen Gupta ... A relativistic mean-field study of magic numbers in light nuclei from neutron to proton drip-lines · T K Jha M S ... Field theoretic calculation of energy cascade rates in non-helical magnetohydrodynamic turbulence.

  9. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Bianchi Type-II inflationary models with constant deceleration parameter in general relativity · C P Singh S Kumar · More Details Abstract Fulltext PDF. Einstein's field equations are considered for a locally rotationally symmetric Bianchi Type-II space–time in the presence of a massless scalar field with a scalar potential.

  10. Laser Plasmas: Density oscillations in laser produced plasma ...

    Indian Academy of Sciences (India)

    ... laser intensity in the absence and presence of magnetic field shows appearance of different threshold intensity of laser corresponding to each magnetic field at which this instability or density fluctuation sets on. This instability has been identified as a large Larmor radius instability instead of classical Rayleigh-Taylor (R-T) ...

  11. Experimental investigation of ultrasonic velocity anisotropy in ...

    Indian Academy of Sciences (India)

    ... weak as the transverse component of the particle/cluster moment is larger than the longitudinal one and the system reaches saturation even at low field. These observed variations in the field-induced anisotropy are analysed by incorporating the moment distribution of particles in Tarapov's theory (J. Magn. Magn. Mater.

  12. Incentives and Social Relations in the Workplace

    NARCIS (Netherlands)

    J. Sol (Joeri)

    2011-01-01

    textabstractIn this thesis, I study how organizations can incentivize a group of individuals, both in theory and by conducting …eld experiments. The …eld experiments introduce short-term team incentives in a randomly selected sample of stores that belong to a single Dutch retail chain of 128

  13. Robbers or Rebels?: Understanding the Role of Greed and ...

    African Journals Online (AJOL)

    ... it may be explained by opportunities such as resource predation and geography of the area. Drawing largely from fi eld research on social entrepreneurship and reconciliation in Burundi, as well as from extensive fi eld knowledge and a review of academic literature, this article addresses theoretical analysis of rebellion in ...

  14. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    We present a realistic scenario of tracking of scalar fields with varying equation of state. The astrophysical constraints on the evolution of scalar fields in the physical universe are discussed. The nucleosynthesis and the galaxy formation constraints have been used to put limits on and estimate during cosmic evolution.

  15. Final Report. Grant DOE DE-FG02-04ER54768

    Energy Technology Data Exchange (ETDEWEB)

    Betti, Riccardo [Univ. of Rochester, NY (United States)

    2016-01-11

    The magnetized spherical implosion campaign funded by this grant is summarized in this progress report. The main goal of this grant was to improve the seed eld generator MIFEDS (Magneto- Inertial Fusion Energy Delivery System) on the OMEGA laser to enable experiments at high elds (> 8 T) and to carry out magnetized spherical implosion experiments to study the e ect of magnetic elds on the fusion yield. New experiments were carried out in the last budget period to study the e ect of higher elds and shaped laser pulses. These new experiments improved the magnetized implosion database and allowed us to improve the con dence of our conclusions with respect to the e ect of magnetic elds on implosion performance. The main conclusion is that adding magnetic eld leads to a 30% higher neutron yield, but using seed magnetic eld higher than 8 T does not further increase the neutron yield. A further conclusion is that the yield enhancement due to the magnetic eld is approximately independent of the laser pulse shape.

  16. Meslek lisesi öğretmenlerinin mesleki tükenmişlik düzeylerinin incelenmesi [Investigating the professional burnout levels of vocational high school teachers

    Directory of Open Access Journals (Sweden)

    Atilla ERKUL

    2014-10-01

    Full Text Available Bu araştırmada meslek lisesi öğretmenlerinin tükenmişlik düzeyleri tükenmişlik alt boyutlarında; branş, mesleki kıdem, öğrenim durumu, cinsiyet, medeni durum ve öğretmenlik mesleğini isteyerek seçip seçmemeleri değişkenlerine göre incelenmiştir. Araştırmanın evrenini 2011–2012 eğitim-öğretim döneminde İstanbul ili Şişli İlçesinde Meslek liselerinde görev yapan 542 öğretmen oluşturmaktadır. Araştırmanın örneklemini ise bu okullardan araştırmaya gönüllü olarak katılan 215 öğretmen oluşturmaktadır. Araştırmada öğretmenlerin tükenmişlik düzeylerini belirlemek üzere, Maslach Tükenmişlik Envanteri ve Kişisel Bilgi Formu kullanılmıştır. Elde edilen verilerin istatistiksel analizinde, aritmetik ortalama, t-testi ve tek yönlü varyans analizi (ANOVA kullanılmıştır. Araştırma bulgularına göre en fazla tükenmişlik “Duygusal Tükenme” alt boyutunda görülmektedir. Bu boyutu sırası ile “Kişisel başarı” ve “Duyarsızlaşma” boyutları takip etmektedir. Araştırmada cinsiyet ve branş değişkenlerine göre, duyarsızlaşma ve kişisel başarı alt boyutlarında anlamlı bir farklılık bulunmazken; duygusal tükenme boyutunda anlamlı farklılık saptanmıştır. Buna göre kadın öğretmenlerin erkek öğretmenlere göre; kültür dersi öğretmenlerinin meslek dersi öğretmenlerine göre daha fazla duygusal tükenme yaşadığı görülmektedir. Araştırmada mesleğini istemeden seçen öğretmenlerin mesleği isteyerek seçenlere göre daha fazla duygusal tükenme ve duyarsızlaşma yaşadığı saptanmıştır. Araştırmada ayrıca öğretmenlerin tükenmişlik alt boyutlarında medeni durum, eğitim düzeyi ve kıdem değişkenlerine göre tükenmişlik düzeylerinin anlamlı düzeyde farklılık göstermediği belirlenmiştir.

  17. Bir Eğitim Teknolojisi Araştırmasına Dayalı Olarak Karma Yöntem Araştırması Deneyimi

    Directory of Open Access Journals (Sweden)

    Mehmet Fırat

    2014-03-01

    Full Text Available Karma yöntem araştırmaları, araştırma yöntemlerinin sınıflandırılmasında ayrı bir kategori olarak ele alınan ve yükselen bir araştırma paradigması özelliğindedir. Bununla birlikte, alanyazındaki araştırmalardan karma yöntem araştırmalarının anlaşılmasında ve uygulanmasında çeşitli sorunlar olduğu vurgulanmaktadır. Eğitim teknolojileri disiplinlerarası bir alan olduğundan, doğası gereği karma yöntem araştırmalarına geniş bir çerçeve sunmaktadır. Bu çalışmada, eğitim teknolojisi alanında karma araştırma yönteminde desenlenen bir araştırmaya dayalı olarak elde edilen karma desen deneyimlerinin paylaşılması amaçlanmıştır. Çalışma, karma yönteme ilişkin sorular biçiminde düzenlenen alt başlıklar ile eğitim teknolojilerinde gerçekleştirilen bir doktora tezi kapsamında bu sorulara verilen cevaplar kapsamında sunulmuştur. Buna bağlı kalınarak çalışmada, belirtilen araştırmaya dayalı olarak öncelikle kavramsal açıdan karma yöntem araştırması irdelenmiş ve bu yöntemin kullanım amaçları açıklanmıştır. Ayrıca, çalışma kapsamında karma yöntem araştırmalarının dayanakları, sınıflandırmaları, aşamaları ve uygulanması konuları ele alınmıştır. Çalışmada karma yöntem araştırmalarının katkıları, türleri ve aşamaları, gerçekleştirilen karma yöntem araştırmasına dayalı olarak açıklanmıştır. Sonuç olarak, karma yöntemin özellikle eğitim teknolojisi alanında kullanımına ilişkin eleştirel çıkarımlarda bulunulmuştur.

  18. Kuzey Kıbrıs Türk Cumhuriyeti`nde Okutulan Kıbrıs Tarihi Ders Kitaplarındaki “Tarih Öncesi Çağlar” Ünitelerinin İçerik Analizi / Content Analysis of Units on "Prehistoric Ages" of Cyprus History Course Books in Turkish Republic of Northern Cyprus

    Directory of Open Access Journals (Sweden)

    Ali Efdal Özkul

    2017-04-01

    Full Text Available Abstract This study is based on the content analysis of the units on pre-historic periods of Cyprus History, Book 1 used in secondary schools between 2004 and 2009 and of Turkish Cypriot History, 6th Grade Books used for the secondary schools between 2009 and 2016. Mixed research methods, which compromises qualitative and quantitative research method, was used in this study. The qualitative part of the study includes the examination of the units on prehistoric ages in the textbooks according to criteria such as concepts, skills and visuals. In the quantitative part of the study, it has been consulted 67 teachers who are able to give a history lesson in secondary schools. According to the findings obtained from the study, it is possible to say that the opinions of the teachers with regard to the Cyprus History, Book I between 2004-2009 are more positive than 6th Grade Books of Cyprus History between 2009-2016. Additionally, it was seen that there were missing points in the units on pre-historic periods of the said course books in terms of concepts, skills and visuals.  Öz Çalışmada 2004-2009 yılları arasında orta dereceli okullarda okutulan Kıbrıs Tarihi 1. Kitap ile 2009-2016 yılları arasında orta dereceli okullarda okutulan Kıbrıs Türk Tarihi 6. Sınıf ders kitaplarının tarih öncesi devirlerini içeren ünitelerinin içerik açısından değerlendirilmesi esas alınmıştır. Çalışmada nitel ve nicel araştırma yöntemlerini içerisine alan karma araştırma modeli kullanılmıştır. Çalışmanın nitel bölümünde ders kitapları içerisinde yer alan tarih öncesi çağları içeren ünitelerin kavramlar, beceriler ve görseller gibi kriterler doğrultusunda incelenmesi yer almaktadır. Araştırmanın nicel bölümünde ise orta dereceli okullarda tarih dersi verebilecek niteliklere sahip 67 öğretmenin görüşüne başvurulmuştur. Çalışmanın sonucunda elde edilen bulgulara göre 2004-2009 Kıbrıs Tarihi 1

  19. Diminishing the Undesirable Effects of the Computer Games with the Kinect Sensors

    Directory of Open Access Journals (Sweden)

    Ömür Akdemir

    2015-04-01

    ını oynamalarının etkileri karşılaştırılmıştır. Araştırma sorularını cevaplamak için karma araştırma deseni kullanılmıştır. Oyun motivasyon ölçeği, bireysel kas aktivite bildirim şekli ve yapılandırılmış görüşme soruları veri toplama aracı olarak kullanılmıştır. t-testin yanında, nitel ve nicel verilerin betimsel değerlendirmeleri yapılmıştır. Elde edilen bulgulara Kinect sensör ile oyun oynamanın bireylerin motivasyonunu ve kas aktivitesini artırdığını ortaya koymuştur. Ayrıca, Kinect sensörü ile oyun oynayan bireylerin oyunlara karşı fikirleri değişmiştir. İleride yapılacak olan araştırmalar Kinect sensör kullanımının bilgisayar oyunlarını oynayanların üzerindeki motivasyon ve duygusal etkilerinin korelasyonunu incelemelidir. Anahtar Sözcükler: Kinect, bilgisayar oyunları, motivasyon ölçeği, fiziksel aktivite

  20. Üstün Yetenekli Dijital Yerlilerin Sosyal Medya Kullanımları Üzerine Nitel Bir Çalışma

    Directory of Open Access Journals (Sweden)

    İbrahim Şamil Köroğlu

    2015-08-01

    Full Text Available Ağ neslinin yeni medya teknolojilerine ilişkin algısına ve teknolojiyi kullanma motivasyonuna ilişkin yapılan nicel çalışmalar dijital antropoloji alanına ilgi duyanlar için ufuk açıcı niteliktedir. Ağ neslinin özellikli bir grubunu teşkil eden üstün yetenekli dijital yerliler ise interneti ve mobil iletişim teknolojilerini bir dil gibi kullanabilen, içerik üretimi ve paylaşımı konusunda katılımcı, bilgi edinme, eğlenme ve sosyalleşme amacıyla birincil kaynak olarak sanal ortamı gören üstün yetenekli çocuklardır. Üstün yetenekli dijital yerlilerin sosyal medya kullanım motivasyonlarını Kullanımlar ve Doyumlar Yaklaşımı ile inceleyen bu çalışma, betimsel nitelikli tarama modelinde bir araştırmadır. Araştırma grubu, 2012-2013 eğitim yılında İstanbul Bilim ve Sanat Merkezi, Beşiktaş Bilim ve Sanat Merkezi ve Beyazıt Ford Otosan İlköğretim Okulu’nda öğrenim gören 401 üstün yetenekli öğrencidir. Grupta yer alan üstün yeteneklilerin 231’i (%57,6 9–11; 148’i (%36,9 12–14; 22’si (%5,5 ise 15–17 yaş grubundadır. Araştırmaya katılan üstün yeteneklilerin 247’si erkek (%61,6; 154’ü (%38,4 kız öğrencilerden oluşmaktadır. Çalışmada üstün yetenekli dijital yerlilerin sosyal medya kullanım sıklıkları; internet kullanım amaçları ile sosyal medya kullanım amaçları ve sık kullandıkları sosyal medya sitelerinin hangileri olduğu incelenmiştir. Çalışmada elde edilen bulgular üstün yetenekli dijital yerlilerin sosyal medya kullanım sıklığının akranlarına oranla Türkiye ortalamasının altında kaldığını; internet kullanım amaçlarıyla sosyal medya kullanım amaçlarının örtüştüğünü, ayrıca YouTube, Facebook ve Twitter’ın üstün yetenekli dijital yerlilerin en sık kullandıkları sosyal medya siteleri olduğunu ortaya koymaktadır.

  1. THE EXAMINATION OF TURKISH / TURKISH LANGUAGE AND LITERATURE TEACHER CANDIDATES’ ATTITUDES TOWARD TEACHER PROFESSION ACCORDING TO VARIOUS VARIABLES (KAFKAS UNIVERSITY SAMPLE TÜRKÇE VE TÜRK DİLİ VE EDEBİYATI ÖĞRETMENİ ADAYLARININ ÖĞRETMENLİK MESLEĞİNE İLİŞKİN TUTUMLARININ ÇEŞİTLİ DEĞİŞKENLER AÇISINDAN İNCELENMESİ (KAFKAS ÜNİVERSİTESİ ÖRNEĞİ

    Directory of Open Access Journals (Sweden)

    Kürşad Çağrı BOZKIRLI

    2011-12-01

    Full Text Available The aim of this study is to examine the attitudes of Turkish teachercandidates and Turkish Language and Literature teacher candidates,who attend to formation program, toward teacher profession according tovarious variables. 64 students from Kafkas University Education FacultyTurkish Education Department 4. grade, and 60 students from thepedagogical formation program which is given at the same faculty, as atotal 124 teacher candidates participated in this study. In this study“Attitude Measurement toward Teacher Profession” which is developed byÜstüner (2006 is used as data gathering tool. The gathered data isanalyzed by SPSS 17.0 (Statistical Package for Social Sciences packageprogram. As a result of the study, it is found that the attitudes of teachercandidates toward teacher profession does not indicate a significantdifference according to “under graduation department”, “the department’sorder of preference in ÖSS”, “gender”, “the graduated high school”variables. Bu çalışmanın amacı, Türkçe öğretmeni adaylarının ve formasyonprogramlarına devam eden Türk Dili ve Edebiyatı öğretmeni adaylarınınöğretmenlik mesleğine yönelik tutumlarını çeşitli değişkenler açısındandeğerlendirmektir. Çalışmaya, Kafkas Üniversitesi Eğitim FakültesiTürkçe Eğitimi Bölümü 4. sınıf öğrencilerinden 64, aynı fakültebünyesinde açılan pedagojik formasyon programından 60 olmak üzeretoplamda 124 öğretmen adayı katılmıştır. Araştırmada veri toplama aracıolarak Üstüner (2006 tarafından geliştirilen “Öğretmenlik MesleğineYönelik Tutum Ölçeği” kullanılmıştır. Elde edilen veriler SPPS 17.0(Statistical Package for Social Sciences paket programı kullanılarakanaliz edilmiştir. Araştırma sonucunda öğretmen adaylarının öğretmenlikmesleğine yönelik tutumlarının “lisans düzeyi mezun olunan/olunacakbölüm”, “bölümün ÖSS’deki tercih sırası”,

  2. ÜRETİM İLİŞKİLERİ TEMELİNDE MODERNİZM VE POST-MODERNİZMİN AZGELİŞMİŞ ÜLKELER ÜZERİNE ETKİLERİ (ON THE BASIS OF THE PRODUCTION RELATIONSHIP EFFECTS OF MODERNISM AND POST-MODERNISM ON UNDERDEVELOPED COUNTRIES

    Directory of Open Access Journals (Sweden)

