
Sample records for san diego ssc

  1. SSC San Diego Strategic Plan. Revision 3 (United States)


    OMB control number. 1. REPORT DATE NOV 2001 2. REPORT TYPE 3. DATES COVERED - 4. TITLE AND SUBTITLE SSC San Diego Strategic Plan. Rev 3 5a...Business Improvement Group ( CBIG ), will be composed of the team members listed above, and will be responsible for monitoring the planning and...implementation of these objectives. The CBIG will charter sub-groups as necessary. Improve Corporate IT infrastructure Much of the SSC San Diego IT service

  2. SSC San Diego Command History Calendar Year 2005 (United States)


    SSC San Diego from Capt. Tim Flynn on 18 August 2005. Capt. Unetic joined the Center from SPAWAR Headquarters where he was Executive Assistant to...communications. Rear Adm. Tim Flynn Rear Adm. Tim Flynn served as SSC San Diego Commanding Officer beginning 2 May 2002. Before joining SSC San Diego, he was...Steven Short, Arleen Simbulan, Robert Smith, Gleason Snashall, Dow Street, Weden Teng, Deborah Tharp , Tine Thompson, Viet Tran, Thomas Tucker, Rob Turner

  3. SSC San Diego Command History Calendar Year 2006 (United States)


    Alamos, New Mexico . 8 Head, Pacific C4ISR Department6 George McCarty was selected to head the Pacific C4ISR Department. Prior to his selection...assistance in the rescue and care of eight dolphins that were washed out into the Gulf of Mexico when Hurricane Katrina’s storm surge destroyed their...years of Navy communications on Point Loma,” Outlook, 24 March 2006, Volume 29, Number 6, Outlook, “SSC San Diego will hold open house and Fiesta Picnic

  4. 77 FR 54811 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of a bay swim in San Diego Harbor. This safety zone is necessary to provide for the safety of the participants, crew...

  5. 78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... temporary safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of a... Bryan Gollogly, Waterways Management, U.S. Coast Guard Sector San Diego; telephone (619) 278-7656, email...

  6. 78 FR 58878 - Safety Zone; San Diego Shark Fest Swim; San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego Shark Fest Swim; San Diego Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of San...

  7. 75 FR 55975 - Safety Zone; San Diego Harbor Shark Fest Swim; San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego Harbor Shark Fest Swim; San Diego Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support...

  8. San Diego's Capital Planning Process (United States)

    Lytton, Michael


    This article describes San Diego's capital planning process. As part of its capital planning process, the San Diego Unified School District has developed a systematic analysis of functional quality at each of its school sites. The advantage of this approach is that it seeks to develop and apply quantifiable metrics and standards for the more…

  9. 78 FR 39610 - Safety Zone; Big Bay Boom, San Diego Bay; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Big Bay Boom, San Diego Bay; San Diego, CA... temporary safety zones upon the navigable waters of the San Diego Bay for the annual Port of San Diego... Sector San Diego, Coast Guard; telephone 619-278-7261, email . If you have...

  10. 75 FR 38412 - Safety Zone; San Diego POPS Fireworks, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego POPS Fireworks, San Diego, CA... zone on the ] navigable waters of San Diego Bay in support of the San Diego POPS Fireworks. This safety.... Coast Guard Sector San Diego, CA; telephone 619-278- 7262, e-mail . If you have...

  11. 78 FR 42027 - Safety Zone; San Diego Bayfair; Mission Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego Bayfair; Mission Bay, San Diego... proposing a temporary safety zone on the navigable waters of Mission Bay in San Diego, CA for the San Diego..., call or email Lieutenant John Bannon, Waterways Management, U.S. Coast Guard Sector San Diego...

  12. 78 FR 29289 - Safety Zone; Big Bay Boom, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Big Bay Boom, San Diego Bay, San Diego, CA... establish four temporary safety zones upon the navigable waters of San Diego ] Bay for the Port of San Diego... Management, U.S. Coast Guard Sector San Diego; telephone (619) 278-7261, email . If...

  13. 78 FR 53245 - Safety Zone; San Diego Bayfair; Mission Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego Bayfair; Mission Bay, San Diego... temporary safety zone upon the navigable waters of Mission Bay in San Diego, CA for the annual San Diego... Management, U.S. Coast Guard Sector San Diego; telephone (619) 278-7261, email . If...

  14. 76 FR 45693 - Safety Zone; San Diego POPS Fireworks, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego POPS Fireworks, San Diego, CA... temporary safety zone on the navigable waters of San Diego Bay in support of the San Diego POPS Fireworks... Diego, CA; telephone (619) 278- 7262, e-mail . If you have questions on viewing...

  15. 76 FR 55796 - Safety Zone; TriRock Triathlon, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock Triathlon, San Diego Bay, San Diego.... Basis and Purpose Competitor Group is sponsoring the TriRock Triathlon, consisting of 2000 swimmers....T11-431 Safety Zone; TriRock Triathlon, San Diego Bay, San Diego, CA. (a) Location. The limits of...

  16. 78 FR 38584 - Safety Zone; San Diego Symphony Summer POPS Fireworks 2013 Season, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego Symphony Summer POPS Fireworks 2013 Season, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of San Diego Bay in support of the San Diego...

  17. 76 FR 75908 - Notice of Inventory Completion: The University of California, San Diego, San Diego, CA (United States)


    ... National Park Service Notice of Inventory Completion: The University of California, San Diego, San Diego... California on behalf of the University of California, San Diego, have completed an inventory of human remains... contact the University of California, San Diego. Disposition of the human remains and associated funerary...

  18. 77 FR 42647 - Safety Zone: San Diego Symphony POPS Fireworks; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone: San Diego Symphony POPS Fireworks; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of San Diego Bay in support of the San Diego Symphony POPS...

  19. 75 FR 77756 - Safety Zone; San Diego Parade of Lights Fireworks, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; San Diego Parade of Lights Fireworks, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone upon the navigable water of the San Diego Bay in San Diego, CA in support of the two...