    Kemal ER

    2014-07-01

    Full Text Available ÖZ: Dünya ekonomik sisteminin kapitalizm tarafından şekillendirildiği bilinen bir gerçektir. Dolayısıyla, ekonomik sistem içinde yer alan fordizm ve post-fordizm de kapitalizmin etkisi altında bulunmaktadır. Burada yapılan araştırmada görüldüğü gibi, fordizm modernizmi etkilemekte, daha sonra gündeme gelen post-fordizm de post-modernizmi etkilemektedir. Öte yandan, modernizm ve post-modernizm, “gelişme yazını” ve “azgelişme yazını” tarafından farklı açılardan ele alınmaktadır. Bu teorilere “azgelişmişlik” açısından bakılmadığında, toplumsal kalkınma sorununa gelişmeyi destekleyici bir çözüm getirilememektedir. O nedenle, bu makalede, ekonomik sistemleri de belirleyen üretim ilişkileri de dikkate alınarak, modernizm ve post-modernizm teorilerinin azgelişme açısından incelenmesi üzerine yoğunlaşılmaktadır. Literatür araştırmalarından elde edilen sonuçla, üretim ilişkileri temelinde modernizm ve post-modernizm gelişmiş devletlerin çıkarlarına işlemektedir. Çalışmada buradan hareketle, azgelişmiş devletlerin zararlarına olabilecek faktörler vurgulanmaya ve bu faktörlerin etkisini ortadan kaldırmaya yönelik politika önerilerinde bulunulmaya çalışılmaktadır. Anahtar Kelimeler: Azgelişme, Kapitalizm, Modernizm, Post-modernizm, Fordizm, Post-fordizm, Bağımlılık Okulu. ABSTRACT: It is a well-known reality that capitalism forms the economic system of the world. Therefore, fordism and post-fordism contained in the economic system are also under the influence of capitalism. As shown in the research, fordism affects the modernism, and in the next step dealt post-fordism influences the post-modernism. On the other hand, the modernism and post-modernism theories have been considered through different perspectives by the “development literature” and the “underdevelopment literature”. It is not possible to find a solution against the social

  3. İşveren Markası Oluşturma: Katılım Bankası Örneği(Creating Employer Brand: Participation Bank Example

    Directory of Open Access Journals (Sweden)

    Elif Narcıkara

    2016-03-01

    Full Text Available Günümüz firmaları, ürün ve hizmetlerinin pazarlanmasında dış müşterinin yanısıra iç müşterinin de öneminin farkına varmışlardır.  Bu bağlamda, Simon Borrow tarafından geliştirilen İşveren Markası kavramı 1990’ların önemli gelişmelerinden biri olmuş ve birçok firma tarafından dikkate alınan bir kavram haline gelmiştir (Tüzüner vd., 2009. Yetenekli iş gören bulma konusundaki zorluklar, hizmet sektöründe İşveren Markası uygulamalarını öne çıkarmıştır (Berthon vd. 2005; Knox ve Freeman, 2006. Kariyer portallarında en çok başvurunun hizmet sektörü içerisinde bankacılık sektörüne yapılması da araştırmacıları bankacılık sektörüne yöneltmiştir. Bu çalışmanın ana örneklemini katılım bankacılığı alanında hizmet veren Albaraka Türk Katılım Bankası’ na daha güncel ve sağlıklı verilere ulaşılacağı varsayımıyla sadece son 3 ayda başvuruda bulunun adaylar oluşturmaktadır. Çalışmanın amacı Albaraka Türk’e iş başvurusunda bulunan adayların tercihlerinde etkili olan İşveren Marka çekiciliği faktörlerini ölçmek ve tercihlerinde tecrübe ve eğitim durumlarının etkisinin olup olmadığını görmektir. Bu amaçla geçerliliği ve güvenilirliği tespit edilmiş olan Berthon’un İşveren Çekiciliği Ölçeği (Employer Attractiveness Scale kullanılmıştır. Araştırma ile ilgili anket, pazarlama pozisyonlarına son 3 ayda başvuru yapan, farklı tecrübe seviyelerindeki 500 kişilik bir aday grubuna uygulanmıştır. Adayların seçiminde kolayda örnekleme metodu kullanılıp, Berthon’un 25 soruluk ölçeğinden oluşan anket 7’li Likert cevap ölçeği kullanılarak e-mail aracılığıyla adaylara gönderilmiştir. Elde edilen sonuçlar da SPSS programı ile analiz edilmiştir.

  4. Yıllık toplam ve Ultraviole (UV Güneş Enerjisi Verilerinin Ölçülmesi

    Directory of Open Access Journals (Sweden)

    Muhittin ŞAHAN

    2014-02-01

    Full Text Available Bu çalışmada, Ekim 1993 ve Eylül 1995 tarihleri arasında toplam ve UV ışınım ölçümleri Adana'da (Enlem: 35°18'D, Boylam: 36°59'K Çukurova Üniversitesi UZAYMER binasının çatısına yerleştirilen bir Eppley Pranometre (285-2800nm ve bir Eppley UV Radyometre (295-385 nm kullanılarak yapılmıştır. Ölçüm süresince günlük toplam enerji ve UV bileşeni sırasıyla 8322.64 MJ/m2 ve 312.04 MJ/m2 olarak hesaplanmıştır. Günlük ortalama toplam enerji ve UV ışınımın bileşeni sırasıyla 17.09 MJ/m2 0.64 MJ/m2 olarak bulunmuştur. Aylık ortalama yıllık toplam enerjinin 17.55 MJ/m2, UV bileşeninin ise 0.67 MJ/m2 olduğu saptanmıştır. En yüksek güneş enerjisi 25.75 MJ/m2 ile Temmuz en düşük enerji 7.25 MJ/m2 ile Ocak ayında alınmıştır. Haziran ve Ağustos aylarında gelen toplam enerji diğer aylara göre daha yüksektir. Elde edilen sonuçlara göre, Şubat ve Ekim aylarında ortalama güneş enerjinin yüzde yüzü 20 MJ/m2 'nin altında, Ocak ayında ise, 15 MJ/m2 'nin altında olduğu saptanmıştır. Güneş enerjisinin %90'ı Nisan, Mayıs, Haziran, Temmuz ve Ağustos aylarında 20 MJ/m2 'nin üzerinde olduğu saptanmıştır. Bu sonuçlara göre, Adana bölgesinin güneş enerjisi bakımından oldukça yüksek değerlere sahip olduğu görülmektedir. Anahtar Kelimeler: Güneş Işınımı, Toplam ışınım, UV Işınımı

  5. Public Librarians’ Needs for in-service Training in Turkey Türkiye’de Halk Kütüphanecilerinin Hizmet İçi Eğitim Gereksinimleri

    Directory of Open Access Journals (Sweden)

    Şenol Karadeniz

    2009-03-01

    ımcısı olmak üzere toplam 143 Bilgi ve Belge Yönetimi Bölümü mezunu ile örneklenmiştir. Anketler, Ocak-Şubat 2008 tarihlerinde bütün deneklere uygulanmıştır. Araştırmadan elde edilen bulgular ışığında, araştırmaya katılan kütüphanecilerin çok büyük bir bölümünün (%89,5 hizmet içi eğitime gereksinim duyduğu anlaşılmıştır.

  6. Japon Balığı (Carassius auratus Linnaeus, 1758 Dokularında Bor Akümülasyonu

    Directory of Open Access Journals (Sweden)

    Tuncer Okan Genç

    2015-03-01

    Full Text Available Bu çalışmada, model bir balık türü olabilen Japon balığının (Carassius auratus Linnaeus, 1758 karaciğer ve kas dokusundaki, yem ve su kaynaklı bor birikiminin dağılımı incelenmiştir. Her bir uygulama için her bir akvaryuma 12 adet birey. Uygulamalarda, akvaryum gruplarının suyuna belirli oranlarda (1 mg/L, 10 mg/L ve 20 mg/L borik asit ve borik asit emdirilmesi ile elde edilen yemlerden (1 mg/kg, 5 mg/kg ve 10 mg/kg verilmiştir. Dokulardaki bor birikimi mikrodalga yaş yakma ile çözündürme işleminin ardından indüktif olarak eşleştirilmiş kütle spektroskopisi (ICP-MS tekniği ile belirlenmiştir. Japon balıklarının farklı dokularında belirlenen maksimum bor konsantrasyonu 20mg/L sulandırılmış borik asit uygulamasında karaciğer dokusunda (1.78±0.02 mg/kg tespit edilmiştir. Ancak 1 mg/kg yem uygulamasında kas dokusunda birikim olmadığı gözlemlenmiştir. Borlu su grupların için Transfer faktör (TF en düşük dozda en yüksek oranda iken doz miktarı arttıkça TF azalmış ve neredeyse 0.1’e yakın bir sabitlik göstermiştir. Bor ilaveli yem kullanılan deney gruplarında TF en düşük dozda (1 mg/kg 0 iken yemde kullanılan borun doz miktarı arttıkça (5 mg/kg TF değerinin yaklaşık 0.06’ya kadar çıktığı tespit edilmiştir. Bu çalışmada önemli iki tespit ortaya konulmuştur; bor birikiminde hedef organlardan biri karaciğer iken kas dokusunun birikim açısından hedef olmadığı ve yem ile alınan borun dokularda birikiminin düşük olmasıdır.

  7. AYVALIDERE HAVZASINDA (SÜLEYMANPAŞA / TEKİRDAĞ JEOMORFOLOJİK FAKTÖRLERİN TOPRAK ÖZELLİKLERİ ÜZERİNE ETKİLERİ

    Directory of Open Access Journals (Sweden)

    Emre ÖZŞAHİN

    2016-02-01

    Full Text Available Bu çalışmada, jeomorfolojik faktörlerin toprak özellikleri üzerine etkileri Ayvalıdere Havzası örneğinde incelenmiştir. Bu etkilerin örnek bir havza dâhilinde incelenmesi çalışmanın önemini teşkil etmektedir. Çalışmada 1:25.000 ölçekli KIRKLARELİ F19-d4 ve BANDIRMA G19-a1 numa- ralı topoğrafya haritaları kullanılmıştır. Yöntem olarak ise öncelikle havza alanının jeomorfolojik özellikleri tespit edilmiştir. Ardından başka araştırmacılar tarafından yaptırılan toprak örneklerinin analizlerinden ve çalışma bulgularından istifade edilerek havzanın detaylı toprak haritası oluşturul- muştur. Gerek jeomorfolojik özellikler (yer şekilleri, eğim, bakı, yükselti gerekse toprak özellikleri CBS (Coğrafi Bilgi Sistemleri ortamında karşılaştırılarak, havzada toprakların dağılışında jeomor- folojik faktörlerin etkisi irdelenmiştir. Çalışma sonunda yer şekilleri ile toprak özellikleri arasındaki ilişkinin kısa mesafeler dâhilinde büyük değişiklikler sunduğunu belirlenmiş ve vurgulanmıştır. Bu ilişkinin daha detaylı çalışmalarla ortaya konması gereklidir. Böylece elde edilen sonuçlarla toprak kaynaklarının korunması, doğru kullanımı ve planlanması konusunda önemli adımlar atılabilir. Nihai olarak gerek jeomorfolojik gerekse pedolojik özellikleri konu alan benzer çalışmalarda toprak ve yer şekilleri arasındaki münasebetin araştırılması doğal ortamı daha iyi anlayıp, analiz etmemize yardımcı olacaktır.

  8. BİR İLETİŞİM ARACI OLARAK WEB SİTELERİ: TÜRKİYE’DEKİ OTEL WEB SİTELERİNİN ETKİNLİĞİ ÜZERİNE BİR ARAŞTIRMA-WEB SITES AS A COMMUNICATION TOOL:THE CASE OF TURKISH HOTELS

    Directory of Open Access Journals (Sweden)

    Solmaz Filiz KARABAĞ

    2012-06-01

    Full Text Available Son yıllarda internet kullanımı birçok sektörde olduğu gibi turizm sektöründe de online seyahat alımlarını ön plana çıkarmış ve otellerin web siteleri önemli bir iletişim ve pazarlama medya aracı durumuna gelmiştir. Bu bağlamda, gerekli donanıma ve zenginliğe sahip Türkiye’deki otellerin bu aracı gerçekte nasıl kullanmaları gerektiği ve şu anda nasıl kullandıkları önemli bir konu olarak karşımıza çıkmaktadır. Yapılan yazın taraması sonucunda otellerin web sitelerinin taşıması gereken içerik ve tasarım özelliklerini ortaya koyan bir model geliştirilmiştir. Bu modele dayanılarak, Türkiye turizminin pazarda kültür turizmine katkısı olacağı düşünülen “Dünya Miras Listesi”nde yer alan bölgelerdeki üç, dört ve beş yıldızlı toplam 335 otelin web sitesi analiz edilmiştir. Elde edilen sonuçlardan hareketle, otel web sitelerinde adres, telefon numarası, e-posta adresi ve otel resimlerinin dışında potansiyel turistin dikkatini, otelin bulunduğu yöreye çekebileceği düşünülen çevre, turizm potansiyeli, yöreye ilişkin bilgi vb. gibi birçok konuda hiçbir bilginin olmadığı gözlenmiştir. Ayrıca çalışmada, konuyla ilgili olarak etkin bir web sitesi hazırlamaya yönelik olarak bazı öneriler sunulmuştur.-Increased use of Internet in the recent years caused a boom in online purchasing of travel services and made web sites of hotels important marketing and communication tools for the tourism industry. In this context, it can be said that to research how Turkish tourism industry uses web sites to promote itself on the Internet, is vital. This study develops a web site model including content and design components. The data is gathered from 335 three, four, and five star hotels operating in nine Turkish cities, which are members of world heritage list. The findings show that the hotels generally use contact information, and hotel pictures. But a little

  9. Yöneticilerin Liderlik Tarzları ile Çalışanların İşyerindeki Politik Davranışları Arasındaki İlişkinin İncelenmesine Yönelik Bir Araştırma(A Study on the Correlation of Leadership Styles and the Political Behaviours of Employees in Workplaces

    Directory of Open Access Journals (Sweden)

    Mustafa Erdem

    2016-04-01

    Full Text Available Bu çalışmanın temel amacı işletmelerde çalışan personelin yöneticilerinin liderlik tarzlarını nasıl algıladıkları, bu algı çerçevesinde herhangi bir politik davranış sergileyip sergilemediklerini ortaya koymak ve bu iki kavram arasındaki ilişkiyi incelemektedir. Çalışmada ‘Türkiye Ortamında Liderlik Özellikleri’ isimli ölçek çalışmasından istifade edilerek çalışanların, yöneticilerinin davranışlarını nasıl algıladıkları ve bu algıya istinaden ortaya koymuş oldukları politik davranışlar tespit edilmiştir. Bu bağlamda yöneticilerin liderlik tarzları; takım kuran ve paylaşan, hiyerarşik ve işe odaklı, takip ve kontrol eden ve babacan olarak, politik davranışlar ise; tavizci davranmak, ikiyüzlü davranmak, göze girmeye çalışmak, koalisyon kurmak, karşılıklı çıkar gözetmek, üst yönetime yaranmaya çalışmak şeklinde ele alınmıştır. Çalışmada farklı sektörlerde faaliyet gösteren işletmelerde toplam 123 kişi ile anket çalışması yapılmıştır. Çalışanlara uygulanan anket verilerinin analizi sonucunda elde edilen bulgular çerçevesinde, yöneticilerin liderlik tarzları ile çalışanların işyerindeki politik davranışları arasındaki ilişki tespit edilmeye çalışılmıştır. Abstract The main objective of this study is to exhibit how the employees in a workplace perceive the leadership styles of their executives, how they reflect a political behaviour regarding their perception and to examine the association between these two notions. The study made use of the scale experiment “Leadership Characteristics in Environment of Turkey” for determining how the employees perceive the behaviours of executives and which political behaviours the employees reflect regarding this perception. In this context the leadership styles of executives are handled as team setter and participant, hierarchical and work-oriented, monitor and controller and

  10. Yozgat İlinde İki Osmanlı Kalesinin Dünü ve Bugünü Karahisar-ı Behramşah (Müşalim Kalesi ve Akçakale

    Directory of Open Access Journals (Sweden)

    Murat HANİLÇE

    2017-12-01

    Full Text Available Yozgat’ın idari yapısı Osmanlı Devleti egemenliği sırasında günümüzden oldukça farklıydı. Günümüzde Yozgat ili sınırları içerisinde kalan Aydıncık, Çekerek, Kadışehri ve Akdağmadeni ilçe topraklarının önemli kısmı Sivas sancağına bağlı Zile kazası sınırlarındaydı. Söz konusu yerleşimler Osmanlı Devleti’nin ilk dönemlerinde Dulkadirlilerle Osmanlıların bir kesişme noktası olduğu gibi Osmanlı Devleti’nin doğu sınırlarına oldukça yakın bir konumdaydı. Osmanlıların 15 ve 16. yüzyıllarda tuttukları tapu kayıtları ve diğer arşiv belgelerine göre, bu çalışmaya konu olan iki kaleden birisi aynı zamanda Zile kazasına bağlı bir nahiye olan Karahisar-ı Behramşah’ta ve diğeri Halka-i Hass nahiyesindeydi. Karahisar-ı Behramşah’taki kaleye kalede oturan ve Zile zaimi olan Müşalim oğlu Ali Bey ve sülalesinden dolayı Müşalim kalesi denmekteydi. Halka-i Hass nahiyesinde bulunan kale Akça Kale adını taşımaktaydı. Bu çalışmada, günümüzde Yozgat Akdağmadeni ilçesi sınırlarında kalan Karahisar-ı Behramşah kalesi ile Kadışehri ilçesi sınırları dâhilinde bulunan Akça Kale’nin arşiv belgelerine ve mevcut araştırma eserlerine göre tarihi ortaya konulacaktır. Adı geçen kalelerin günümüzdeki durumu ile ilgili yaptığımız gezi sonrasında yöre halkından elde edilen bilgiler de değerlendirilecektir. Bu kaleler hakkında eksik bazı bilgiler bu çalışma ile tamamlanmaya çalışılacaktır. Çalışmanın sonuç kısmında Yozgat ve çevresindeki Türk kalelerinin Türkiye turizmine kazandırılması konusunda bazı tespitler ve değerlendirmelere yer verilecektir.

  11. The Analysis of the Primary School Mathematics Exam Questions According to the MATH Taxonomy [İlköğretim Matematik Dersi Sınav Sorularının MATH Taksonomisine Göre Analizi

    Directory of Open Access Journals (Sweden)

    Berna Aygün

    2016-04-01

    Full Text Available In this study, the contents and types of elementary 6th, 7th, 8th grades’ mathematics exam questions are analyzed according to groups and categories of the MATH taxonomy. In order to achieve this aim documentary analysis research and Chi-square test are used and the analyses of questions are based on the definitions of groups and categories of the MATH taxonomy. Analyzed questions consist of 939 questions which are collected from mathematics classes of different schools at East Blacksea regions. In all of the questions, 260 are at 6th grade (27.7%, 327 are at 7th grade (34.8%, and 352 are at 8th grade (37.5% mathematics written exam questions. According to the results, two in every three questions used by instructors in math exams are at A3 "Routine use of Procedures" level in which the use of the procedure or algorithm is required to use properly. Most of the questions are from category A which contains routine procedures and basic abilities. in addition to this, there are fewer questions at category B which is required the higher order thinking skill, and scarcely any questions at higher-up thinking level, category C. [Bu çalışmada ilköğretim 6., 7. ve 8. sınıfların matematik dersi sınav sorularının ait olduğu öğrenme alanlarının ve soru türlerinin MATH taksonomi grup ve kategorilerine göre incelenmesi amaçlanmıştır. Bu amaç doğrultusunda çalışmada karma yöntem kullanılmış ve sorular MATH Taksonomi Grup ve Kategorilerine ait açıklamalar temel alınarak doküman incelemesi ve ki-kare testi ile analiz edilmiştir. İncelenen sorular, Doğu Karadeniz bölgesindeki çeşitli okullardaki matematik dersi sınavlarında sorulan toplam 939 sorudan oluşmaktadır. Bu sorulardan 260 tanesi (% 27,7 6. sınıf, 327 tanesi (% 34,8 7. sınıf, 352 tanesi (% 37,5 ise 8. sınıf matematik dersi yazılı sınav sorularıdır. Elde edilen bulgulara göre öğretmenlerin matematik dersi sınavlarında kullandıkları her 3

  12. Information Security Issues in a Digital Library Environment: A Literature Review = Dijital Kütüphane Ortamında Bilgi Güvenliği Sorunları: Literatür Değerlendirmesi

    Directory of Open Access Journals (Sweden)

    Anday, Audrey

    2012-01-01

    Full Text Available This paper aimed to explore the literature on security issues that digital libraries should consider in managing digital resources. Books on information security and network security were consulted as well as several databases such as ERIC, Ebrary, LISA, Science Direct, EbscoHost, ISI, Google Scholar, ProQuest, Emerald Insight, ACM were searched to understand what particular aspect of information security and privacy in digital libraries exist from 2000 - 2010. Security in digital libraries is an issue of the most important, and should be considered carefully in creating policies and strategic plans of institutions wanting to set up a digital library. This paper focused on the four main streams that concerns security in the digital environment, namely: infrastructure, digital content, users and standards and legal issues. This literature review also built upon previous literature reviews, and is one of the few of its kind in the topic. / Bu çalışma dijital kütüphanelerin kaynakların yönetiminde göz önünde bulundurmasıgereken güvenlik sorunlarına ilişkin literatürü ortaya koymayı amaçlamaktadır. Bilgi Güvenliği, Ağ Güvenliği, Kişisel Gizlilik konuları üzerine 2000 - 2010 yıl aralığını kapsayan kitaplar ve makaleler ERIC, Ebrary, LISA, Science Direct, EbscoHost, ISI, Google Akademik, ProQuest, Emerald Insight ve ACM gibi çeşitli veri tabanlarından taranmıştır. İncelenen literatürden elde edilen sonuçlara göre,bilgi güvenliği dijital kütüphaneler için son derece önemli bir konudur ve dijitalleşme sürecinde bir kütüphane, güvenlik politikalarını ve stratejik planlarını dikkatle göz önünde bulundurmalıdır. Bu araştırmada dijital ortamda güvenliği ilgilendiren Altyapı, Dijital İçerik, Kullanıcılar, Standartlar ve Hukuki Konular olmak üzere dört ana madde üzerinde durulmuştur. Bu çalışma ayrıca daha önceki literatür taramalarını da kapsamaktadır.

  13. Otizm Spektrum Bozukluğu (OSB Olan Bireylerin Fiziksel Aktivitelerine İlişkin Yapılan Çalışmaların Gözden Geçirilmesi

    Directory of Open Access Journals (Sweden)

    Bora Görgün

    2016-12-01

    Full Text Available Bu araştırmada, Türkiye’de ve dünyada otizm spektrum bozukluğu (OSB olan bireylerin fiziksel aktivitelerine ilişkin 2004-2014 yılları arasında yapılan tez ve makale çalışmalarının gözden geçirilmesi amaçlanmıştır. Bu araştırma için Yükseköğretim Kurulu (YÖK Ulusal Tez Merkezi, Türkiye Bilimsel ve Teknolojik Araştırma Kurumu Ulusal Akademik Ağ ve Bilgi Merkezi (TÜBİTAK ULAKBİM, EbscoHost, Proquest Dissertations and Theses Global, SAGE ve SpringerLink veritabanları taranmış ve konuyla ilgili 16 tez çalışmasına ve hakemli dergilerde yayınlanmış 33 makaleye ulaşılmıştır. Elde edilen çalışmalar dört kategoride incelenmiştir. “OSB olan bireylerin fiziksel aktivitelerini karşılaştırma” kategorisinde altı, “fiziksel aktivite programının OSB olan bireyler üzerine etkisi” kategorisinde 26, “fiziksel aktiviteye yönelik ailelerin ve öğretmenlerin görüşleri” kategorisinde altı ve “fiziksel aktivite programlarının niteliklerini belirleme ve artırmaya yönelik çalışmalar” kategorisinde 11 çalışma yer almaktadır. Sonuçlar fiziksel aktivitenin OSB olan bireylerin gelişimlerine olumlu katkı sağladığını, ülkemizde yapılan çalışmaların fiziksel aktivitenin etkisi üzerine yoğunlaştığını ve fiziksel aktivite programlarının niteliği, farklı yetersizlik gruplarındaki bireylerle fiziksel aktivite düzeylerinin karşılaştırılması gibi farklı alanlarda çalışmalara ihtiyaç olduğunu göstermektedir. The aim of this study is to review thesis and articles on physical activities of individuals with autism spectrum disorders (ASD published between 2004 and 2014 in Turkey and in the world. Council of Higher Education (YÖK National Thesis Center, The Scientific and Technological Research Council of Turkey National Academic Network and Information Center (TÜBİTAK ULAKBİM, EbscoHost, Proquest Dissertations and Theses Global, SAGE and Springer

  14. OKUL ÖNCESİ ÖĞRETMENLERİNİN SINIF YÖNETİMİ BECERİLERİ

    Directory of Open Access Journals (Sweden)

    Fatma YAŞAR EKİCİ

    2017-11-01

    Full Text Available Bu araştırmanın temel amacı okul öncesi öğretmenlerinin sınıf yönetimi becerilerinin incelenmesidir. Araştırmada tarama modeli kullanılmıştır. Araştırma evrenini Türkiye’de okul öncesi eğitim kurumlarında görev yapmakta olan okul öncesi öğretmenleri oluşturmaktadır. Araştırma örneklemini ise 2016-2017 eğitim öğretim yılının güz döneminde İstanbul, Yalova, Trabzon, Afyon, Bursa, Kayseri, Tekirdağ, Sakarya, İzmit, İzmir, Antalya, Adana, Ordu, Batman ve Mardin illerindeki devlet ve özel okul öncesi eğitim kurumlarında görev yapmakta olan 300 okul öncesi öğretmeni oluşturmaktadır. Araştırmada veri toplama aracı olarak araştırmacılar tarafından hazırlanmış olan Kişisel Bilgi Formu ve Denizel Güven ve Cevher tarafından geliştirilmiş olan Sınıf Yönetimi Beceri Düzeyi Ölçeği kullanılmıştır. Verilerin analizinde SPSS.20 paket programı kullanılmıştır. Araştırmada elde edilen bulgular şöyledir: Okul öncesi öğretmenlerinin sınıf yönetimi becerileri yaş, çalışılan kurum türü, medeni durum, gelir düzeyi, görevdeki kadro durumu, eğitim düzeyi, sınıfta bulunan öğrenci sayısı ve sınıf yönetimiyle ilgili eğitim alma durumuna göre anlamlı düzeyde farklılaşmamaktadır. Bundan farklı olarak okul öncesi öğretmenlerinin sınıf yönetimi beceri düzeyleri mesleki kıdeme göre farklılaşmaktadır. Buna göre mesleki kıdemi 10 yıl ve üzeri olan okul öncesi öğretmenlerinin sınıf yönetimi becerileri, mesleki kıdemi 0-11 ay arasında olan okul öncesi öğretmenlerinden daha yüksektir.

  15. Türkiye’de Öğrenim Gören Suriyeli Ortaokul Öğrencilerinin Algısal Öğrenme Stillerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Murat ŞENGÜL

    2017-12-01

    Full Text Available Öğrenme olayı çevresel, duygusal, fizyolojik, psikolojik, sosyolojik birçok etmen ve uyarıcı ile bağlantılı olarak gerçekleşen bir süreçtir. Doğası gereği her insanın kendine özgü bir öğrenme stili vardır. Eğitim öğretim sürecinde bu durum çok daha iyi gözlemlenebilir. Bazı öğrenciler ders sürecinde görerek daha iyi öğrenirken bazıları dokunarak bazıları ise duyarak daha iyi öğrenirler. Yabancı dil öğretiminde öğrenmenin etkili bir şekilde gerçekleşebilmesi için öğretmenin öğrencilerinin konuyu hangi öğrenme stillini kullanarak kavradığını iyi bilmesi gerekmektedir. Bu araştırmanın amacı, Türkiye’de yaşayan Suriyeli ortaokul öğrencilerinin öğrenme stillerinin nasıl olduğunu saptamak, öğrenme stillerinin görsel, işitsel, dokunsal, kinestetik ve sosyal öğrenme alanlarından hangilerinde yoğunlaştığını belirlemek, bu doğrultuda öğretmenlere farklı öğrenme stillerine sahip öğrenciler için seçecekleri yöntemler, teknikler konusunda ışık tutmak ve önerilerde bulunmaktır. Araştırmada nicel araştırma tekniklerinden betimsel tarama yöntemi kullanılmıştır. Araştırmanın verileri üç uzmanın görüşleri doğrultusunda dilsel geçerliliği sağlanmış olan “Algısal Öğrenme Stili Tercih Anketi” aracılığıyla toplanmıştır. Türkiye’nin çeşitli illerinde öğrenim gören toplam 255 Suriyeli ortaokul öğrencisine uygulanmıştır. Araştırmadan elde edilen veriler neticesinde, Suriyeli ortaokul öğrencilerinin algısal öğrenme stillerinden dokunsal ve kinestetik öğrenme stillerini diğer öğrenme stillerine oranla daha çok, bireysel öğrenme stillerini ise diğer öğrenme stillerine oranla daha az tercih ettikleri belirlenmiştir. Bunun yanı sıra, cinsiyet değişkenine göre öğrencilerin dokunsal ve kinestetik öğrenme stilleri tercihlerinde anlamlı farklılıklar gözlenmiştir. Kız öğrencilerin erkek

  16. Otizmli Çocuğa Sahip Olan Ebeveynlerin Görüşleri: Otizm Tanımlamaları ve Otizmin Nedenleri

    Directory of Open Access Journals (Sweden)

    Gökhan Töret

    2014-04-01

    Full Text Available Bu araştırmada, otizmli çocuğa sahip olan ebeveynlerin, otizmin nedenlerine ilişkin algıları, otizm tanımlamaları ve çocuklarının otizmin yaygın tanımı ile uyumlu olduğunu veya olmadığını düşündükleri özelliklerine ilişkin görüşlerinin belirlenmesi amaçlanmıştır. Araştırmada, otizmli çocuğa sahip olan birincil bakım veren durumundaki 50 ebeveyn ile yarı-yapılandırılmış görüşmeler gerçekleştirilmiştir. Ebeveyn görüşlerinin yazıya dökülmesi ile ebeveyn görüşlerini yansıtan ön temaların oluşturulması sonrası temalar üzerinden yapılan betimsel analiz sonucunda, otizm ile ilişkili olarak ebeveynlerin çoğunluğunun çocuklarının sahip olduğu otizmin nedeni konusunda bilinmezlik yaşadıkları, otizmi, sosyal-iletişimsel davranışlarda bozukluk olarak tanımladıkları, otizmin tanımı ile uyumlu olduğunu düşündükleri en sık problemin, çocuklarında gözledikleri dil-konuşma ve iletişim bozukluğu olduğu ve çocuklarında otizmin tanımı ile uyumlu olmayan bir öğrenme veya davranış özelliği gözlemedikleri belirlenmiştir. Bu araştırmada ilgili temalar altında derinlemesine elde edilen ebeveyn görüşleri, ilgili nitel araştırmalar doğrultusunda tartışılmış ve gelecekte yapılacak araştırmalara ve uygulamalara yönelik önerilere yer verilmiştir. The purpose of this study was to examine the opinions of parents of children with autism about their perception and definition of autism, characteristics of their children whether they are congruent with the common definition of autism or not. Semi-structured interviews were conducted with 50 parents who were the primary caregivers of children with autism. Following the completion of interviews with the parents, the interviews were transcribed without making any corrections; the expressions of parents were written verbatim as they were heard by the researchers. The results of this study showed that

  17. Tüketicilerin Helal Tüketim Davranışlarının Belirleyicileri: Planlı Davranış Teorisi Çerçevesinde Bir Araştırma

    Directory of Open Access Journals (Sweden)

    Abdülkadir ÖZTÜRK

    2016-11-01

    Full Text Available Özet Bu çalışmanın amacı, tüketicilerin helal kavramını nasıl algıladıkları ve tüketicilerin helal özellikli ürünleri satın alma davranışlarını incelemektir. Sosyal bilimlerde insan davranışlarını incelemede sıklıkla kullanılan Planlı Davranış Teorisi (PDT çerçevesinde araştırma yürütülmüştür. Tüketicilerin helal ürünlere yönelik tutumları, çevrelerindeki insanların tepkileri ve algılanan davranışsal kontrolün davranışsal niyet ve fiili davranış üzerindeki etkileri araştırılmıştır. Ayrıca tüketicilerin helal ürün kavramını nasıl tanımladıkları ve farklı ürün gruplarına göre bu tanımlamaların değişip değişmediği incelenmiştir. Bu amaçlar kapsamında helal tüketim ile ilgili sosyal medya üzerinde oluşturulmuş bir grubun üyelerine yönelik online olarak bir anket hazırlanmış ve gerekli veriler toplanmıştır. 202 tüketiciden elde edilen veriler üzerinde analizler yapılmıştır. PDT esas alınarak geliştirilen araştırma modelinde yer alan değişkenlerin tüketicilerin helal ürün satın almaya yönelik niyetlerini ve davranışlarını açıkladığı tespit edilmiştir. Davranışsal niyet üzerinde tüketicilerin geliştirdikleri tutum, fiili davranış üzerinde ise niyetlerin en belirleyici değişkenler oldukları tespit edilmiştir. Gıda, kozmetik ve temizlik ürün gruplarında katılımcıların en çok gıda ürünlerinin helal özelliği taşıması konusunda hassasiyet taşıdıkları gözlemlenmiştir. Helal ürünlerin, İslam dininin kurallarına uygun olarak üretilmiş olmasının yanında tüketiciler tarafından güvenilir, sağlıklı ve temiz olarak algılandığı tespit edilmiştir. Anahtar Kelimeler: Helal tüketim, Planlı Davranış Teorisi.