  20. Convair Astronautics, San Diego (California

    Directory of Open Access Journals (Sweden)

    Pereira & Luckmam, Arquitectos


    Full Text Available Este brillante y espectacular complejo industrial se ha creado especialmente para la investigación y fabricación de cohetes intercontinentales y vehículos del espacio de las Fuerzas Aéreas de los EE. UU., en las proximidades de San Diego y cerca del campo de pruebas de Sycamore Canyon.

  1. 33 CFR 165.1102 - Security Zone; Naval Base Point Loma; San Diego Bay, San Diego, CA. (United States)


    ... Loma; San Diego Bay, San Diego, CA. 165.1102 Section 165.1102 Navigation and Navigable Waters COAST... Guard District § 165.1102 Security Zone; Naval Base Point Loma; San Diego Bay, San Diego, CA. (a) Location. The following area is a security zone: The water adjacent to the Naval Base Point Loma, San Diego...

  2. Species - San Diego Co. [ds121 (United States)

    California Department of Resources — This is the Biological Observation Database point layer representing baseline observations of sensitive species (as defined by the MSCP) throughout San Diego County....

  3. 78 FR 10062 - Safety Zone; Sea World San Diego Fireworks, Mission Bay; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Sea World San Diego Fireworks, Mission Bay; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of Mission Bay in support of the Sea World San Diego...

  4. 77 FR 42649 - Safety Zone: Sea World San Diego Fireworks, Mission Bay; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone: Sea World San Diego Fireworks, Mission Bay; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is... rule, call or email Petty Officer David Varela, Waterways Management, U.S. Coast Guard Sector San Diego...

  5. 77 FR 60899 - Safety Zone; Sea World San Diego Fireworks, Mission Bay; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Sea World San Diego Fireworks, Mission Bay; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of Mission Bay in support of the Sea World San Diego...

  6. 77 FR 42638 - Safety Zone: Sea World San Diego Fireworks, Mission Bay; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone: Sea World San Diego Fireworks, Mission Bay; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of Mission Bay in support of the Sea World San Diego...

  7. 78 FR 29025 - Sea World San Diego Fireworks 2013 Season; Mission Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Sea World San Diego Fireworks 2013 Season; Mission Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of Mission Bay in support of the Sea World San Diego...

  8. 76 FR 46352 - Approval of Noise Compatibility Program for San Diego International, San Diego, CA (United States)


    ... Federal Aviation Administration Approval of Noise Compatibility Program for San Diego International, San Diego, CA AGENCY: Federal Aviation Administration, DOT. ACTION: Notice . SUMMARY: The Federal Aviation Administration (FAA) announces its findings on the noise compatibility program submitted by San Diego Regional...

  9. 78 FR 77597 - Safety Zone; Allied PRA-Solid Works, San Diego Bay; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Allied PRA-Solid Works, San Diego Bay; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the navigable waters of the San Diego Bay in support of a fireworks...

  10. Evaluation of Resuspension from Propeller Wash in Pearl Harbor and San Diego Bay (United States)


    July 2014 Evaluation of Resuspension from Propeller Wash in Pearl Harbor and San Diego Bay P.F. Wang K. Richter I. D. Rivera -Duarte B...Technical Report 2036 July 2014 Evaluation of Resuspension from Propeller Wash in Pearl Harbor and San Diego Bay P.F. Wang...K. Richter I. D. Rivera -Duarte B. Davidson B. Wild R. Barua SSC Pacific Q. Liao University of Wisconsin-Milwaukee J. Germano Germano

  11. 75 FR 55270 - Safety Zone; NASSCO Launching of USNS Washington Chambers, San Diego Bay, San Diego, CA (United States)


    ... Chambers, San Diego Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the navigable waters of the San Diego Bay in... the Port (COTP) San Diego or his designated representative. DATES: This rule is effective from 9:15 a...

  12. Trouble Brewing in San Diego. Policy Brief (United States)

    Buck, Stuart


    The city of San Diego will face enormous budgetary pressures from the growing deficits in public pensions, both at a state and local level. In this policy brief, the author estimates that San Diego faces total of $45.4 billion, including $7.95 billion for the county pension system, $5.4 billion for the city pension system, and an estimated $30.7…

  13. 75 FR 8804 - Safety Zone; NASSCO Launching of USNS Charles Drew, San Diego Bay, San Diego, CA. (United States)


    ... Diego Bay, San Diego, CA. AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the navigable waters of the San Diego Bay in support of... Captain of the Port (COTP) San Diego or his designated representative. DATES: This rule is effective from...

  14. 77 FR 48532 - Notice of Intent To Repatriate Cultural Items: San Diego State University, San Diego, CA (United States)


    ... National Park Service Notice of Intent To Repatriate Cultural Items: San Diego State University, San Diego, CA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The San Diego State University... Diego State University Archaeology Collections Management Program. DATES: Representatives of any Indian...

  15. An Archeological Survey of the San Diego River (United States)


    Indian populations and to arable landa and water, Father Serra moved Mission San Diego de Aleala ------ to the site of Nipoguay, an Indian village located...NN ARCHAEOLOGICAL SRE OF THE ~i7 SAN DIEGORIE I If SAN DIEGO STATE UNIVERSITY FOUNDATION DEPARTMENT OF THE ARMY, CORPS OF ENGINEERS kSAN DIEGO STATE...the San Diego River Archeological Survey A. PERFORMING ORG.ý REPORT NUM§ER na 7. AUTHOR(s) 6. CONTRACT OR GRANT NUMBER(*) - I- PERFORMING ORGANIZATION

  16. San Diego Science Alliance Education Outreach Activities (United States)

    Blue, Anne P.


    The General Atomics Science Education Outreach Activities as well as those of several other San Diego area institutions led to the formation in 1994 of the San Diego Science Alliance. The Science Alliance is a consortium of science-related industries, institutions of research and higher education, museums, medical health networks, and science competitions in support of K-12 science education. Some Alliance accomplishments include printing over 4000 resource catalogs for teachers, workshops presented by over 20 of their business members at the San Diego Science Education Conference, and hosting of 3 eight-week courses for teachers. The Alliance provides an important forum for interaction between schools and teachers and local industries and institutions. The Science Alliance maintains a World Wide Web Home Page at elvbf General Atomics' role in the San Diego Science Alliance will be presented.(Presented by Patricia S. Winter for the General Atomics Science Education Groups and San Diego Science Alliance.)

  17. Mammal Track Counts - San Diego County, 2010 [ds709 (United States)

    California Department of Resources — The San Diego Tracking Team (SDTT) is a non-profit organization dedicated to promoting the preservation of wildlife habitat in San Diego County through citizen-based...

  18. Coastal Cactus Wren, San Diego Co. - 2009 [ds702 (United States)

    California Department of Resources — The San Diego Multiple Species Conservation program (MSCP) was developed for the conservation of plants and animals in the southeast portion of San Diego County....

  19. Coastal Cactus Wren, San Diego Co. - 2011 [ds708 (United States)

    California Department of Resources — The San Diego Multiple Species Conservation program (MSCP) was developed for the conservation of plants and animals in the southeast portion of San Diego County....

  20. Mammal Track Counts - San Diego County [ds442 (United States)

    California Department of Resources — The San Diego Tracking Team (SDTT) is a non-profit organization dedicated to promoting the preservation of wildlife habitat in San Diego County through citizen-based...

  1. 33 CFR 110.210 - San Diego Harbor, CA. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false San Diego Harbor, CA. 110.210... ANCHORAGE REGULATIONS Anchorage Grounds § 110.210 San Diego Harbor, CA. (a) The anchorage grounds. (1... Commander, Naval Base, San Diego, CA. The administration of these anchorages is exercised by the...

  2. 75 FR 71179 - Environmental Impact Statement: San Diego County, CA (United States)


    ... Federal Highway Administration Environmental Impact Statement: San Diego County, CA AGENCY: Federal... Environmental Impact Statement (EIS) will be prepared ] for a proposed highway project in San Diego County... Community Center, 2258 Island Avenue, San Diego, California 92102. FOR FURTHER INFORMATION CONTACT: Kevin...

  3. 75 FR 17329 - Safety Zone; Big Bay Fourth of July Fireworks, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Big Bay Fourth of July Fireworks, San Diego Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Notice of proposed rulemaking. SUMMARY: The Coast Guard proposes establishing a temporary safety zone on the navigable waters of the San Diego Bay in...

  4. 76 FR 70480 - Otay River Estuary Restoration Project, South San Diego Bay Unit of the San Diego Bay National... (United States)


    ... Fish and Wildlife Service Otay River Estuary Restoration Project, South San Diego Bay Unit of the San Diego Bay National Wildlife Refuge, California; Environmental Impact Statement AGENCY: Fish and Wildlife... the San Diego Bay National Wildlife Refuge. This notice advises the public that we intend to gather...

  5. 78 FR 48044 - Safety Zone; San Diego International Airport Terminal Two West Grand Opening Fireworks; San Diego... (United States)


    ... [Docket No. USCG-2013-0637] RIN 1625-AA00 Safety Zone; San Diego International Airport Terminal Two West Grand Opening Fireworks; San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone on the navigable waters of the San Diego Bay in support...

  6. San Diego, California: Solar in Action (Brochure)

    Energy Technology Data Exchange (ETDEWEB)


    This brochure provides an overview of the challenges and successes of San Diego, CA, a 2007 Solar America City awardee, on the path toward becoming a solar-powered community. Accomplishments, case studies, key lessons learned, and local resource information are given.

  7. San Diego Zoo:Success in Breeding

    Institute of Scientific and Technical Information of China (English)


    Giant pandas have become very popular in U.S.zoos. One in particular, the San Diego Zoo, has been extremely successful at making the pandas feel at home and getting them to breed. In 1999, it became home tothe first surviving panda cub born in the United States.

  8. 77 FR 20379 - San Diego Gas & (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission San Diego Gas & Electric Company v. Sellers of Energy and Ancillary Services Into Markets Operated by the California Independent System Operator Corporation and the California...

  9. 76 FR 1386 - Safety Zone; Centennial of Naval Aviation Kickoff, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Centennial of Naval Aviation Kickoff, San... in support of the Centennial of Naval Aviation Kickoff. This temporary safety zone is necessary to... Purpose On February 12, 2010, the Centennial of Naval Aviation Kickoff will take place in San Diego Bay...

  10. El Camino de San Diego

    Directory of Open Access Journals (Sweden)

    Manuel Gárate


    Full Text Available Resulta difícil explicar nuestra pasión sudamericana por el fútbol, pero lo es aún más cuando se trata de aquella que siente pueblo argentino por Diego Armando Maradona. No se trata del cariño propio a una gran estrella del balompié, sino del amor incondicional al “10”: el ídolo popular; el mismo que en 1986 lavó en una cancha de fútbol la afrenta de los ingleses, vencedores de la Guerra de las Malvinas. Pero Maradona también representa el éxito del chico pobre, que viene de las villas miser...

  11. Examination of spotted sand bass (Paralabrax maculatofasciatus) pollutant bioaccumulation in San Diego Bay, San Diego, California. (United States)

    Loflen, Chad L


    The spotted sand bass (Paralabrax maculatofasciatus) is an important recreational sport and subsistence food fish within San Diego Bay, a large industrialized harbor in San Diego, California. Despite this importance, few studies examining the species life history relative to pollutant tissue concentrations and the consumptive fishery exist. This study utilized data from three independent spotted sand bass studies from 1989 to 2002 to investigate PCB, DDT, and mercury tissue concentrations relative to spotted sand bass age and growth in San Diego Bay, with subsequent comparisons to published pollutant advisory levels and fishery regulations for recreational and subsistence consumption of the species. Subsequent analysis focused on examining temporal and spatial differences for different regions of San Diego Bay. Study results for growth confirmed previous work, finding the species to exhibit highly asymptotic growth, making tissue pollutant concentrations at initial take size difficult if not impossible to predict. This was corroborated by independent tissue concentration results for mercury, which found no relationship between fish size and pollutant bioaccumulation observed. However, a positive though highly variable relationship was observed between fish size and PCB tissue concentration. Despite these findings, a significant proportion of fish exhibited pollutant levels above recommended state recreational angler consumption advisory levels for PCBs and mercury, especially for fish above the minimum take size, making the necessity of at-size predictions less critical. Lastly, no difference in tissue concentration was found temporally or spatially within San Diego Bay.