  18. DEMOGRAFİK DEĞİŞKENLER BAZINDA İŞ TATMİNİ BOYUTLARINDA OLUŞAN FARKLILIKLAR: OKMEYDANI EĞİTİM VE ARAŞTIRMA HASTANESİ PERSONELİNE YÖNELİK BİR ARAŞTIRMA-THE DIFFERENCES IN THE JOB SATISFACTION’S DIMENSIONS WITH RESPECT TO THE DEMOGRAPHIC FACTORS: A RESEARCH

    Directory of Open Access Journals (Sweden)

    A. Çiğdem MERCANLIOĞLU

    2012-07-01

    Full Text Available Kurumların etkinlik ve verimlilik boyutlarında başarılı olmalarının anahtarı, çalışanlarına verdiği değerdir. Bu çalışmada, Okmeydanı Eğitim ve Araştırma hastanesinde görevli, tesadüfi yöntemle seçilmiş 520 personelin,  çalıştıkları poliklinik, yaş, cinsiyet, medeni durum, eğitim, kıdem ve mesleki deneyimleri ile,  MSQ (Minnesota Satisfaction Questionnaire Minnesota İş Tatmini Soru Formu ile elde edilen, iş tatmininin boyutlarında duydukları tatmin/tatminsizlik dereceleri arasında, istatistiksel olarak anlamlı farklılıkların tespitine yönelik bir araştırma yapılmıştır. Bulgular, çalışanların iş tatmininin, MSQ ile ortaya çıkan aktivite boyutu hariç, tüm boyutlarında, çalıştıkları polikliniklere göre anlamlı farklılık gösterirken, cinsiyet değişkeni 8 boyutta, medeni durum değişkeni 5 boyutta, yaş değişkeni 3 boyutta, meslek 4 boyutta, kıdem 2 boyutta ve son olarak mesleki deneyim 2 boyutta anlamlı farklılıklar göstermiştir.-The key to a successful institution in efficiency and effectiveness, is the value given to employees. In this study, a survey based on MSQ (Minnesota Satisfaction Questionnaire, containing the sub-dimensions of job satisfaction has been conducted over Okmeydanı Educational and Research Hospital’s medical staff. The sample group of study was composed by randomly selecting 520 hospital staff. The aim was to determine the differences in the job satisfaction’s dimensions with respect to the demographic factors, including the employer clinic, age, sex, marital status, education, seniority and professional background. Findings have been significantly different except activity, from what was expected by the staff, in the dimensions that resulted from MSQ, with respect to the polyclinics they work in. There also have been differences in findings with respect to 8 dimensions of gender variables, 5 dimensions of marital status variables, 3

  19. Öğretimsel Düzenlemeler Modelinin Erken Çocukluk Özel Eğitiminde Kullanılması

    Directory of Open Access Journals (Sweden)

    Cevriye Ergül

    2009-01-01

    Full Text Available Özel gereksinimli çocukların hedeflenen beceri ve davranışlarda gösterdikleri gelişimin sürekli ve sistematik bir şekilde değerlendirilmesi ve elde edilen verilerin öğretimsel uygulamaları düzenlemede kullanılması, erken çocukluk özel eğitimin en önemli yapıtaşlarından biri olmasına rağmen, öğretmenlerin çoğunlukla sistematik veri toplamadıkları, öğretimsel kararlar alırken sezgilerine ve sistematik olmayan gözlemlerine dayandıkları bildirilmiştir. Buna karşın, basit bir yönerge modeli olan Öğretimsel Düzenlemeler Modeli (ÖDM ile yapılandırılmış bir süreç içinde öğretmenlerin verileri sistematik değerlendirmelerinin sağlandığı durumlarda, çocukların hedeflenen becerilerin kazanımında daha başarılı olduğu gözlenmiştir. Bu çalışmada, ÖDM modelinin bir erken müdahale programında uygulanması anlatılmıştır. Üç basamaktan oluşan bu model, özel gereksinimli çocukların hedeflenen beceri ve davranışlarında gösterdikleri gelişimin sürekli ve sistematik bir şekilde değerlendirilmesini, verilerin grafikleştirilmesini ve verilerin öğretimsel kararlar almak için yorumlanmasını içermektedir. Makalede, bahsedilen basamakların ayrıntılı değerlendirilmesi sunulmuştur. Although a critical component of early childhood special education is continuous monitoring children’s progress and using data to modify instruction, special education teachers engage in data collection activities only rarely or not at all. Instead, they tend to rely on their intuition or informal observations of children when they make instructional decisions. However, when teachers use a structured method embedded in the Instructional Adaptations Model (IAM to evaluate data and make instructional changes, their students demonstrate superior performance in the acquisition of targeted skills in comparison to their peers. In the article, implementation of IAM in early intervention programs is

  20. İçsel Markalaşma Uygulamalarıyla Markanın Örgüt İçerisinde Tutundurulması: ARKAS Holding Örnek Olayı* ( Promoting Brand Within Organization Via Internal Branding: ARKAS Holding Case Study

    Directory of Open Access Journals (Sweden)

    Aysun KAHRAMAN

    2015-12-01

    Full Text Available İçsel markalaşma; çalışanların, çalıştıkları işletmenin marka vaadini, marka değerini anlaması ve benimsemesi sonucunda, dış müşterilerin de markayı daha kolay benimseyeceğini savunmaktadır. Bu çalışmanın amacı, ülkemiz literatüründe yeterince ele alınmamış olan içsel markalaşma olgusunu teorik temeller ve uygulama aşamaları açısından açıklığa kavuşturmaktır. Çalışmada ilk olarak markalaşmanın önemine ve markalaşma sürecinde çalışanların rollerine değinilmiştir. Daha sonra içsel markalaşma kavramı, içsel markalaşma uygulamalarında kullanılan teknikler ve araçlar teorik olarak incelenmiştir. Çalışmanın uygulama bölümü için bir hizmet işletmesi olan Arkas Holding’in iki yöneticisiyle, Arkas Holding’deki içsel markalaşma uygulamalarıyla ilgili olarak derinlemesine görüşmeler yapılmıştır. Yapılan görüşmeler sonrasında elde edilen bulgular değerlendirildikten sonra Arkas Holding’de içsel markalaşmanın önemi, içsel markalaşma uygulamalarının nasıl gerçekleştiği, bu süreçte dikkat edilmesi gereken unsurlar ve karşılaşılan zorluklar ortaya konulmuştur. Internal branding supports the idea that external customers will internalize the brand more easily if employees understand and adopt the brand promise and brand values of the company which they work for. The aim of this study is to clarify internal branding phenomenon, which which has not been discussed enough in the Turkish literature, in terms of literature and application areas. Firstly the study has discussed the importance of branding process and the role of employees in this process. Then, the concept of internal branding, the technics and the tools whics are used for application of internal branding is examined theoretically. In the application part in-depth interviews were conducted with two managers of Arkas Holding about internal branding activities in Arkas Holding. After

  1. ALIŞVERİŞ MERKEZLERİNİN ve SÜPER MARKET ZİNCİRLERİNİN YEREL GİRİŞİMCİLERE ETKİSİNİN DEĞERLENDİRİLMESİ: SAMSUN ÖRNEĞİ - SHOPPING MALLS AND SUPER MARKET CHAINS EVALUATION OF THE EFFECT OF LOCAL ENTREPRENEURS: THE CASE OF SAMSUN

    Directory of Open Access Journals (Sweden)

    Ayça Can KIRGIZ

    2014-03-01

    Full Text Available ÖzetAlışveriş merkezleri, insanlık tarihinde organize toplum yaşantısının oluşmaya başlaması ve güncel pazarlama yaklaşımlarının gelişmesiyle birlikte çeşitli biçim ve türlerde kendiliğinden ortaya çıkmış kompleks yapılardır. Temeli kapalı çarşı modellerine dayanan alışveriş merkezleri günümüzde tüketicilerin tercih ettikleri yapılar olmaktadır. Bu çalışmada, popüler kültürün bir parçası haline gelen ve hızla yayılan alışveriş merkezleri ve süper market zincirlerinin yerel girişimciler açısından olumlu ve olumsuz etkileri sundukları hizmetler açısından, sosyal ve kültürel imkanlar, rekabet, satış maliyetleri ve satış imkanları açısından teoriye bağlı kalarak tartışılmıştır. Samsun bölgesi merkez alınarak bu bölgede rastgele seçilmiş yerel girişimcilere “Alışveriş Merkezlerinin Yerel Girişimcilere Olumlu ve Olumsuz” etkileri ile ilgili derinlemesine mülakat yapılmıştır. Elde edilen veriler doğrultusunda yerel girişimciler ve alışveriş merkezleri/süper market zincirleri arasındaki ölümcül rekabet değerlendirilmiş ve çözüm önerilerinde bulunulmuştur.AbstractShopping malls are self-generated complex structures in various forms and types due to the emergence of organized communal life in the history of mankind and the development of recent marketing approaches. Based on the models of covered markets, shopping malls have become structures preferred by consumers at the present time. In this study, the positive and negative impacts of shopping malls and supermarket chains, each of which has become a part of popular culture and spreads like wildfire, on local entrepreneurs have been discussed on the basis of theoryrelated to social and cultural aspects, competition, sales costs and sales opportunities in terms of services rendered by shopping malls. As Samsun being placed in the center, randomly selected local entrepreneurs are

  2. TERMAL TURİZMDE TÜKETİCİ SATIN ALMA DAVRANIŞINI ETKİLEYEN FAKTÖRLERİN BELİRLENMESİ: GÖNEN ÖRNEĞİ - DETERMINATION OF THE FACTORS AFFECTING CONSUMER PURCHASE BEHAVIOR IN THERMAL TOURISM

    Directory of Open Access Journals (Sweden)

    Mehmet İLBAN

    2012-11-01

    Full Text Available Özet:Günümüzde turistik bölgeler arasında yaşanan yoğunrekabet, tüketicilerin satın alma davranışlarını etkileyebilmeyi,buna bağlı olarak benzersiz bir ürün yaratmayı ve ürününfarklılığını ortaya koyabilmeyi son derece önemli halegetirmiştir. Bu durum turistik bölgenin turist sayısı ve eldeedeceği gelir düzeyini de yakından ilgilendirmektedir.Dolayısıyla, tüketiciler açısından turistik bölge tercihinde satınalma davranışını etkileyen faktörlerin öncelikle nelerolduğunun tespiti ve tüketicilerin belirli özelliklerine görehedef pazarların belirlenmesi bu çabaları yerine getirmedemuhakkak ki oldukça önemli katkılar sağlayacaktır. Bunoktadan hareketle, demografik özelliklerine göre termalturizme yönelik tüketicilerin satın alma davranışlarınıetkileyen faktörlerin belirlenmesi amacıyla bir anket çalışmasıuygulanmıştır. Anketlerden elde edilen verilerden hareketle,turistik tüketicilerin satın alma davranışlarını etkileyenfaktörlerin öncelik sırasına göre şu şekilde sıralanmıştır;pazarlama çabaları, ekonomik faktörler, sosyal faktörler,psikolojik faktörler ve kişisel ve kültürel faktörler. Ayrıcaaraştırmada, turistik tüketicilerin demografik özelliklerinegöre satın alma davranışlarını etkileyen faktörleri algılamalarıarasında anlamlı farklılıklar bulunmuştur.Abstract:Today, fierce competition among the tourist areasmade affecting buying behavior of the consumers andcorrespondingly creating a unique product and putting forththe difference of the product extremely important. This case isa particular concern to tourist number of the tourist area andthe income level. Hence, firstly, from the perspective of touriststo choose a tourist place, determination of the factors affectingthe buying behaviors of the consumers and specifying thetarget markets according to the certain features of theconsumers, will make a significant contribution

  3. The Examination of Teacher Candidates’ Level of Proficiency in Technopedagogical Education [Öğretmen Adaylarının Teknopedagojik Eğitim Yeterliliklerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Berna Aygün

    2016-08-01

    Full Text Available The purpose of this study is to investigate preservice elementary mathematics teachers` techno pedagogical knowledge competencies and performance indicators defining these competencies. In this qualitative study, teaching practices which was prepared in learning domain such as numbers and operations, algebra, geometry and measurement, statistics and probability and with different dynamic mathematical software (GeoGebra, Cabri3D and Tinkerplots by 24 prospective mathematics teachers’ candidates were investigated. Data of study was collected through video records and lesson plans filled out by the prospective teachers after their teaching sessions. Data were analyzed within executing the teaching process and problem solving competency fields of technopedagogical education. Findings indicate that technology is used as an explorative tool for the first time in teaching the subject, technology based activities are prepared to prevent misconception; however, they were forced to use technology in assessment evaluation process. [Bu çalışmanın amacı ilköğretim matematik öğretmen adaylarının Teknopedagojik eğitim yeterliklerinin ve performans göstergelerinin incelenmesidir. Bu çalışmada öğretmen adaylarının sayılar ve işlemler, cebir, geometri ve ölçme, veri işleme ve olasılık öğrenme alanlarında GeoGebra, Cabri3D ve Tinkerplots gibi farklı dinamik matematik yazılımları kullanılarak hazırlanılan teknoloji destekli ders anlatımları incelenmiştir. 2013- 2014 güz ve bahar yarıyıllarında Karadeniz Bölgesi’nde bir devlet üniversitesinde ilköğretim matematik öğretmenliği 3. sınıfında öğrenim gören 24 öğretmen adayı ile yürütülen bu çalışmada nitel araştırma yöntemi ile desenlenmiştir. Öğretmen adaylarının ders anlatımlarının video kaydı alınmış ve çözümlemesi yapılmıştır. Video kayıtlarının çözümlenmesi ve adayların ders planlarından elde edilen veriler

  4. Türkiye’de Sanatçı Adayı Yetiştiren Yükseköğretim Kurumlarının 2000 Yılı Sonrası Gelişimi / Development of Turkish Higher Education Institutions Educating Candidate Artists After 2000

    Directory of Open Access Journals (Sweden)

    Evrim Çağlayan

    2017-04-01

    Full Text Available Abstract The aim of this study is to present the qualitative development of Turkish higher education institutions that educating candidate artists after 2000. Obtained data and documents were organized according to this development and were analyzed in order to provide current information about these higher education institutions. The study deals with two main themes. The first theme contains developments between 1983 and 2000, and the second theme contains developments between 2000 and 2016. In the study, it has been found that the number of higher education institutions that training candidate artists follow a steady increase after 2000 and their numbers reached to 70 in 2016. The relevant literature show that some faculties of fine arts were established without planning and analysis about the needs of academic and administrative staff, technical and spatial structure, employment opportunities after graduation. Because of this reason, these faculties could not reach a sufficient number of academic staff, could not provide the minimum physical conditions and could start education approximately 3 or 4 years after their establishment. Öz Bu çalışma, sanatçı adayı yetiştiren yükseköğretim kurumlarının 2000 yılı sonrası niceliksel gelişimini ortaya koymayı amaçlamaktatır. Çalışma ile ilgili elde edilen bilgi ve belgeler bu gelişim sürecine göre düzenlenmiş ve ilgili yükseköğretim kurumları hakkında güncel bilgileri sunmak amacıyla analiz edilmiştir. Çalışma bulguları iki ana tema üzerinden sunulmuştur. Birinci tema 1983-2000 yılları arasında yaşanan gelişmeleri, ikinci tema ise 2000 yılından günümüze kadar olan gelişmeleri kapsamaktadır. Çalışmada, sanatçı adayı yetiştiren yükseköğretim kurumlarının sayısının 2000 yılı sonrasında düzenli bir artış izlediği ve 2016 yılında 70’e yükseldiği tespit edilmiştir. Çalışma sonucunda; yeterli planlama, mezuniyet sonras

  5. Kurumsal Bilgi Sistemleri İçerisinde Belge Yönetimi: Türkiye’deki Kamu Üniversitelerinde Gerçekleştirilen Uygulamalara Yönelik Bir Durum Analizi=Records Management in Enterprise Information Systems: A Case Study Carried Out on the Practices in States Universities of Turkey

    Directory of Open Access Journals (Sweden)

    Özgür Külcü

    2013-12-01

    Full Text Available Bilgi toplumuna geçişle birlikte yönetim anlayışlarındaki değişiklikler, teknolojik olanaklar doğrultusunda geliştirilen standartlar, analiz araçları, düzenlemeler ve yasal uygulamalar kurumsal içeriğin yönetimine yeni boyutlar kazandırmaktadır. Günlük iş süreçlerini, iç işleyişleri ve çevre ile olan etkileşimler doğrultusunda yürüten kurumlar, sahip oldukları farklı bilgi kaynaklarına yönelik işlevler taşıyan sistemler geliştirmek, bu sistemlerden faydalanmak, bilgi sistemleri ile ilgili tüm gelişmeleri takip etmek durumundadırlar. Kurumsal işleyişlerini bilgi sistemleri ile yürüten üniversiteler sahip oldukları kurumsal yapılarla ön plana çıkmaktadırlar. Bu araştırma ile Türkiye’de üniversitelerdeki kurumsal bilgi ve belge sistemlerine yönelik uygulamalara ilişkin benzer ya da farklı yönlerin neler olduğu, uyum ve eşgüdüm sorunu yaşanıp yaşanmadığı, 22 üniversitede gerçekleştirilen yarı yapılandırılmış görüşmeler ve geliştirilen bir durum listesi aracılığıyla belirlenmeye çalışılmıştır. Araştırma kapsamında elde edilen bulgular, üniversitelerin kurumsal bilgi sistemlerinin yönetimine dönük uygulamalarında eksikliklerinin bulunduğunu, belge yönetim sistemleri ile ilgili süreçlerde iyileştirmelere ihtiyaç olduğunu ortaya çıkarmıştır./Changes in managerial approaches with the transition to information society, developed standards, assessment tools, legislations and regulations bring new dimensions to management of organizational information. Organizations managing daily workflows according to internal and external interactions, should use, develop and implement information systems that have different functions for different information assets. Furthermore, organizations should also follow updates related to information system. In this regard, universities with their organizational structures come into prominence among the

  6. The Study of Turkish Illustrated Story Books Published Between 1974-1993, from the Viewpoint of Physical Aspects 1974-1993 Yılları Arasında Türkçe Basılmış Olan Resimli Öykü Kitaplarının Resimlendirilme ve Fiziksel Özellikleri Yönünden İncelenmesi

    Directory of Open Access Journals (Sweden)

    Havise Çakmak Güleç

    1997-03-01

    kitap için, kitap adı, yazar ve resimleyenin adı-soyadı, kitabın yayın yeri ve yılı, resim, renklendirilme, metin ve resim ilişkisi, resimlendirilme özelliği ile ilgili bilgilerin yer aldığı bir "Kitap Kayıt Formu"na kaydedilmiştir. Araştırmanın sonucunda elde edilen bulgulara göre, örneklemi oluşturan Türkçe resimli öykü kitaplarının ciltleme, kapak türü, kağıt kalitesi ve renklendirilme yönünden genelde yetersiz oldukları belirlenmiştir. Ancak, boyut, resim, resimlendirilme özelliği, metin ve resim ilişkisi yönünden ise iyi durumda oldukları saptanmıştır.