  12. Bismuth ochers from San Diego Co., California (United States)

    Schaller, W.T.


    The chief points brought out in this paper may be briefly summarized as follows: (1) The existence of natural Bi2O3 has not been established. (2) Natural bismite or bismuth ocher, when pure, is more probably a bismuth hydroxide. (3) The bismuth ochers from San Diego County, California, are either a bismuth hydroxide or bismuth vanadate, pucherite, or mixtures of these two. (4) Pucherite has been found noncrystallin and determined for the first time in the United States.

  13. Border Security: The San Diego Fence (United States)


    sector is located north of Tijuana and Tecate, Mexican cities with a combined population of 2 million people, and features no natural barriers to entry...more marked in the areas where fencing was constructed within San Diego sector. The USBP’s Imperial Beach and Chula Vista stations saw their...effects on (1) the Tijuana River National Estuarine Research and Reserve; (2) state and federally listed threatened and endangered species; (3) lands

  14. Enterprise Resource Planning (ERP) : a case study of Space and Naval Warfare Systems Center San Diego's Project Cabrillo


    Hoffman, Dean M.; Oxendine, Eric


    Approved for public release; distribution unlimited This thesis examines the Enterprise Resource Planning (ERP) pilot implementation conducted at the Space and Naval Warfare Systems Center San Diego (SSC-SD), the first of four Department of the Navy (DON) pilot implementations. Specifically, comparisons are drawn between both successful and unsuccessful ERP implementations within private sector organizations and that of SSC-SD. Any commonalities in implementation challenges could be...

  15. 2007 San Diego wildfires and asthmatics. (United States)

    Vora, Chirag; Renvall, Marian J; Chao, Peter; Ferguson, Paul; Ramsdell, Joe W


    This case series reports the changes in the respiratory health of eight asthmatic subjects and the relationship with air quality associated with the October 2007 firestorm in San Diego County of California. Participants were eight subjects with asthma enrolled in Asthma Clinical Research Network (ACRN) (NIH# U10-HL074218) studies at the University of California San Diego (UCSD), School of Medicine, who had study data collected immediately prior, during and 1 month after the 5-day firestorm in San Diego County. Air quality deteriorated to an extreme average of 71.5 mg/m(3) small particulate matter less than 2.5 μm (PM(2.5)) during the firestorm. Respiratory health data included morning and evening peak expiratory flow rates (PEFR), morning and evening Forced Expiratory Volume in one second (FEV(1)), rescue medication usage, and sputum eosinophils. Morning and evening PEFR and FEV(1) rates remained stable. The two subjects tested during the fires had elevated eosinophil counts and rescue medication usage was increased in five of the eight subjects. Pulmonary function test values were stable during the wildfires for all eight subjects but there was a statistically significant increase in rescue medication usage during the wildfires that correlated with PM(2.5) values. The two subjects tested during the fires showed increases in sputum eosinophil counts consistent with increased airways inflammation. These findings suggest that poor air quality associated with wildfires resulted in an increase in airways inflammation in these asthmatic subjects, but pulmonary function tests remained stable, possibly due to increased rescue medication usage. This is especially pertinent as there is an increase in incidence of wildfires this decade.

  16. Species Observations (poly) - San Diego County [ds648 (United States)

    California Department of Resources — Created in 2009, the SanBIOS database serves as a single repository of species observations collected by various departments within the County of San Diego's Land...

  17. Gredos San Diego Cooperative. Cooperate to undertake

    Directory of Open Access Journals (Sweden)

    Carlos de la Higuera


    Full Text Available This paper analyzes the cooperative experience through Gredos San Diego model, its institutional approaches and its history from the point of view of management, focusing on the variables that enable the success of a collective ownership institution. First, the author makes a brief analysis of the principles that guide the cooperative, its origins and its current situation, including the development of GSD Cooperative Group. It continues exploring the evolution of management, dividing it into four distinct stages, and concludes with a summary with the findings of the previous president of the cooperative.Received: 23.07.2012Accepted: 10.09.2012

  18. The Future SSC Pacific Civil Service Workforce (United States)


    TECHNICAL REPORT 1971 August 2008 The Future SSC Pacific Civil Service Workforce P. Shigley G. Pennoyer J. Carreño Approved for... Shigley G. Pennoyer J. Carreño Approved for public release; distribution is unlimited. SSC San Diego San Diego, CA 92152-5001 SB...Prescribed by ANSI Std. Z39.18 08–2008 Final THE FUTURE SSC PACIFIC CIVIL SERVICE WORKFORCE P. Shigley G. Pennoyer J

  19. 33 CFR 80.1104 - San Diego Harbor, CA. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false San Diego Harbor, CA. 80.1104 Section 80.1104 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Coast § 80.1104 San Diego Harbor, CA. A line drawn...

  20. The San Diego Panasonic Partnership: A Case Study in Restructuring. (United States)

    Holzman, Michael; Tewel, Kenneth J.


    The Panasonic Foundation provides resources for restructuring school districts. The article examines its partnership with the San Diego City School District, highlighting four schools that demonstrate promising practices and guiding principles. It describes recent partnership work on systemic issues, noting the next steps to be taken in San Diego.…

  1. The San Diego Panasonic Partnership: A Case Study in Restructuring. (United States)

    Holzman, Michael; Tewel, Kenneth J.