  7. Türkiye’de Halk Kütüphanesi Hizmetlerinin Özel İdarelere Devri Konusunda Özel İdare Yöneticilerinin Görüşleri

    Directory of Open Access Journals (Sweden)

    Orhan Açıkgöz

    2013-11-01

    Full Text Available Bu çalışma, “Türkiye’de halk kütüphanelerinin özel idarelere devri konusunda özel idare yöneticilerinin yaklaşımlarını ortaya koyarak, özel idareler açısından devrin gerçekleştirilmesi için uygun koşulların var olup olmadığını belirlemek” amacıyla hazırlanmıştır. Türkiye’deki tüm il ve ilçe özel idareleri araş­tırma evrenini oluşturmaktadır. Buna göre, 81 il ve 892 ilçe olmak üzere araştırma evrenini oluşturan toplam özel idare sayısı 973’tür. Araştırma için hazırlanan anketler, 15.11.2011 15.01.2012 tarihleri arasında Türkiye’deki 81 il özel idaresi ile bu illerden seçilmiş 81 ilçe özel idaresine gönderilmiştir. Bunlardan 66 il ve 59 ilçe özel idare yöneticisi, anketleri yanıtlayarak araştırmaya katılmış ve böylece evren toplam 125 özel idare ile örneklenmiştir. Araştırmadan elde edilen sonuçlara göre, Türkiye’de özel idare yöneticilerinin var olan koşullarda halk kütüphanelerinin özel idarelere devredilmesini istemediği ortaya çıkmıştır. Özel idare yöneticileri ayrıca devrin gerçekleşmesi halinde halk kütüphanesi hizmetle­rinde genel olarak bir değişiklik olmayacağına ve halk kütüphanesinin özel idareler için gereksiz yükler getireceğine inanmaktadırlar. Buna karşın, özel idare yöneticileri, devrin gerçekleşmesi halinde özel idarelerin halk kütüphanelerine yeterli desteği ve önemi vereceğini düşünmektedirler.

  8. İdarenin Kusursuz Sorumluluğu Çerçevesinde Tehlike ve Sosyal Risk İlkesi / The Absence of Strict Liability of Administration in case of Danger and Social Risk

    Directory of Open Access Journals (Sweden)

    Arzu Dilaveroğlu

    2017-06-01

    Full Text Available Abstract The aim of this study is to examine the principles of risk (risk and social risk that lead to the absence of strict liability of the administration. The main questions to be addressed in this study, which is prepared by the descriptive method, are the meaning of the concept of strict liability and under which circumstances it is possible to assume strict liability of the administration in the framework of the risk and social risk principles. The information obtained within the scope of the study suggest that administration is responsible for damages arising out of danger and social risk, even though it is impeccable, besides the legal regulations regarding cases where the administration is defective in their actions and transactions. This is called the principle of strict liability in the literature. The study included a discussion of the fact that in order to be able to be held responsible in the framework of the danger and social risk, the relationship between the actions of the administration and the incident occurred should be found, the expectation from the administration could not be met that the damage could be prevented by the administration before it emerges and the socalled damage arises as a consequence of social life. Öz Bu çalışmanın temel amacı, idarenin kusursuz sorumluluğuna neden olan tehlike (risk ve sosyal risk ilkelerinin incelenmesidir. Betimleyici kaynak taraması yöntemi ile hazırlanan bu çalışmada üzerinde durulacak temel sorular, kusursuz sorumluluk kavramının ne olduğu, tehlike ve sosyal risk ilkesi kapsamında hangi durumlarda idarenin kusursuz sorumluluğuna hükmedilebileceğidir. Çalışma kapsamında elde edilen bilgiler, idarenin eylem ve işlemlerinde kusurlu olduğu durumlara ilişkin yasal düzenlemelerin yanında, kusursuz olmasına rağmen tehlike ve sosyal risk gereği ortaya çıkan zararlardan dolayı da sorumlu olduğunu ortaya koymuştur. Buna literatürde kusursuz sorumluluk

  9. EVALUATION OF THE READINESS LEVEL OF STUDENTS IN GEOGRAPHY LESSON IN REGARD TO TEACHERS’ VIEWS ÖĞRENCİLERİN COĞRAFYA DERSİNDE HAZIR BULUNUŞLULUK DÜZEYLERİNİN ÖĞRETMEN GÖRÜŞLERİNE GÖRE DEĞERLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Mehmet Fatih KAYA

    2011-12-01

    Full Text Available In this study, it was aimed to reveal views of geography teachers aboutstudents’ readiness level’s influence on geography education process.A semi-structured interview technique as one of qualitative researchmethods was utilized in this study. Sample of the study consisted of 17geography teachers that work in schools of Gaziantep city centre. Frominterviews extracted data was analysed by descriptive and content analysis.As a result of the research it has been determined that, as studentreadiness level at Anatolian Highschools are at sufficient level, its counterpart onnormal and vocational high schools is lower then expected. The main reasons ofthe lowness of the student readiness level was determined as student, parent,environment, class, class size, tools and administration based reasons. From thepoint of the research there has been made some suggestions. Bu çalışmada; coğrafya öğretmenlerinin, öğrencilerin hazırbulunuşluluk düzeylerinin coğrafya eğitim-öğretim sürecinde ne tür bir etkiyesahip olduğu konusundaki görüşlerinin ortaya konulması amaçlanmıştır.Bu çalışmada, nitel araştırma yöntemlerinden olan yarı-yapılandırılmışgörüşme tekniği kullanılmıştır. Araştırmanın çalışma grubunu Gaziantep ilmerkezinde görev yapmakta olan 17 coğrafya öğretmeni oluşturmaktadır.Görüşme yoluyla elde edilen veriler betimsel ve içerik analiz yöntemlerikullanılarak analiz edilmiştir.Araştırma sonucunda öğrencilerinin hazır bulunuşluluklarının Anadoluliselerinde yeterli düzeyde olduğu, düz ve meslek lise türlerinde ise istenendüzeyden düşük olduğu saptanmıştır. Hazır bulunuşluluk düzeyinin yetersizliğinnedenleri; öğrenci, veli, çevre, sınıf, sınıf mevcudu, araç-gereç ve yöneticikaynaklı olduğu tespit edilmiştir. Araştırma sonuçlarından hareketle bazıönerilerde bulunulmuştur.

  10. ALIŞVERİŞ MERKEZLERİNİN ve SÜPER MARKET ZİNCİRLERİNİN YEREL GİRİŞİMCİLERE ETKİSİNİN DEĞERLENDİRİLMESİ: SAMSUN ÖRNEĞİ - SHOPPING MALLS AND SUPER MARKET CHAINS EVALUATION OF THE EFFECT OF LOCAL ENTREPRENEURS: THE CASE OF SAMSUN

    Directory of Open Access Journals (Sweden)

    Ayça Can KIRGIZ

    2014-01-01

    Full Text Available ÖzetAlışveriş merkezleri, insanlık tarihinde organize toplum yaşantısının oluşmaya başlaması ve güncel pazarlama yaklaşımlarının gelişmesiyle birlikte çeşitli biçim ve türlerde kendiliğinden ortaya çıkmış kompleks yapılardır. Temeli kapalı çarşı modellerine dayanan alışveriş merkezleri günümüzde tüketicilerin tercih ettikleri yapılar olmaktadır. Bu çalışmada, popüler kültürün bir parçası haline gelen ve hızla yayılan alışveriş merkezleri ve süper market zincirlerinin yerel girişimciler açısından olumlu ve olumsuz etkileri sundukları hizmetler açısından, sosyal ve kültürel imkanlar, rekabet, satış maliyetleri ve satış imkanları açısından teoriye bağlı kalarak tartışılmıştır. Samsun bölgesi merkez alınarak bu bölgede rastgele seçilmiş yerel girişimcilere “Alışveriş Merkezlerinin Yerel Girişimcilere Olumlu ve Olumsuz” etkileri ile ilgili derinlemesine mülakat yapılmıştır. Elde edilen veriler doğrultusunda yerel girişimciler ve alışveriş merkezleri/süper market zincirleri arasındaki ölümcül rekabet değerlendirilmiş ve çözüm önerilerinde bulunulmuştur.AbstractShopping malls are self-generated complex structures in various forms and types due to the emergence of organized communal life in the history of mankind and the development of recent marketing approaches. Based on the models of covered markets, shopping malls have become structures preferred by consumers at the present time. In this study, the positive and negative impacts of shopping malls and supermarket chains, each of which has become a part of popular culture and spreads like wildfire, on local entrepreneurs have been discussed on the basis of theoryrelated to social and cultural aspects, competition, sales costs and sales opportunities in terms of services rendered by shopping malls. As Samsun being placed in the center, randomly selected local entrepreneurs are

  11. Kayıp verilerin varlığında çoktan seçmeli testlerde madde ve test parametrelerinin kestirilmesi: SBS örneği [Item and test parameters estimations for multiple choice tests in the presence of missing data: The case of SBS

    Directory of Open Access Journals (Sweden)

    Ergül DEMİR

    2014-10-01

    Full Text Available Bu çalışmada, kayıp verilerin varlığında, çoktan seçmeli testlerde, farklı kayıp veri yöntemleri kullanılarak kestirilen madde ve test parametreleri arasındaki ilişkilerin incelenmesi ve bu tür testlerde kullanılması uygun olan kayıp veri yöntemlerinin belirlenmesi amaçlanmıştır. Temel araştırma türünde, ilişkisel tarama modelinde bir araştırma olarak tasarlanan bu çalışmada, analizler 527517 yanıtlayıcıya yönelik SBS (Seviye Belirleme Sınavı 2011 Matematik Testi A Kitapçığı verileri üzerinde yürütülmüştür. Veri analizlerinde silmeye dayalı yöntemlerden ‘dizin silme yöntemi’, basit atama yöntemlerinden ‘0 atama’, ‘seri ortalamaları ataması’, ‘gözlem birimi ortalaması ataması’, ‘yakın noktalar ortalama ataması’, ‘yakın noktalar medyan ataması’, ‘doğrusal interpolasyon’ ve ‘dorusal eğilim noktası ataması’ yöntemleri, en çok olabilirlik yöntemlerinden ‘regresyon atama’, ‘beklenti-maksimizasyon algoritması’ ve ‘veri çoğaltma’ yöntemleri, çoklu veri atama yöntemlerinden ise ‘Markov zincirleri Monte Carlo’ yöntemi olmak üzere 12 farklı kayıp veri yöntemi kullanılmıştır. Elde edilen bulgular, kayıp verilerin ihmal edilebilir olmaması durumunda çoktan seçmeli testlere yönelik istatistiksel kestirimlerde, uygun bir kayıp veri yönteminin kullanılmasının gerekli olduğunu göstermektedir. Silmeye dayalı yöntemler ve 0 Atama yöntemi, bu tür veriler için uygun yöntemler değildir. Basit atama yöntemlerinin ise yanlı kestirimler üretme olasılığı yüksektir. En çok olabilirlik ve çoklu veri atama yöntemleri, bu tür verilerde kullanılması en uygun kayıp veri yöntemleri olarak değerlendirilmektedir.

  12. FROM MOODS OF "MUREBBİYE" TO NARRATION OF HUSEYIN RAHMI GURPINAR HÜSEYİN RAHMİ GÜRPINAR'IN “MÜREBBİYE”SİNİN HALLERİNDEN ANLATININ UNSURLARINA

    Directory of Open Access Journals (Sweden)

    İbrahim TÜZER

    2011-09-01

    Full Text Available Artist, belonging to whichever era or period, feels, perceives and is willing to publish humane values via work of art. By this point of view an artist tries to let his readers feel the realities of the society he lives in and the realities of the work of art in his aesthetic perspective combining it with narrative aspects of tragedy or conflict. As the primary addressee of the work of art, the reader acquires a lot in accordance with the strength of the ties between the text and his journey facing his self realiance moving away from this relative authenticity.Hüseyin Rahmi Gürpınar is one of our writers publishing works of art in view of this interaction summarized as artist, work of art and the reader. In his book called ‘Mürebbiye’, he points out to what happened to the children of the Ottoman families trying to get westernized as they handled their children to the hands of so-called French mentors without knowing where and how this form of education comes from. In this article, this successfully narrated novel will be analyzed through chain of events. Hangi dönemin ya da devrin insanı olursa olsun "sanatkâr", hisseden, fark eden ve insanî olana ilişkin değerleri "sanat eseri" vasıtasıyla duyurmak isteyen kişidir. Bu yönüyle sanatkâr, içerisinde yaşamış olduğu toplumun gerçekliğiyle meydana getirdiği eserinin estetize edilmiş gerçekliğini, trajedi ya da çatışma da diyebileceğimiz anlatı unsurlarıyla birleştirerek "okur"una hissettirmeye çalışır. Sanat eserinin birincil muhatabı olarak okur ise edebi metinle kurabildiği bağ ölçüsünde bu itibari gerçeklikten hareket ederek kendi gerçekliğiyle yüzleşme yolunda önemli kazanımlar elde eder. Hüseyin Rahmi Gürpınar da yukarıda kısaca işaret edilen "sanatkâr", "sanat eseri" ve "okur" etkileşimi dolayımında eser kaleme alan yazarlarımızdandır. Yaşadığı dönem içerisinde tanık olduğu "Batılılaşmak!" isteyen Osmanl

  13. Sosyal Bilgiler Öğretiminde Kullanılan Bilgisayar Temelli Materyallerin 6. Sınıf Öğrencilerinin Dikkat Düzeylerine Etkisinin Elektroansefalografi Cihazı Aracılığıyla Tespiti / Determination of the Effects of Computer Based Instructional Materials Used in Social Studies Education of Sixth Grade Students' Attention Levels via Using an Electroencephalography Device

    Directory of Open Access Journals (Sweden)

    Yusuf İnel

    2017-09-01

    Full Text Available Abstract The purpose of this research is to investigate the effects of computer-based instructional materials used in social study courses of sixth grade attention levels via an electroencephalography device. In this study, a time series design was employed. The study group was composed 21 volunteer students who were allowed sixth grade in a public secondary school located in the Central District of Uşak province during the 2013-2014 academic year. NeuroSky's MindWave - EEG device was used as data collection tool in the study. "PYTHON" and "MATLAB" programs were used for the analysis of the obtained data. As a result of the research, prezi presentation, digital graphics, digital map, documentary and animation were found to increase the attention level of the students. Apart from the purpose of the research, the levels of attention dropped when the questions were asked students. According to the printed maps, digital maps increase students' attention and the hand movements of the teacher in the class is also effective in the attention levels of the students.   Öz Bu araştırmanın amacı, sosyal bilgiler dersinde kullanılan bilgisayar temelli materyallerin 6. sınıf öğrencilerinin dikkat düzeylerine etkisinin tespit edilmesidir. Yarı deneysel modellerden zaman serisi deneysel deseni şeklinde gerçekleştirilen araştırmanın çalışma grubunu 2013–2014 eğitim - öğretim yılında, Uşak ili Merkez İlçesinde yer alan bir devlet ortaokulunda öğrenim gören 6. sınıflar arasından ailelerinden izin alınan 21 gönüllü öğrenci oluşturmuştur. Araştırmada veri toplama aracı olarak NeuroSky’s MindWave - EEG cihazı kullanılmıştır. Elde edilen verilerin çözümlenmesinde, “PYTHON” ve “MATLAB” programlarından yararlanılmıştır. Araştırma sonucunda, hazırlanan Prezi sunumu, dijital grafik, dijital harita, belgesel ve animasyonun öğrencilerin dikkat düzeyini artırdığı bulgusuna ula

  14. Kargo Kullanıcılarının Önem Verdikleri Faktörlerin, Kargo Firmaları Tarafından Başarım Düzeylerinin İncelenmesi / The Achievement Level of Factors which Cargo Users Care about by Cargo Companies

    Directory of Open Access Journals (Sweden)

    Ali Çağlar Çakmak

    2017-10-01

    Full Text Available Abstract The service which is provided by courier companies that we often use in our daily life has a great importance for their customers. To deliver a received or sent cargo on time without having damage is one of the most effective factors that comprise this importance. From this point of view, the main purpose of this study is to determine the services that the customers set great care about and to find out to what extent can the courier companies fulfill these demands. For this purpose, in this study the evaluation of the companies by the customers are assessed by using importance-performance analysis. According to the obtained results, the factors which the customers set care the most are; “delivering the post without any deficiency”, “not to open” and “delivering to designated address”. The least important factors are; “to ask help while carrying the cargo”, “the physical conditions of the company” and “applying existing campaigns”. When we look at the courier companies, through the most preferred three companies: Yurtiçi Cargo, Aras Cargo and PTT Cargo, “PTT Cargo” has the highest performance average while “Yurtiçi Cargo” has the lowest.   Öz Günlük hayatımızda sıklıkla kullandığımız kargo firmalarının verdikleri hizmet, bu hizmeti alan kullanıcıları için büyük önem arz etmektedir. Gönderilen veya alınan kargonun zamanında teslim edilmesi, herhangi bir hasar görmemesi de bu önemin oluşmasındaki en etkili unsurlardandır. Buradan hareketle bu çalışmanın ana amacı, kullanıcıların en çok önem verdikleri hizmetlerin belirlenmesi ve çalıştıkları kargo firmalarının bu hizmetleri ne ölçüde yerine getirebildiklerinin ortaya çıkarılmasıdır. Bu amaçla, bu çalışmada kullanıcıların kargo firmalarını değerlendirmeleri önem-başarım analizi kullanılarak ölçülmüştür. Elde edilen sonuçlara göre kullanıcıların en çok önem verdiği unsurlar; g

  15. Bilişsel - Duyuşsal Odaklı Bir Programın ilköğretim Öğrencilerinin Fiziksel Engelli Yaşıtlarına Yönelik Sosyal Kabul Düzeylerine Etkisinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Canan Aktaş