    The Panasonic Foundation provides resources for restructuring school districts. The article examines its partnership with the San Diego City School District, highlighting four schools that demonstrate promising practices and guiding principles. It describes recent partnership work on systemic issues, noting the next steps to be taken in San Diego.…

  2. 40 CFR 81.164 - San Diego Intrastate Air Quality Control Region. (United States)


    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false San Diego Intrastate Air Quality... Quality Control Regions § 81.164 San Diego Intrastate Air Quality Control Region. The San Diego Intrastate... within the outermost boundaries of the area so delimited): In the State of California: San Diego County. ...

  3. 77 FR 43350 - Draft Environmental Assessment and Proposed Habitat Conservation Plan for the San Diego Unified... (United States)


    ... San Diego Unified School District's Jonas Salk Elementary School Project in the City of San Diego, San Diego County, CA AGENCY: Fish and Wildlife Service, Interior. ACTION: Notice of availability: request... Elementary School Project in response to an application from the San Diego Unified School District (District...

  4. Puente Coronado - San Diego (EE. UU.

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo


    Full Text Available This 3,5 km long bridge, joining the cities of San Diego and Coronado is one of the longest in the world of this type, and one of the three most important straight line bridges in the United States. Its supporting structure consists of reinforced concrete columns resting on footings or piles, according to whether they are under the sea water or on dry land. The superstructure is partly of metal plates and partly of box girders. The surfacing of the deck consists of asphalt epoxy concrete, of 5 cm depth. Special paint was applied to the bridge, including layers of vinyl, iron oxide and blue vinyl on a zinc base.Este puente, de unos 3 km y medio, que une las ciudades de San Diego y Coronado es uno de los de mayor longitud del mundo, de este tipo, y uno de los tres principales ortótropos de los Estados Unidos de América. Su infraestructura está constituida por pilas de hormigón armado apoyadas sobre pilotes o sobre zapatas, según estén en el mar o en tierra firme. La superestructura está formada, en parte, por chapas metálicas y, en parte, por vigas cajón. El acabado del tablero metálico se realizó a base de hormigón asfáltico de epoxi con un espesor de 5 cm. La pintura es especial y se compone de capas de vinilo, de óxido de hierro y de vinilo azul sobre una capa de cinc.

  5. San Diego Littoral Cell CRSMP Potential Offshore Borrow Areas 2009 (United States)

    California Department of Resources — Offshore sediment sources along the entire reach of the San Diego Coastal RSM Plan region were previously identified by SANDAG and used for Regional Beach Sand...

  6. Vernal Pool Amphibians, Shrimp, Plants - San Diego [ds188 (United States)

    California Department of Resources — In 2002, the City of San Diego (City) received funding through a U. S. Fish and Wildlife Service (USFWS) Section 6 Planning Grant to complete an inventory and...

  7. San Diego, California Tsunami Forecast Grids for MOST Model (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The San Diego, California Forecast Model Grids provides bathymetric data strictly for tsunami inundation modeling with the Method of Splitting Tsunami (MOST) model....

  8. San Diego, California 1/3 arc-second DEM (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 1/3-second San Diego, California Elevation Grid provides bathymetric data in ASCII raster format of 1/3-second resolution in geographic coordinates. This grid is...

  9. San Diego Littoral Cell CRSMP Receiver Sites 2009 (United States)

    California Department of Resources — A total of 27 possible placement sites (some with multiple placement footprints) are incorporated into this San Diego Coastal Regional Sediment Management Plan to...

  10. Baseline Surveys - Tecolote Canyon, San Diego Co. [ds655 (United States)

    California Department of Resources — Various resource projects have been conducted in the City of San Diego's Open Space Parks as part of the implementation of the City's Multiple Species Conservation...

  11. RadNet Air Data From San Diego, CA (United States)

    This page presents radiation air monitoring and air filter analysis data for San Diego, CA from EPA's RadNet system. RadNet is a nationwide network of monitoring stations that measure radiation in air, drinking water and precipitation.

  12. Vegetation Mapping - Tecolote Canyon, San Diego Co. [ds656 (United States)

    California Department of Resources — Vegetation mapping has been conducted at various City of San Diego Park and Recreation Open Space lands in support of natural resource management objectives and the...

  13. San Diego Bay National Wildlife Refuge: Sweetwater Marsh and South San Diego Bay Units: Comprehensive Conservation Plan and Environmental Impact Statement: Volume I (United States)

    US Fish and Wildlife Service, Department of the Interior — This Comprehensive Conservation Plan (CCP) was written to guide management on San Diego Bay NWR (Sweetwater Marsh and South San Diego Bay Units) for the next 15...

  14. Estimating Bicycle and Pedestrian Demand in San Diego


    Jones, Michael; Buckland, Lauren


    This paper introduces the concepts behind estimating bicycle and pedestrian demand and provides an example of the development of a sketch-plan method for estimating bicycle and pedestrian demand from land use in San Diego County. The paper describes the methodology involved in collecting counts for the currently ongoing Seamless Travel project. The Seamless Travel project intends to develop a model for estimating bicycle and pedestrian demand within San Diego County. The project methodology i...

  15. 77 FR 34984 - Notice of Intent To Repatriate a Cultural Item: San Diego Museum of Man, San Diego, CA (United States)


    ...The San Diego Museum of Man, in consultation with the appropriate Indian tribes, has determined that a cultural item meets the definition of unassociated funerary object and repatriation to the Indian tribes stated below may occur if no additional claimants come forward. Representatives of any Indian tribe that believes itself to be culturally affiliated with the cultural item may contact the San Diego Museum of Man.

  16. 78 FR 66844 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of... San Diego Fall Classic, held on November 10, 2013. This event occurs on Mission Bay in San Diego, CA....S. Coast Guard Sector San Diego, CA; telephone (619) 278-7656, email D11-PF-MarineEventsSanDiego...