    2002-07-01

    Full Text Available Bu araştırmanın amacı bilişsel ve duyuşsal odaklı etkinlikleri içeren bir programın ilköğretim öğrencilerinin fiziksel engelli yaşıtlarına yönelik sosyal kabul düzeyleri üzerindeki etkisini incelemektir. Araştırmaya deney ve kontrol gruplarında 20'şer öğrenci olmak üzere toplam 40 öğrenci (6., 7'., ve 8. sınıf katılmıştır. Deney grubunu II kız 9 erkek, kontrol grubunu ise 9 kız, 11 erkek öğrenci oluşturmuştur. Öğrencilerin fiziksel engelli yaşıtlarına yönelik sosyal kabul düzeyleri program öncesi ve sonrasında Sosyal Kabul Ölçeği ile değerlendirilmiştir. Deney grubundaki öğrencilere haftada iki gün 90 dakika süreli 7 oturumdan oluşan bir program uygulanmıştır. Programda, öğrencilere fiziksel engelli bireyler hakkında bilgi verme, film gösterme, grup tartışması, görme engelli bir bireyle doğrudan etkileşimde bulunma ve engel durumunu canlandırma etkinliklerine yer verilmiştir. Analiz sonuçları, uygulanan programın deney grubundaki öğrencilerin fiziksel engelli yaşıtlarına yönelik sosyal kabul düzeylerini geliştirmede etkili olduğunu göstermiştir. Araştırmada elde edilen bu bulgu, engelli Öğrencilerin normal okul ortamlarında başarılı bir biçimde kaynaştırılmaları açısından benzer programların gerekliliğine işaret etmektedir. The purpose of this study is to investigate the effects of an intervention program, incorporated cognitive and affective activities on social acceptance level of physically disabled children by their nonhandicapped peers, at 6"' to Slh grade. A total of 40 students. 20 for experimental (II female and 9 male and 20 for control group (9 female and 11 male participated in the study. The Social Acceptance Scale was administered to both groups before and after the program. The program, applied lo the experimental group, was held two times a week for ninety minutes per day for seven weeks. Provision of information about

  16. The Potential of GeoGebra Dynamic Mathematics Software in Teaching Analytic Geometry: The Opinion of Pre-service Mathematics Teachers [Analitik Geometri Öğretiminde GeoGebra Yazılımının Potansiyeli: Öğretmen Adaylarının Görüşleri

    Directory of Open Access Journals (Sweden)

    Serdal Baltacı

    2016-12-01

    Full Text Available The potential of GeoGebra in teaching analytic geometry concepts was investigated in this paper. The study carried out with case study methodology and the participants were 6 pre-service mathematics teachers at 3rd grade of elementary mathematics education. All of the participants had the skill of well self-expression and they were volunteers for interview. Two participants were at high achievement levels, two participants were at medium achievement levels and two participants were low achievement levels. While carrying out each lesson, participants used worksheets which were prepared by the researchers. The data were obtained by semi-structured interviews which were carried out at the end of the courses and the data were analyzed with content analysis method. Research results showed that using dynamic mathematics software while studying on analytic geometry provides convenience for the participants and they felt more active while they were using software in the learning environment. [Bu çalışmada, analitik geometri kavramlarının öğretiminde GeoGebra’ nın potansiyeli incelenmiştir. Özel durum çalışması yöntemiyle yürütülen bu araştırmanın katılımcılarını, ilköğretim matematik öğretmenliği 3. sınıfa devam eden 6 öğretmen adayı oluşturmaktadır. Katılımcılar kendini ifade etme becerisi yüksek, mülakata gönüllü ve farklı başarı düzeyinde (yüksek, orta, düşük olan ikişer öğretmen adayından oluşmaktadır. Çalışmada analitik geometri dersleri, araştırmacılar tarafından geliştirilen çalışma yaprakları kullanılarak yürütülmüştür. Araştırmanın verileri derslerin sonunda yapılan yarı yapılandırılmış mülakatlarla toplanmıştır. Araştırmadan elde edilen veriler, içerik analizi yöntemi ile analiz edilmiştir. Araştırma sonuçları öğretmen adaylarının analitik geometri kavramlarını öğrenmede yazılımı kullanmalarının onlara kolaylık sa

  17. ŞEHİR İÇİ DENİZYOLU ULAŞIMINDA MÜŞTERİLERİN HİZMET ALGISI VE MEMNUNİYETİ: BİR UYGULAMA - CUSTOMER’S PERCEPTION OF SERVICE AND SATISFACTION IN MARITIME TRANSPORT IN THE CITY: AN APPLICATION

    Directory of Open Access Journals (Sweden)

    Mustafa KARADENİZ

    2014-07-01

    Full Text Available ÖzetTaşımacılık ve ulaştırma sektörü lojistiğin önemli bir faaliyet alanıdır. Teknolojide ve hizmet sektöründeyaşanan gelişmeler bu sektörü de her yönüyle değiştirmiştir. Müşteri memnuniyetini sağlamak rekabetgücünü arttırmada en etkili faktörlerden biridir. Günümüz çağdaş rekabet dünyasında ulaştırma sektöründede büyük bir çekişme mevcuttur. Bu gelişmeleri göz önünde bulunduran işletmeler, insanların hizmetalgısı-memnuniyet ilişkisine önem vermeye başlamıştır. İşletmeler, müşteri memnuniyetini sağlamak içinmüşterilerinin alışkanlıklarını, beklentilerini, algılarını ve sosyo-demografik özelliklerini iyi tespit etmeyeçalışmaktadırlar.Yapılan bu çalışmanın literatür bölümünde lojistik, taşımacılık, şehir içi deniz yolu taşımacılığı, hizmetkavramı ve müşteri memnuniyeti üzerinde durulmuş ve İstanbul Şehir Hatları hakkında genel bilgiverilmiştir. Araştırmanın uygulama kısmında ise İstanbul Şehir Hatlarını kullanan 396 müşterinin, sunulanhizmete ilişkin algısı ve memnuniyetleri incelenmiştir. Veri toplama yöntemi olarak anket kullanılmış, anketverileri frekans analizi, güvenilirlik analizi, faktör analizi, t-testi, Anova, korelasyon analizi ve regresyonanalizine tabi tutularak araştırmadan elde edilen sonuçlar yorumlanmıştır.AbstractThe transportation sector is one of the important activity field in logistics. Developments in technologyand the service sector has changed every aspect of this industry. Customer satisfaction is one of the most important factor in increasing competitiveness. In today’s modern competitive world, there is also a greatcontention in the transportation sector. Considering these developments, businesses began to give attentionto the relationship between the service perception and satisfaction of people. Business tries to identifycustomers’ habits, expectations, perceptions and socio

  18. ŞEHİR İÇİ DENİZYOLU ULAŞIMINDA MÜŞTERİLERİN HİZMET ALGISI VE MEMNUNİYETİ: BİR UYGULAMA - CUSTOMER’S PERCEPTION OF SERVICE AND SATISFACTION IN MARITIME TRANSPORT IN THE CITY: AN APPLICATION

    Directory of Open Access Journals (Sweden)

    Mustafa KARADENİZ

    2014-08-01

    Full Text Available ÖzetTaşımacılık ve ulaştırma sektörü lojistiğin önemli bir faaliyet alanıdır. Teknolojide ve hizmet sektöründeyaşanan gelişmeler bu sektörü de her yönüyle değiştirmiştir. Müşteri memnuniyetini sağlamak rekabetgücünü arttırmada en etkili faktörlerden biridir. Günümüz çağdaş rekabet dünyasında ulaştırma sektöründede büyük bir çekişme mevcuttur. Bu gelişmeleri göz önünde bulunduran işletmeler, insanların hizmetalgısı-memnuniyet ilişkisine önem vermeye başlamıştır. İşletmeler, müşteri memnuniyetini sağlamak içinmüşterilerinin alışkanlıklarını, beklentilerini, algılarını ve sosyo-demografik özelliklerini iyi tespit etmeyeçalışmaktadırlar.Yapılan bu çalışmanın literatür bölümünde lojistik, taşımacılık, şehir içi deniz yolu taşımacılığı, hizmetkavramı ve müşteri memnuniyeti üzerinde durulmuş ve İstanbul Şehir Hatları hakkında genel bilgiverilmiştir. Araştırmanın uygulama kısmında ise İstanbul Şehir Hatlarını kullanan 396 müşterinin, sunulanhizmete ilişkin algısı ve memnuniyetleri incelenmiştir. Veri toplama yöntemi olarak anket kullanılmış, anketverileri frekans analizi, güvenilirlik analizi, faktör analizi, t-testi, Anova, korelasyon analizi ve regresyonanalizine tabi tutularak araştırmadan elde edilen sonuçlar yorumlanmıştır.AbstractThe transportation sector is one of the important activity field in logistics. Developments in technologyand the service sector has changed every aspect of this industry. Customer satisfaction is one of the most important factor in increasing competitiveness. In today’s modern competitive world, there is also a greatcontention in the transportation sector. Considering these developments, businesses began to give attentionto the relationship between the service perception and satisfaction of people. Business tries to identifycustomers’ habits, expectations, perceptions and socio

  19. Lise Öğrencilerinde Okulu Bırakma Eğilimi ve Nedenleri / Dropout Tendency among High School Students and its Reasons

    Directory of Open Access Journals (Sweden)

    Hüseyin ŞİMŞEK

    2011-12-01

    Full Text Available Bu araştırmanın amacı, Güneydoğu Anadolu Bölgesindeki lise öğrencilerinin okulu bırakma eğilimlerini belirlemek ve okulu bırakma eğilimine etki eden faktörleri saptamaktır. Araştırmaya Güneydoğu Anadolu Bölgesinde yer alan sekiz il merkezinde toplam 54 lisede farklı sınıflarda okuyun ve seçkisiz olarak belirlenen 1106 öğrenci katılmıştır. Araştırma verileri araştırmacı tarafından hazırlanan bir anketle toplanmıştır. Verilerin analizinde değişkenlere bağlı olarak frekans ve yüzdeler dikkate alınmış, anlamlı farklılık aranan durumlarda, kay kare tekniğinden yararlanılmıştır. Araştırma bulguları, okulu bırakma eğiliminin başta kişisel özellikler olmak üzere, aile özellikleri, eğitim sistemi, okul ve öğretmen gibi çeşitli değişkenlerin etkilediği karmaşık bir süreç sonunda gerçekleştiğini göstermiştir. Elde edilen bulgulara göre Güneydoğu Anadolu Bölgesindeki lise öğrencilerinin % 17’si şimdi ya da geçmişte okul bırakmayı düşündüğünü belirtmiştir. Okulu bırakma eğilimi en fazla lise 3. sınıfta görülmektedir. Kız öğrencilerde erkek öğrencilere oranla okulu bırakma eğilimi belirgin biçimde düşüktür. Çok çocuklu ailelerden gelen lise öğrencilerinin okulu bırakma eğilimleri az çocuklu aileden gelenlere oranla daha yüksektir. Öğretmenden ve okuldan memnuniyet oranı azaldıkça okulu bırakma olasılığı belirgin biçimde artmaktadır.

  20. Burdur İli Anason (Pimpinella anisum L., Kişniş (Coriandrum sativum L. ve Rezene (Foeniculum vulgare Mill. Agro-Ekosistemlerinde Böcek Biyolojik Çeşitliliklerinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Gökhan AYDIN

    2014-02-01

    Full Text Available Bu çalışma, Burdur ilinde kültürü yapılan önemli tıbbi ve aromatik bitkilerden pestisit uygulaması yapılmayan ve periyodik olarak münavebe yöntemi uygulanan anason (Pimpinella anisum L., kişniş (Coriandrum sativum L. ve rezene (Foeniculum vulgare Mill. agro-ekosistemlerinde böcek biyolojik çeşitliliklerinin araştırılması amacı ile böcek aktivitesinin yoğun olduğu 2009 yılı nisan ve eylül ayları arasında yapılmıştır. Çukur tuzak örnekleme yönteminin uygulandığı habitatlardaki böcek biyolojik çeşitlilik değerleri Shannon-Wiener ve Simpson çeşitlilik, Simpson dominantlık, Shannon Populasyon yoğunluk ilişkisi parametreleri kullanılarak hesaplanmıştır. Buna göre hesaplanan biyolojik çeşitlilik indekslerinde rezene agro-ekosisteminde hem Shannon-Wiener hem de Simpson çeşitlilik indeks değerleri sırası ile 2.5838 ve 0.8742 ile diğer agro-ekosistemlere göre en yüksek bulunmuştur. Simpson dominantlık parametre sonucuna göre ise 0.2025 değeri ile kişniş agro-ekosistemi, anason ve rezene agro-ekosistemlerine göre dominantlığın en yüksek olduğu tarım alanı olarak belirlenmiştir. Habitatlardaki populasyon yoğunluk ilişkisi incelendiğinde Shannon Evenness değeri anason agro-ekosisteminde en dengeli olarak bulunmuş ve 0.7333 olarak hesaplanmıştır. Bu sonuçlara göre pestisit uygulaması yapılmayan ve periyodik olarak münavebe yöntemi uygulanan agro-ekosistemlerdeki böcek türleri ve birey sayılarından elde edilen çeşitlilik değerlerinin doğal habitatlara benzerlik gösterdiği ortaya çıkartılmıştır. Anahtar kelimeler: Tür Zenginliği, Shannon-Wiener Çeşitlilik, Simpson Dominantlık, Populasyon Yoğunluk İlişkisi, Çukur Tuzak

  1. PSİKOLOJİK SERMAYE ÖLÇEĞİNİN GEÇERLİLİK VE GÜVENİLİRLİK ÇALIŞMASI

    Directory of Open Access Journals (Sweden)

    Turhan ERKMEN

    2013-02-01

    Full Text Available PSİKOLOJİK SERMAYE ÖLÇEĞİNİN GEÇERLİLİK VE GÜVENİLİRLİK ANALİZİÖzet: Bu çalışmada, Fred Luthans ve arkadaşları (2007 tarafından geliştirilen Psikolojik Sermaye Ölçeği’nin (Psychological Capital Scale Türkçe uyarlamasını yapmak, geçerlilik ve güvenilirlik analizini gerçekleştirmek amaçlanmıştır. Ülkemizde yapılan bu çalışma, Örgütsel Davranış literatüründe önemli bir kavram olan Psikolojik Sermaye ile ilgili yapılacak çalışmalara da referans olabilecektir. Çalışma, bilişim sektöründe çalışan toplam 158 kişi ile gerçekleştirilmiştir. Ölçeğin geçerlilik çalışmaları için doğrulayıcı faktör analizi, güvenilirlik çalışmaları için ise iç tutarlılık analizleri yapılmıştır. Elde edilen sonuçlara göre, psikolojik sermaye kavramının; orijinal ölçekteki faktör yapısından farklı olarak 3 faktörle ifade edildiği, bu faktörlerin de öz-yeterlilik, umut ve iyimserlik olduğu, psikolojik dayanıklılık boyutunun ortadan kalktığı, ölçeğin Türkçe versiyonunun uygulama alanı çerçevesinde güvenilir ancak geçerli olmadığı sonucu bulunmuştur.VALIDITY AND RELIABILITY STUDY OF THE PSYCHOLOGICAL CAPITAL SCALEAbstract: The purpose of the study is to adapt Psychological Capital Scale into Turkish and to conduct validity and reliability analysis of the Scale which was developed by Fred Luthans and his colleagues (2007. This study intends to be referred to the future studies in our country as psychological capital has become an important concept in the field of Organizational Behavior. The study was conducted among 158 employees who work in information sector. For validity studies, confirmatory factor analysis; for internal consistency, reliability analyses were performed. According to the results of the study, it was found that psychological capital was explained by 3 factors in contrast to the 4 factors of the original scale. The factors remained

  2. Öğretmen Adaylarının Öğrenme Stilleri İle Çevre Eğitimi Öz-Yeterlikleri Arasındaki İlişki / Relationship between the Self Efficacy Beliefs towards Environmental Education and the Learning Styles of Pre-service Teachers

    Directory of Open Access Journals (Sweden)

    Mustafa KAHYAOĞLU

    2011-12-01

    Full Text Available Bu çalışmanın amacı, öğretmen adaylarının öğrenme stilleri ile çevre eğitimine yönelik öz-yeterlikleri arasındaki ilişkinin ortaya konulmasıdır. Araştırma Siirt Üniversitesi Eğitim Fakültesi Sınıf ve Fen Bilgisi öğretmenliği programlarında öğrenim gören toplam 235 (109 kadın, 126 erkek öğretmen adayı ile gerçekleştirilmiştir. Veriler 2010-2011 eğitim öğretim güz yarıyılında Özdemir ve ark (2009 tarafından geliştirilen “Çevre Eğitimi Öz-Yeterliği Ölçeği” ve Kolb (1984 tarafından geliştiren, Aşkar ve Akkoyunlu (1993 tarafından Türkçeye uyarlanan “Öğrenme Stilleri Envanteri" kullanılarak toplanmıştır. Elde edilen bulgulara göre, öğretmen adaylarının çevre eğitimi öz-yeterlikleri orta düzeydedir ve Fen Bilgisi öğretmenliği programında öğrenim gören öğretmen adaylarının çevre eğitimi öz-yeterlikleri Sınıf öğretmenliği programında öğrenim gören öğretmen adaylarına göre daha yüksektir. Fen Bilgisi ve Sınıf öğretmenliği programında öğrenim gören öğretmen adayları en fazla ayrıştıran ve özümseyen öğrenme stillerine sahiptir. Ayrıca Fen Bilgisi ve Sınıf öğretmenliği öğretmen adaylarının çevre eğitimi öz-yeterlikleri ile öğrenme stilleri arasında anlamlı bir farklılık yoktur.