  17. General Atomic Laboratories. San Diego - California

    Directory of Open Access Journals (Sweden)

    Luckman, Charles


    Full Text Available El edificio está emplazado en un espacioso solar de Torrey Pines Mesa, situado en la parte norte de la ciudad de San Diego (California. Los servicios fundamentales comprenden un bloque administrativo; una gran construcción experimental; dos edificios de forma semicilíndrica, en los que se encuentran los laboratorios particulares y las oficinas correspondientes; y otro edificio, de planta circular, en el que está la biblioteca y que, además, sirve para centro de reuniones, conferencias e información técnica. También existe un edificio en el que se encuentra el acelerador lineal de partículas, otros dos que sirven para la investigación de la fisión nuclear y el salón de reuniones. El complejo de los laboratorios, incluyendo los edificios auxiliares y de servicio, ocupa aproximadamente 24.000 m2 y es uno de los mayores y mejor acondicionados para la investigación nuclear privada del mundo.

  18. SSC San Diego Command History Calendar Year 2004 (United States)


    Unclassified But Sensitive) IP Router Network services to customers. Team members: Rafael Maldonado, Israel Arenas, Mytiec Lam, Hang Le, Maurice Murphy...Robert O’Leary, Mark Schwartz, Robin Chu, John Kottong, Sandy Wetzel-Smith, Bobby Ramirez , Eleanor Holmes, Jay Mclnvale, Carmela Keeney, Patricia Thomas...Granlee, Roger Ligon, J.C. Norris, Jim Pomerene, John Wadsworth, Abundio Alvarez , Robert Calland, Arthur Chagnon, Dr. Donald Christy, Dr. I.R

  19. SSC San Diego Command History Calendar Year 2007 (United States)


    Scrimpsher, Luis Biaggi, Mitchell Gillette, Chew Hom, Michael Gonzales, Randall Smith, Vivian Chu, James Hlava, Eric Rupert, Ellen Ward, Manuel Silveira...Hamaguchi, Al Cassedy, Paul Lichtenstein, David Stevens, Stan Durbin, Ed Van Houten, Grely Ponce , Dr. Randy Moore, Larry Mohr, Mike Phillips, Andy...Michelle Sund, Larry Campbell, Bob Franco, Rick Ponce , Ron Diaz, Douglas Hovermale, Monica Dukes, George Vajgrt, Mike Hammock, Jim Logsdon, Henry

  20. Solar energy system performance evaluation-seasonal report for Elcam San Diego, San Diego, California (United States)


    The solar energy system, Elcam San Diego, was designed to supply domestic hot water heating for a single family residence located in Encinitas, California. System description, performance assessment, operating energy, energy savings, maintenance, and conclusions are presented. The system is a 'Sunspot' two tank cascade type, where solar energy is supplied to either a 66 gallon preheat tank (solar storage) or a 40 gallon domestic hot water tank. Water is pumped directly from one of the two tanks, through the 65 square feet collector array and back into the same tank. Freeze protection is provided by automatically circulating hot water from the hot water tank through the collectors and exposed plumbing when freezing conditions exist. Auxiliary energy is supplied by natural gas. Analysis is based on instrumented system data monitored and collected for one full season of operation.

  1. 33 CFR 334.860 - San Diego Bay, Calif., Naval Amphibious Base; restricted area. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false San Diego Bay, Calif., Naval..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.860 San Diego... Middle San Diego Bay in an area extending from the northern and eastern boundary of the Naval Amphibious...

  2. 78 FR 32121 - When Pigs Fly Fireworks Display; San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 When Pigs Fly Fireworks Display; San Diego, CA AGENCY... on the navigable waters of the San Diego Bay in support of the When Pigs Fly Fireworks Display on... Management, U.S. Coast Guard Sector San Diego, Coast Guard; telephone 619-278-7656, email...

  3. 33 CFR 165.1120 - Security Zone; Naval Amphibious Base, San Diego, CA. (United States)


    ... Base, San Diego, CA. 165.1120 Section 165.1120 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.1120 Security Zone; Naval Amphibious Base, San Diego, CA. (a) Location. The following area is a security zone: the waters of San Diego Bay, enclosed by lines connecting the following points: Beginning at...

  4. 33 CFR 165.1110 - Security Zone: Coronado Bay Bridge, San Diego, CA. (United States)


    ... Bridge, San Diego, CA. 165.1110 Section 165.1110 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.1110 Security Zone: Coronado Bay Bridge, San Diego, CA. (a) Location. All navigable waters of San Diego Bay, from the surface to the sea floor, within 25 yards of all piers, abutments, fenders and...

  5. 75 FR 19248 - Subject: Safety Zone; Sea World Summer Nights Fireworks, Mission Bay, San Diego, CA (United States)


    ..., Mission Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast... Management, U.S. Coast Guard Sector San Diego, CA; telephone 619-278- 7262, e-mail Bay, San Diego, California. (a) Location. The limits of the safety zone will include a 600 foot radius...

  6. 75 FR 11194 - San Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation... (United States)


    ... Fish and Wildlife Service San Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation Plan, San Diego and Riverside Counties, CA AGENCY: Fish and Wildlife Service... application, and notice of public meetings for the San Diego County Water Authority's (Water Authority...

  7. 33 CFR 334.880 - San Diego Harbor, Calif.; naval restricted area adjacent to Point Loma. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false San Diego Harbor, Calif.; naval....880 San Diego Harbor, Calif.; naval restricted area adjacent to Point Loma. (a) The area. That portion of San Diego Bay southerly of Ballast Point, exclusive of the southwesterly portion of the restricted...

  8. 33 CFR 165.1108 - Security Zones; Cruise Ships, Port of San Diego, California. (United States)


    ..., Port of San Diego, California. 165.1108 Section 165.1108 Navigation and Navigable Waters COAST GUARD... § 165.1108 Security Zones; Cruise Ships, Port of San Diego, California. (a) Definition. “Cruise ship” as... or at a port of call in the San Diego port. (b) Location. The following areas are security zones: (1...