  3. Functional food products and ingredients with the increasing varieties in the world markets have enlarged

    Directory of Open Access Journals (Sweden)

    Emin Yılmaz

    2015-12-01

    Full Text Available Fonksiyonel gıda ürünleri ve hammaddeleri dünya marketlerinde artan çeşitleriyle her gün pazar paylarını artırmaktadır. Genel olarak, bir ürünün fonksiyonel sayılabilmesi için, temel fiziyolojik görevlerine ek olarak, hastalıklara karşı koruyucu ve/veya tedavi edici etki göstermesi ve bu etkinin verilerle ispatlanması zorunludur. Gıda sektöründe bu kapsamda, doğal fonksiyonel ürünler, formülasyonla hazırlanmış ürünler ve hammaddeler kullanılmaktadır. Diğer kaynaklar yanında, deniz ürünleri fonksiyonel gıda maddesi ve hammaddelerinin en önemli kaynaklarıdır. Balık ve balık karaciğer yağları, omega-3 yağ asitleri, eikosapentaenoik (EPA ve dokosahekzaenoik (DHA asitlerin ana kaynağıdır. Balık yağları ispatlanmış fonksiyonel özellikleriyle gıda ve ecza sektöründe kullanılan en yaygın fonksiyonel ürünlerdir. Çok çeşitli deniz canlılarından elde edilen ticari enzimlerin (trimetilamin oksit demetilaz, thiaminaz, karnosinaz, tripsin v.b. hem kaynakları hem de kullanım alanları spesifiktir. Biyoklinik kimya ve organik sentez sektörü ile gıda, kağıt, ecza gibi sektörlerde bu enzimler çok kıymetli ürünlerdir. Bunun yanında protaminler, holotoksinler, okadaik asit, manolit, squalamin gibi yüzlerce biyoaktif molekülün yegane kaynakları deniz ürünleridir. Bu ürünlerden bazısı fonksiyonel gıda katkı maddesi olarak kullanılırken, çoğunluğu direkt ilaç yapımında kullanılmaktadır. Agar, karagenan, kitin, kitosan, jelatin ve benzerleri gıda ve gıda ambalaj sektöründe yaygın kullanılırlar ve ispatlanmış fonksiyonel ürün özellikleri vardır. Ayrıca deniz ürünleri kaynaklı vitaminler (özellikle A ve D vitaminleri, renk maddeleri, mikroalg ve spirulina ürünleri, protein izolatları ve aroma hammaddeleri diğer kıymetli fonksiyonel ürünlerdir. Bu derlemede en yaygın deniz ürünleri kaynaklı fonksiyonel ürünler tanıtılacaktır

  4. Occupational accidents and affecting factors of metal industry in a factory in Ankara

    Directory of Open Access Journals (Sweden)

    Buket Gulhan

    2012-08-01

    Full Text Available Abstract Objective:According to the statistics of the Social Security Institution, 18672 occupational accidents occurred in the metal industry in 2008 in Turkey. Whereas 78 of these accidents resulted in death, 252 people became permanently incapable of working. In 2008, 369677 working days were lost as a result of occupational accidents. Evaluating the reasons for and the results of accidents in the metal industry and contributing to the development of recommendations for prevention in accordance with the information obtained. Method: The study was conducted with 201 of 210 workers working in heavy metal manufacturing and construction in the building company between April 2008 and June 2008. Results: The frequency of occupational accidents among the metal workers was 22% between January 2007 and June 2008. The reasons for the workers’ accidents are listed as; insufficient use of personal protective equipment (44%, carelessness (37%, and personal reasons, not to be taken of security measures at machines and looms/ unsuitable machines (both 17%.Conclusion: The study demonstrates that the accidents mostly occur because of failure to use of personal protective equipment, insufficient vocational training. Key Words: Occupational, accident, metal industry, preventionAnkara’da bir metal sanayi fabrikasında iş kazaları ve etkileyen faktörler Özet Amaç: 2008 yılında Sosyal Güvenlik Kurumu’nun verilerine göre metal sanayisinde 18672 iş kazası meydana gelmiş ve 369677 işgünü kaybı olmuştur.  Bu kazalardan 78 tanesi ölümle sonuçlanırken, 252 kişi kalıcı olarak işgöremez hale gelmiştir. Metal sanayisinde meydana gelen kazaların sebep ve sonuçlarını inceleyerek, elde edilen bilgiler doğrultusunda kazaların önlenmesine yönelik tavsiyelerin geliştirilmesi amaçlanmıştır. Yöntem: Araştırma, Ankara’da faaliyet gösteren ağır metal imalat, konstrüksiyon ve inşaat sanayi şirketinde 2008 Nisan-2008 Haziran d

  5. Yazılım geliştiricilerin kullanıcı deneyimi ve kullanılabilirlik konusundaki farkındalıklarının ve bilgi seviyelerinin belirlenmesi

    Directory of Open Access Journals (Sweden)

    Yavuz İnal

    2016-10-01

    Full Text Available Bu çalışma yazılım geliştiricilerinin kullanıcı deneyimi ve kullanılabilirlik konularındaki farkındalıklarının ve bilgi seviyelerinin belirlenmesi amacıyla yapılmıştır. Bunun yanında katılımcıların kullanılabilirlik aktivitelerinin yazılım geliştirme süreçlerine hangi aşamada dâhil edilmesi gereği konusundaki düşünceleri analiz edilmiştir. Çalışmaya 59 yazılım geliştiricisi katılmıştır. Çalışmanın ilk bölümünde veriler anket aracılığıyla toplanmıştır. Çalışmanın ikinci bölümünde ise, katılımcılar arasından gönüllülük esasına göre seçilen bir grup yazılım geliştirici ile ayrıntılı mülakat yapılmış ve konuyla ilgili detaylı bilgi alınmıştır. Çalışmada elde edilen bulgulara göre yazılım geliştiricilerinin önemli bir bölümünün bu konularda herhangi bir eğitim almadıkları belirlenmiştir. Geliştiricilerin çoğunun kendilerini yazılım projesi geliştirme ekibi içerisinde kullanıcı deneyimi ve kullanılabilirlik konularında en az farkındalığa ve bilgiye sahip grup olarak gördükleri belirlenmiştir. Bunun yanında katılımcıların kullanıcı deneyimi ve kullanılabilirlik gibi kavramlara yönelik eksik ya da yanlış bilgi sahibi oldukları görülmüştür.

  6. An Investigation of Model Creation Skills to Proof of Prospective Mathematics Teachers about the Sum of Successive Odd Numbers [Matematik Öğretmeni Adaylarının Ardışık Tek Sayıların Toplamının İspatına Yönelik Model Oluşturma Becerilerinin İncelenmesi

    Directory of Open Access Journals (Sweden)

    Gürsel Güler

    2015-12-01

    Full Text Available This study aims to look into secondary education prospective mathematics teachers’ model creation skills regarding proof of the rule providing the sum of successive odd numbers. The study takes case study method, a qualitative research approach, as the basis to reflect the current situation, and focus group discussions were held in classroom environment to collect data. The study was conducted on twenty prospective math teachers studying pedagogical formation. Focus group discussions held with twenty prospective teachers selected on voluntary basis voluntarily were recorded, put on paper and analyzed descriptively. According to the results derived from the study, it is observed that the prospective teachers used verbal, algebraic and formal models as three model types during the proof of the rule providing the sum of successive odd numbers and created six different proofs along with these models.[Bu çalışmada, orta öğretim matematik öğretmeni adaylarının ardışık tek sayıların toplamını veren kuralın ispatına yönelik model oluşturma becerilerinin araştırılması amaçlanmıştır. Nitel araştırma yaklaşımlarından mevcut durumu yansıtmayı amaçlayan durum çalışması yönteminin esas alındığı çalışmanın verileri sınıf ortamında gerçekleştirilen odak grup görüşmesi yardımıyla toplanmıştır. Çalışma pedagojik formasyon eğitimi programına devam eden yirmi matematik öğretmeni adayı ile yürütülmüştür. Gönüllük esasına göre seçilen yirmi öğretmen adayı ile yapılan odak grup görüşmesi kaydedilmiş ve daha sonra yazıya dökülerek betimsel olarak analiz edilmiştir. Araştırmada elde edilen sonuçlara göre öğretmen adaylarının ardışık tek sayıların toplamını veren kuralın ispatında sözel, cebirsel ve şekilsel olmak üzere üç farklı model türü kullandıkları ve bu modeller doğrultusunda altı farklı ispat oluşturdukları görülmüştür.

  7. Aileler, Öğretmenler ve Dil ve Konuşma Terapistlerinin Çocuklardaki Dil ve Konuşma Bozukluklarına Yönelik Tutum ve Bilgilerinin Değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    Bülent Toğram

    2009-01-01

    Full Text Available Çocuklardaki iletişim sorunları aile bildirimleri, öğretmen raporları ve dil ve konuşma terapistleri (DKT tarafından yapılan değerlendirmeler ile saptanmaktadır. Dil ve konuşma bozukluklarının önlenmesi ve terapisinde işbirliği içinde bulunmaları gereken bu üçlü grubun konuya ilişkin görüş ve tutumları alanyazında önemli bulunmaktadır. Bu çalışmanın amacı, ebeveynlerin, öğretmenlerin ve DKT’lerin dil ve konuşma bozuklukları alanındaki sorumluluk ve rollerini nasıl algıladıklarını, dil ve konuşma bozukluğu olan çocuğun akademik ve sosyal başarısına yönelik tutumlarını, dil ve konuşma bozukluklarının nedenleri ve terapisine yönelik düşüncelerini betimlemektir. Çalışmaya 37 aile bireyi, 46 öğretmen ve 35 DKT katılmıştır. Anket yoluyla elde edilen veriler her grubun konuya ilişkin bilgisini ortaya koymak için karşılaştırılmıştır. Dil ve konuşma bozukluğu olan çocukların akademik/sosyal başarılarına yönelik tutumlarında diğer katılımcı gruplara göre öğretmenlerin, çocukların terapi gereksinimlerine yönelik tutumlarında ise ailelerin daha kararsız tutumlar geliştirdikleri dikkat çekmektedir. Dil ve konuşma bozukluklarının nedenleri ve terapi eksikliklerine yönelik bilgilerinde grupların öncelikli sıralamalarının farklılaştığı görülmüştür. Speech and language disorders (SLD in children have been determined by parental reports, teacher reports and assessments by speech-language therapists. Therefore, the family members, teachers and speech and language therapists should be in continuous collaboration during the intervention and therapy process of the individuals with SLD. The collaborators’ attitudes toward the impact of SLD on the child have been highlighted in the literature. The purpose of the study is to determine parents’ and teachers’ and speech and language therapists’ awareness toward their roles and

  8. Recommendations for Practice: Designing Curriculum for Gifted Students / Uygulamaya Yönelik Öneriler: Üstün Zekalı Öğrenciler İçin Müfredat Tasarımı

    Directory of Open Access Journals (Sweden)

    Kimberley L. Chandler

    2015-12-01

    Full Text Available Abstract Throughout the literature of gifted education, the modifications recommended for differentiating curriculum for gifted students may be categorized as relating to content, process, product, learning environment, and (to a lesser extent affective concerns. Due to the Jacob K. Javits Gifted and Talented Students Education Program (funded by the United States Department of Education in particular, there are now data that provide evidence of some effective curriculum interventions for producing achievement gains in gifted students. Specific recommendations have been gleaned based on findings from the research and about curriculum development and implementation in gifted education (Robins & Chandler, 2013. These may prove useful for designing curriculum or facilitating the development of programming for highly able students. In this article, the author provides background information about the curricular needs of gifted students and specific recommendations for practice that can serve as a guide for key stakeholders to optimize talent and educational opportunity.. Keywords: gifted education, curriculum design, gifted students Öz Üstün zekalıların eğitimlerine ilişkin literatüre bakıldığında üstün zekalı öğrenciler için önerilen müfredat farklılaştırmalarıyla ilgili modifikasyonlar içerik, süreç, ürün, öğrenme ortamı ve duyuşsal (diğerlerine göre daha az derecede kategorilerle ilgili olduğu görülmektedir. Günümüzde Jacob K. Javit Üstün Zekalı ve Yetenekliler Eğitim Programı (ABD Eğitim Dpartmanı tarafından desteklenen gibi bazı uygulamalardan elde edilen veriler, bazı müfredat uygulamalarının üstün zekalı öğrenciler için etkili ve başarılı olduğuna dair kanıt sunmaktadır. Üstün zekalıların eğitiminde müfredat geliştirme ve uygulamalarıan ve araştırma bulgularına dayalı olarak özel önerilerde bulunulmuştur(Robins & Chandler, 2013. bunlar üstün yetenekli

  9. RAIN VOLLEY APPLICATIONS IN UŞAK AND ITS SURROUNDINGS (EXAMLE OF TAKMAK VILLAGE UŞAK VE ÇEVRESİNDE YAĞMUR YAĞDIRMA UYGULAMALARI (TAKMAK KÖYÜ ÖRNEĞİ

    Directory of Open Access Journals (Sweden)

    Sami KILIÇ

    2011-01-01

    öyünde uygulanmakta olan yağmur yağdırma tekniklerinin tasviri ve tahlili oluşturmaktadır. Bu manada, katılımlı gözlem ve derinlemesine mülakat teknikleriyle elde edilen Takmak köyündeki yağmur yağdırma uygulamalarının tasviri verilerinin önemli fenomenleri, Dinler Tarihi açısından değerlendirilerek, Takmak köyündeki yağmur yağdırma tekniklerinin tarihi-dini kökenleri ortaya konulmaya çalışılacaktır.

  10. Using Figure and Concept Knowledge in Geometry [Geometride Öğrencilerin Şekil ve Kavram Bilgisi Kullanımı

    Directory of Open Access Journals (Sweden)

    Yavuz Karpuz

    2014-08-01

    Full Text Available In this study, we aim to investigate how students build interaction between concepts and figure in geometry. For this purpose we developed two type data collection tool. First one called shapely is formed eight open ended question which has concepts and figure. Second one called shapeless is formed eight open ended question which has only concepts. To prepare this data collection tools’ difficulty level we took two math teachers’ opinions. Developed data collection tools were applied 120 students at 9th grade and 11th grade in Trabzon Gazi Anatolian High School. First of all we applied shapeless questions. One month later we applied shapely questions. We investigated students’ answer and the data showed that students more succeed in shapely questions than shapeless questions. We concluded that the difficulty of solving shapeless question result from students didn’t manage to draw figure representing concept knowledge or draw wrong figure, figure drawn by students can’t fulfıl generalizability condition and students who have little knowledge of concept in geometry is under the influence of prototype figure. [Mevcut çalışma ile öğrencilerin geometrik şekil ve kavram bilgilerini nasıl kullandıkları araştırmak amaçlanmıştır. Bu amaç doğrultusunda iki tür veri toplama aracı geliştirilmiştir. Birincisi kavram ve şeklin beraber verildiği sekiz açık uçlu sorudan, ikincisi de sadece kavramın verilip şeklin verilmediği sekiz açık uçlu sorudan oluşmaktadır. Geliştirilen veri toplama araçları Trabzon Gazi Anadolu Lisesi’nde öğrenim gören 9 ve 11.sınıf öğrencilerinden 120 kişiye, ilk önce şekilsiz sorular olmak üzere bir ay arayla uygulanmıştır. Öğrencilerin şekilli ve şekilsiz sorulara verdikleri yanıtlar karşılaştırmalı olarak incelenmiştir. Elde edilen bulgular öğrencilerin şekilli soruların çözümünde daha başarılı oldukları yönündedir. Şekilsiz soruların

  11. PSİKOLOJİK SERMAYE ÖLÇEĞİNİN GEÇERLİLİK VE GÜVENİLİRLİK ÇALIŞMASI

    Directory of Open Access Journals (Sweden)

    Turhan ERKMEN

    2013-01-01

    Full Text Available PSİKOLOJİK SERMAYE ÖLÇEĞİNİN GEÇERLİLİK VE GÜVENİLİRLİK ANALİZİÖzet: Bu çalışmada, Fred Luthans ve arkadaşları (2007 tarafından geliştirilen Psikolojik Sermaye Ölçeği’nin (Psychological Capital Scale Türkçe uyarlamasını yapmak, geçerlilik ve güvenilirlik analizini gerçekleştirmek amaçlanmıştır. Ülkemizde yapılan bu çalışma, Örgütsel Davranış literatüründe önemli bir kavram olan Psikolojik Sermaye ile ilgili yapılacak çalışmalara da referans olabilecektir. Çalışma, bilişim sektöründe çalışan toplam 158 kişi ile gerçekleştirilmiştir. Ölçeğin geçerlilik çalışmaları için doğrulayıcı faktör analizi, güvenilirlik çalışmaları için ise iç tutarlılık analizleri yapılmıştır. Elde edilen sonuçlara göre, psikolojik sermaye kavramının; orijinal ölçekteki faktör yapısından farklı olarak 3 faktörle ifade edildiği, bu faktörlerin de öz-yeterlilik, umut ve iyimserlik olduğu, psikolojik dayanıklılık boyutunun ortadan kalktığı, ölçeğin Türkçe versiyonunun uygulama alanı çerçevesinde güvenilir ancak geçerli olmadığı sonucu bulunmuştur.VALIDITY AND RELIABILITY STUDY OF THE PSYCHOLOGICAL CAPITAL SCALEAbstract: The purpose of the study is to adapt Psychological Capital Scale into Turkish and to conduct validity and reliability analysis of the Scale which was developed by Fred Luthans and his colleagues (2007. This study intends to be referred to the future studies in our country as psychological capital has become an important concept in the field of Organizational Behavior. The study was conducted among 158 employees who work in information sector. For validity studies, confirmatory factor analysis; for internal consistency, reliability analyses were performed. According to the results of the study, it was found that psychological capital was explained by 3 factors in contrast to the 4 factors of the original scale. The factors remained

  12. Türkiye’de eğitimsel eşitsizlik ve toplumsal tabakalaşma ilişkisine dair ampirik bir çalışma [The relationship between educational inequality and social stratification in Turkey: An empirical study

    Directory of Open Access Journals (Sweden)

    Yalın KILIÇ

    2014-10-01

    Full Text Available Bu çalışmada, Türkiye’deki eğitimsel eşitsizliklerin toplumsal tabakalar açısından çözümlenmesi amaçlanmıştır. Araştırma TÜİK tarafından uygulanan 2006 yılı Hane Halkı Bütçe Anketi verilerine dayalı olarak planlanmıştır. Hane Halkı Bütçe Anketleri, hanelerin sosyo-ekonomik yapıları, yaşam düzeyleri, tüketim kalıpları hakkında bilgi veren ve toplumun gereksinimlerinin belirlenmesi, kullanılabilir gelirin haneler ya da bireyler arasında ne şekilde dağıldığının bilinmesi ve uygulanan sosyo-ekonomik politikaların geçerliğinin test edilmesi amacıyla kullanılan en önemli kaynaklardan biridir. Dolayısıyla bu çalışmada hane halkı bütçe anketinin verileri toplumsal tabakaların oluşturulmasında temel veri kaynağını oluşturmuştur. Çalışmada, yetişkin nüfusun eğitim düzeyinin cinsiyetle ve elde edilen gelirle ve eğitim çağındaki çocukların eğitim kademeleri itibariyle okullaşma oranlarının cinsiyetle ve hanedeki kişi başı düşen ortalama gelirle ilişkileri toplumsal tabakalar açısından incelenmektir. Bu hedef doğrultusunda öncelikle TÜİK tarafından uygulanan 2006 yılı Hane Halkı Bütçe Anketi verileri işlenmiş ve analiz edilmiştir. Çalışmada verilerin özelliklerine ve kurulan hipotezlere göre; Kay-kare, korelasyon ve varyans analizi yapılmıştır. Yapılan çözümlemeler sonucunda toplumsal tabakaların eğitimsel eşitsizliklerin önemli bir açıklayıcısı olduğu belirlenmiştir.

  13. Performans Geribildirimi ile Öğretmenlerin Mesleki Gelişimini Destekleme

    Directory of Open Access Journals (Sweden)

    Selma Akalın

    2015-04-01

    Full Text Available Eğitim-öğretimin kalitesi ile öğretmen niteliği arasında doğrudan bir ilişki vardır. Öğretmenin niteliği, eğitim sisteminin nihai hedefi olan öğrenci öğrenmesinin artırılmasında belirleyici bir rol oynamaktadır. Öğretmenlerin kişisel ve mesleki gelişimlerini sağlamayı amaçlayan öğretmen yetiştirme programları eğitim sisteminin önemli bir parçasını oluşturmakta, bu nedenle de öğretmen eğitimi uygulamaları sürekli incelenmektedir. Öğretmenlerin ve öğretmen adaylarının etkili öğretim uygulamalarını kullanmaları yönünde teşvik edilmeleri beklenmektedir. Etkili öğretim uygulamalarının kullanımını artıracak yöntemlerden biri öğretmenlere, öğretim ve davranış yönetimi becerilerine ilişkin, performans geribildirimi sunmaktır. Bu derlemede, performans geribildirimi ve özellikleri tanıtılmakta, öğretmen eğitimi uygulamaları çerçevesinde performans geribildirimi çalışmaları incelenmektedir. Bu amaçla, öğretmen eğitiminde performans geribildirimini konu alan araştırmalara yönelik alanyazın taraması yapılmış, ulaşılabilen çalışmalar kısaca özetlenmiş ve bu çalışmalardan elde edilen bilgiler ışığında uygulamaya ve ileri araştırmalara yönelik öneriler geliştirilmiştir, There is a direct relationship between the quality of education and the teacher's qualifications. The quality of teacher plays a decisive role in the enhancement of student learning which is the ultimate goal of the education system. Teacher training programs aimed at providing teachers' personal and professional development constitute an important part of the education system therefore, teacher education practices are constantly examined. Individuals who are responsible of teacher education are expected to encourage teachers and teacher candidates to use effective instructional methods. One of the techniques which may increase the use of effective teaching methods is to

  14. Altıncı ve Yedinci Sınıf Öğrencilerinin Hoca Ahmed Yesevî Algıları / Sixth and Seventh Graders’ Perceptions of Khoja Ahmad Yassawi

    Directory of Open Access Journals (Sweden)

    Bahadır Kılcan

    2017-04-01

    Full Text Available Abstract The purpose of this research is to determine sixth and seventh graders’ perceptions of Khoja Ahmad Yassawi, who was among Turkish-Muslim thinkers, covered in the sixth and seventh grades social sciences curriculum. To this end, the metaphors produced and the pictures/cartoons drawn by the students about Khoja Ahmad Yassawi were examined. Qualitative research designs were employed in the research. The study group consists of 237 sixth and seventh graders educating in Mamak district of Ankara province in the spring semester of the 2015-2016 academic year. The data obtained from the participants were analyzed and interpreted via content analysis. The participants were found to have the following perceptions of Khoja Ahmad Yassawi: “informing, advisory”, “guiding, illuminating”, “showing the truth, providing benefit”, and “leaving a mark, esteemed”.   Öz Bu araştırmada, sosyal bilgiler 6 ve 7. sınıf öğretim programında yer alan Türk-İslam mütefekkirlerinden Hoca Ahmed Yesevi’nin altıncı ve yedinci sınıf öğrencileri tarafından nasıl algılandığının belirlenmesi amaçlanmıştır. Bu amaç doğrultusunda; öğrencilerin Hoca Ahmed Yesevi’ye ilişkin geliştirdikleri metaforlar ve çizdikleri resim/karikatürler incelenmiştir. Nitel araştırma deseninde gerçekleştirilen araştırmanın çalışma grubunu 2015-2016 eğitim öğretim bahar döneminde Ankara ili Mamak ilçesinde öğrenim gören 237 altıncı ve yedinci sınıf öğrencisi oluşturmaktadır. Katılımcılardan elde edilen verilerin çözümlenmesinde ve yorumlanmasında içerik analizi kullanılmıştır. Araştırma sonucunda katılımcıların, Hoca Ahmed Yesevi’yi; “bilgi sağlayan, öğüt veren”, “yol gösteren, aydınlatan”, “doğruyu gösteren, fayda sağlayan” ve “iz bırakan, değerli olan” şeklinde algıladıkları görülmektedir.

  15. The Acquisition of Counting Skill in Preschooler

    Directory of Open Access Journals (Sweden)

    Kadir Çakır

    2013-03-01

    Full Text Available Abstract- The aim of this study was to find out more information on the acquisition of counting skill in preschool children. For this purpose, children’s judgment of acceptability of a counting activity was used to investigate whether children’s counting skills are governed by their implicit knowledge of a number of counting principles. Data showed that children easily recognized the violation of one or more counting principles in a one’s application of counting principles in sequences of English and Turkish count words, implying that children have the understanding of counting principles. The sessions on counting in Turkish make it very likely that the children were responding to violations of rules rather than merely violation of well-learning of count words. These results give additional support to the assumption that there are innate counting principles that rule young children’s counting. Keywords: counting principles, error-detection task, mathematical development. Özet- Okul Öncesi Çocuklarda Sayma İlkeleri. Bu çalışmada çocukların bir sayma etkinliğinin geçerli olup olmadığı hakkındaki yargıları kullanılarak, sayma becerisinin doğuştan sahip olunan bir dizi örtük ilkeler tarafından yönlendirilip yönlendirilmediği incelenmiştir. Bu amaç doğrultusunda, bir grup okul öncesi çocuklardan videodan izledikleri bir aktör çocuğun hem anadilinde (İngilizce hem de bilmedikleri bir yabancı dilde (Türkçe yaptığı farklı hatalar içeren sayma serilerinin doğru veya yanlış olup olmadığı belirtmesi istenmiştir. Elde edilen sonuçlar çocukların sayma etkinliklerine rehberlik eden doğuştan getirdikleri örtük “sayma ilkelerine” sahip olduklarına ilişkin görüşleri destekler yönündedir. Örneğin, gerek İngilizce gerekse Türkçe sayma serilerinde, “standart (doğru sayma” serisi diğer tüm serilere göre anlamlı ölçüde “doğru” bir sayma olarak değerlendirilirken, T

  16. Pre-service Mathematics Teachers’ Views regarding the Role of Examining Students’ Work in Understanding Students’ Ways of Thinking [Öğrenci Çalışmalarını İncelemenin Öğrenci Düşünme Şekillerini Anlamadaki Rolü ile İlgili Matematik Öğretmen Adaylarının Düşünceleri

    Directory of Open Access Journals (Sweden)

    Makbule Gözde Didiş

    2015-08-01

    Full Text Available Awareness for and knowledge of students’ ways of thinking is an important component of teachers’ competence that should be gained before starting their career. The purpose of this study was to investigate pre-service secondary mathematics teachers’ views regarding the role of examining students’ work in understanding students’ ways of thinking within the context of an undergraduate mathematical modeling course for pre-service mathematics teachers. The participants were twenty-five pre-service mathematics teachers enrolled in the course. Lasting eight weeks the data were collected through the pre-service teachers’ reflection papers, individual interviews, and a self-evaluation questionnaire. The analyses of data revealed that the pre-service mathematics teachers thought that examining students’ solution papers and video episodes helped them to be aware of, predict, understand, and interpret students’ ways of thinking. The findings of the study suggested that mathematics teacher educators might consider using students’ work from real classroom settings in order to both develop and support the development of pre-service mathematics teachers’ pedagogical content knowledge. [Öğretmenin sahip olması beklenen önemli yeterliliklerden birisi öğrenci düşünme şekilleri bilgisidir. Pedagojik alan bilgisinin bir alt boyutu olan bu bilginin öğretmenlere mesleğe başlamadan önce kazandırılması önemlidir. Bu çalışmanın amacı matematiksel modelleme etkinliklerinin sınıf içi uygulamalarından elde edilen öğrenci çözüm kâğıtları ve videoları incelemenin öğrenci düşünme şekillerini anlamaya olan katkısı konusunda matematik öğretmen adaylarının düşüncelerini incelemektir. Çalışmanın katılımcıları öğretmen adaylarına dönük bir matematiksel modelleme dersine kayıtlı yirmi beş matematik öğretmen adayıdır. Sekiz hafta süren çalışmanın verileri bireysel düşünce raporlar

  17. Okul Yöneticilerinin Göreve Geliş Biçimlerinin Okul Kültürüne Yansımaları

    Directory of Open Access Journals (Sweden)

    Gözde TÜRKMENOĞLU

    2015-07-01

    Full Text Available Bu araştırma okul yöneticilerinin göreve geliş biçimlerinin okul kültürüne yansımalarını yönetici görüşlerine dayalı olarak incelemek amacıyla yapılmıştır. Bu araştırma nitel araştırma yöntemlerinden biri olan durum çalışması ile desenlenmiştir. Araştırmanın çalışma grubunu belirlemek üzere amaçlı örnekleme yöntemlerinden maksimum çeşitlilik örneklemesi yöntemi kullanılmıştır. Araştırmanın çalışma grubunu Tekirdağ ili Çorlu ilçesinde Milli Eğitim Bakanlığına bağlı bulunan lise, ortaokul ve ilkokullarda görev yapan 12 okul yöneticisi oluşturmaktadır. Araştırma ile ilgili veriler 2014-2015 eğitim-öğretim yılında toplanmıştır. Çalışma grubunda yer alan yöneticilerden veri toplanabilmesi için yarı yapılandırılmış görüşme formu geliştirilmiştir. Araştırmada elde edilen veriler içerik analizi tekniği ile çözümlenmiştir. Araştırma sonuçları şöyle özetlenebilir; yöneticilerin tamamı, okul yöneticilerinin sınavla göreve gelmeleri gerektiğini düşünmektedir. Okul yöneticilerinin çoğu yöneticilerin eğitim yönetimi alanında lisansüstü eğitim alarak göreve gelmeleri gerektiği görüşündedir. Araştırmaya katılan yöneticilerin çoğu, okul yöneticilerinin görevlendirilmesi uygulamasını olumsuz olarak değerlendirmiştir. Okul yöneticileri okul yöneticilerinin sınavla, yönetim alanında lisansüstü eğitimle ve görevlendirilme ile göreve gelmelerinin okul kültürüne birçok açıdan etkileri olduğunu düşünmektedirler.

  18. SPATIAL DISTRIBUTION IN A DRY ONION FIELD (A PRECISION FARMING APPLICATION IN TURKEY

    Directory of Open Access Journals (Sweden)

    Bahattin AKDEMIR

    2006-05-01

    Full Text Available Objective of this study is to determine spatial variability in a dry onion fi eld and to produce a management strategy which is based on spatial variability of yield and soil components. The onion fi eld properties were determined and given in maps. Soil samples were taken to determine properties of soil such as pH, salt, humidity, CaCO3, organic matter, total N, Zn, Fe, P2O5, Ca+Mg, K, texture. Longitudinal slope was also measured. Results were used to produce maps. Most percentage of the fi eld soils was determined as clay-loam. Small part of the fi eld was loam. Yield of dry onion decreased by increasing of Organic Matter, Total Nitrogen, Iron, and Zinc in the fi eld according to the related maps. Relationship between yield and phosphorous, CaCO3, Ca+Mg and salt was positive according to the related maps.

  19. Higgs-Like Particle due to Revised Quantum Electrodynamics

    Directory of Open Access Journals (Sweden)

    Lehnert B.

    2013-07-01

    Full Text Available A Higgs-like particle having zero net electric charge, zero spin, and a nonzero rest mass can be deduced from an earlier elaborated revised quantum electrodynamical theory which is based on linear symmetry breaking through a nonzero electric field divergence in the vacuum state. This special particle is obtained from a composite longitudinal solution based on a zero magnetic field strength and on a nonzero divergence but a vanishing curl of the electric field strength. The present theory further differs from that of the nonlinear spontaneously broken symmetry by Higgs, in which elementary particles obtain their masses through an interaction with the Higgs field. An experimental proof of the basic features of a Higgs-like particle thus supports the present theory, but does not for certain confirm the process which would generate massive particles through a Higgs field

  20. İlköğretim 8. Sınıf Türkçe Ders Kitaplarında Öğrencilere Kazandırılması Hedeflenen Sözcüklerin Öğretimi ve İç Sözlük İlişkisi (Mersin İli Örneği Instruction Of Words In 8th Grade Turkish Course Books Which Are Targeted To Get Acquired To Students And Their Relation To Internal Lexicon (The Case Of Mersin

    Directory of Open Access Journals (Sweden)

    Erdost ÖZKAN

    2013-03-01

    toplama aracı ile uygulanmıştır.Araştırma sonunda elde edilen ham veriler, Spss 16 veri analizi paket programı ile çözümlenmiştir. Öğrencilere kazandırılması hedeflenen sözcükler, okul yerleşim birimi, cinsiyet ve temalar arası ilişki çatıları altında incelenmiş; belirlenen ölçütlerin doğrultusunda uygunluk frekansları ve yüzdelikleri tablolar ve grafikler aracılığıyla irdelenmiştir. Ayrıca araştırma örnekleminde bulunan öğrencilerin cinsiyetleri ile iç sözlüklerinde yer alabilen sözcüklerin ortalamaları arasındaki anlamsal farklılığı ortaya çıkarmak ve anlamlandırmak amacıyla t-test’ten yararlanılmıştır.Öğrencilerin öğrenim gördükleri yerleşim birimine göre sözcük ortalamaları arasındaki farklılığın ortaya konulmasında ise tek yönlü varyans analizi (one way anova ve bu farklılığın hangi grup ya da gruplar lehine olduğunu belirlemek için post hoc veri çözümleme tekniklerinden yararlanılmıştır. Araştırma bulgularından elde edilen sonuçlar aşağıdaki gibi özetlenebilir:1. Türkçe ders kitaplarındaki metinlerde yer alan öğrenci iç sözlüğüne kazandırılması hedeflenen sözcüklerin öğretimi bağlamında öğrencilere uygulanan çalışma dosyasında yer alan yüz doksan üç, p<0.5 anlamsal farklılığa göre on yedi, sözcüğün doğru kullanım değerleri irdelendiğinde örneklem grubunda yer alan kız öğrencilerin (43, erkek öğrencilere (57 göre sözcük kullanımında (köle sözcüğü hariç üstünlük sağladığı sonucuna ulaşılmıştır.2. Araştırma örneklemini oluşturan yüz öğrencinin eğitim-öğretim gördüğü ve sözcüklerin edinimi doğrultusunda okul yerleşke türleri (ilçe-belde-köy arasında anlamlı farklılıklar oluştuğu sonucuna ulaşılmıştır.3. İlköğretim sekizinci sınıf Türkçe ders kitaplarında yer alan toplam altı temanın içerisinde bulunan ve öğrencilere kazandırılması hedeflenen toplam y