  9. 78 FR 48046 - Safety Zone; Kuoni Destination Management Fireworks; San Diego, CA (United States)


    ... [Docket No. USCG-2013-0666] RIN 1625-AA00 Safety Zone; Kuoni Destination Management Fireworks; San Diego... safety zone on the navigable waters of the San Diego Bay in support of the Kuoni Destination Management... San Diego, Coast Guard; telephone 619-278-7656, email . If you have...

  10. 33 CFR 165.1104 - Security Zone: San Diego Bay, CA. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone: San Diego Bay, CA... Navigation Areas and Limited Access Areas Eleventh Coast Guard District § 165.1104 Security Zone: San Diego... into the area of this zone is prohibited unless authorized by the Captain of the Port San Diego...

  11. Our Economy: How It Works. San Diego Results (1981). (United States)

    Foundation for Teaching Economics, San Francisco, CA.

    Five hundred and thirteen ninth grade students in San Diego, California, used the junior high economics textbook "Our Economy: How It Works" (Addison-Wesley, 1980) in a semester-long course and then were evaluated. The text uses case studies about the manufacture of familiar products, financial institutions, and government to make…

  12. Annual Report of the Chancellor, San Diego Community College District. (United States)

    Parnell, Dale

    This document contains a review of the goals of the San Diego Community College District for 1975-76 and the progress that has been made to date in accomplishing those goals. Broad categories reviewed include stabilization and improvement of the environment for teaching and learning, systematization of management efforts, the search for new…




  14. Sediment Quality Characterization Naval Station San Diego (United States)


    Current Profiler APDC Ammonium pyrolidine dithiocarbamate Ag Silver As Arsenic ASTM American Society for Testing and Materials AVS Acid Volatile one method for screening measured samples to deter- mine the likelihood of ecological effects. Our study data were compiled with data from the SSC...biological data. The chemical and biological data within each subregion were then evaluated based on commonly applied screening effect thresholds. Within each

  15. 78 FR 68995 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of... San Diego Parade of Lights, held on December 8, 2013 and December 15, 2013. This event occurs on the San Diego Bay in San Diego, CA. These special local regulations are necessary to provide for the...

  16. 78 FR 53109 - Security Zones; Naval Base Point Loma; Naval Mine Anti-Submarine Warfare Command; San Diego Bay... (United States)


    ...-Submarine Warfare Command; San Diego Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Notice of proposed rulemaking. SUMMARY: The Coast Guard proposes extending a portion of an existing San Diego Bay security zone... security zone modifications are intended to restrict vessels from a portion of the San Diego Bay in order...

  17. 78 FR 72019 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of... during this year's parade held on December 14, 2013. This event occurs on Mission Bay in San Diego, CA.... Coast Guard Sector San Diego, CA; telephone (619) 278-7656, email

  18. 76 FR 5732 - Security Zones; Cruise Ships, Port of San Diego, CA; Correction (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA87 Security Zones; Cruise Ships, Port of San Diego, CA... FR 4833), regarding security zones for cruise ships in the Port of San Diego, California. This... Diego, Coast Guard; telephone 619-278-7261, e-mail . If you have questions on...

  19. 76 FR 9348 - Southern California Edison Company, Pacific Gas and Electric Company, San Diego Gas & Electric... (United States)


    ... Diego Gas & Electric Company; Notice of Petition Take notice that on January 31, 2011, pursuant to... Edison Company (SCE), Pacific Gas and Electric Company (PG&E), and San Diego Gas & Electric Company (SDG..., Joint Petition of Pacific Gas and Electric Company, Southern California Edison Company, and San Diego...

  20. 76 FR 22812 - Safety Zone; Sea World Fireworks; Mission Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Sea World Fireworks; Mission Bay, San Diego... Diego, CA; telephone (619) 278- 7233, e-mail . If you have questions on...; Mission Bay, San Diego, CA. (a) Location. The safety zone will include the area within 600 feet of the...

  1. Shoulder dysplasia in koalas (Phascolarctos cinereus) at San Diego Zoo. (United States)

    Pye, Geoffrey W


    A radiographic study documented shoulder dysplasia (n = 43), with varying degrees of malformation of the supraglenoid and infraglenoid tubercles and the coracoid process, shallowing or loss of the glenoid cavity, flattening or loss of the humeral head, malformation of the greater and lesser tubercles, loss of the intertubercle groove, and humeral diaphyseal abnormalities, in northern koalas (Phascolarctos cinereus) in the San Diego Zoo (San Diego, California, USA) colony. Retrospectively, historic radiographs (n = 38) were examined where available. Prospectively, three standard views (lateral extended arm, ventrodorsal cranially positioned arms, and ventrodorsal caudally positioned arms) were imaged (n = 25). In all radiographs, shoulders were graded as normal, or mildly, moderately, or severely dysplastic. Although affected koalas typically do not exhibit clinical signs, degenerative joint disease may develop and clinical signs treated with nonsteroidal anti-inflammatory drugs. Where shoulder and hip radiographs were both available (n = 60), 92% of individuals had correlation between the degree of shoulder and hip dysplasia.

  2. 78 FR 72025 - Security Zones; Naval Base Point Loma; Naval Mine Anti Submarine Warfare Command; San Diego Bay... (United States)


    ... Submarine Warfare Command; San Diego Bay, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Final rule. SUMMARY: The Coast Guard is increasing a portion of an existing San Diego Bay security zone at Naval Base... Diego Bay in order to ensure the safety and security of Naval assets. Both security zones will safeguard...

  3. 76 FR 1521 - Security Zone: Fleet Industrial Supply Center Pier, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA87 Security Zone: Fleet Industrial Supply Center Pier, San... of the San Diego Bay, San Diego, CA. The existing security zone is around the former Fleet Industrial... Fleet Industrial Supply Center Pier. The pier is no longer owned by the U.S. Navy and the security zone...

  4. 77 FR 68813 - Notice of Closure of Airport Mesa/Carizzo Creek Shooting Area in Eastern San Diego County, CA (United States)


    ... Closure of Airport Mesa/Carizzo Creek Shooting Area in Eastern San Diego County, CA AGENCY: Bureau of Land... San Diego County, California. The closure order prohibits recreational shooting and target practice... following public lands in eastern San Diego County to recreational shooting and target practice: San...

  5. EPA, San Diego County Air District to Unveil Air Monitor in San Ysidro (United States)

    LOS ANGELES - On Tuesday, U.S. EPA Regional Administrator Jared Blumenfeld, along with representatives from the San Diego County Air Pollution Control District (SDAPCD), U.S. Customs and Border Protection and the U.S. General Services Administration, will

  6. 76 FR 53913 - Award of an Urgent Single-Source Grant to Survivors of Torture International (SOTI) in San Diego... (United States)


    ... Torture International (SOTI) in San Diego, CA; Correction AGENCY: Office of Refugee Resettlement, ACF, HHS... urgent single-source grant to Survivors of Torture, International (SOTI), San Diego, CA. The document...

  7. 33 CFR 165.1121 - Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. (United States)


    ... Guard District § 165.1121 Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. (a... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. 165.1121 Section 165.1121 Navigation and Navigable Waters COAST...

  8. 75 FR 56942 - Revisions to the California State Implementation Plan, San Diego County Air Pollution Control... (United States)


    ... AGENCY 40 CFR Part 52 Revisions to the California State Implementation Plan, San Diego County Air Pollution Control District AGENCY: Environmental Protection Agency (EPA). ACTION: Proposed rule. SUMMARY: EPA is proposing to approve revisions to the San Diego Air Pollution Control District...

  9. 78 FR 37176 - Revisions to the California State Implementation Plan, San Diego Air Pollution Control District (United States)


    ... AGENCY 40 CFR Part 52 Revisions to the California State Implementation Plan, San Diego Air Pollution Control District AGENCY: Environmental Protection Agency (EPA). ACTION: Proposed rule. SUMMARY: EPA is proposing to approve a revision to the San Diego Air Pollution Control District (SDAPCD) portion of...

  10. 76 FR 4833 - Security Zones; Cruise Ships, Port of San Diego, CA (United States)


    ... waters within a 100 yard radius around any cruise ship that is located within the San Diego port area... to provide for the safety of the cruise ship, vessels, and users of the waterway. Entry into these... floor, within a 100 yard radius around any cruise ship that is within the San Diego port area inside...

  11. 76 FR 15216 - Security Zones; Cruise Ships, Port of San Diego, CA (United States)


    ... any cruise ship that is located within the San Diego port area landward of the sea buoys bounding the... provide for the safety of the cruise ship, vessels, and users of the waterway. Entry into these security... any cruise ship that is within the San Diego port area inside the sea buoys bounding the Port of...

  12. 33 CFR 165.1101 - Security Zone: San Diego Bay, CA. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone: San Diego Bay, CA... Navigation Areas and Limited Access Areas Eleventh Coast Guard District § 165.1101 Security Zone: San Diego... Diego enclosed by the following points: Beginning at 32°41′16.5″ N, 117°08′01″ W (Point A); thence...

  13. The 2007 San Diego Wildfire impact on the Emergency Department of the University of California, San Diego Hospital System. (United States)

    Schranz, Craig I; Castillo, Edward M; Vilke, Gary M


    In October 2007, San Diego County experienced a severe firestorm resulting in the burning of more than 368,000 acres, the destruction of more than 1,700 homes, and the evacuation of more than 500,000 people. The goal of this study was to assess the impact of the 2007 San Diego Wildfires, and the acute change in air quality that followed, on the patient volume and types of complaints in the emergency department. A retrospective review was performed of a database of all patients presenting to the Emergency Departments of University of California, San Diego (UCSD) hospitals for a six-day period both before (14-19 October 2007) and after (21-26 October 2007) the start of the 2007 firestorm. Charts were abstracted for data, including demographics, chief complaints, past medical history, fire-related injuries and disposition status. As a measure of pollution, levels of 2.5 micron Particulate Matter (PM 2.5) also were calculated from data provided by the San Diego Air Pollution Control District. Emergency department volume decreased by 5.8% for the period following the fire. A rapid rise in PM2.5 levels coincided with the onset of the fires. The admission rate was higher in the period following the fires (19.8% vs. 15.2%) from the baseline period. Additionally, the Left Without Being Seen (LWBS) rate doubled to 4.6% from 2.3%. There was a statistically significant increase in patients presenting with a chief complaint of shortness of breath (6.5% vs. 4.2% p = 0.028) and smoke exposure (1.1% vs. 0% p = 0.001) following the fires. Patients with significant cardiac or pulmonary histories were no more likely to present to the emergency department during the fires. Despite the decreased volume, the admission and LWBS rate did increase following the onset of the firestorm. The cause of this increase is unclear. Despite a sudden decline in air quality, patients with significant cardiac and pulmonary morbidity did not vary their emergency department utilization rate. Based on the

  14. 33 CFR 165.T11-304 - Safety zone; Sea World Summer Nights Fireworks; Mission Bay, San Diego, California. (United States)


    ... Nights Fireworks; Mission Bay, San Diego, California. 165.T11-304 Section 165.T11-304 Navigation and...; Mission Bay, San Diego, California. (a) Location. The limits of the safety zone will include a 600 foot... prohibited unless authorized by the Captain of the Port of San Diego or his designated on-scene...

  15. 77 FR 49863 - Pacific Imperial Railroad, Inc.-Change in Operator Exemption-Rail Line of San Diego and Arizona... (United States)


    ... San Diego and Arizona Eastern Railway Company Pacific Imperial Railroad, Inc. (PIR), a noncarrier, has... is owned by San Diego and Arizona Eastern Railway Company (SD&AE). The agreement provides for a... Line to PIR, with the consent of SD&AE, its parent, San Diego Metropolitan Transit Development Board...

  16. 78 FR 17598 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of regulation. SUMMARY: The Coast Guard will enforce the 2013 San Diego Crew Classic Special Local Regulation located in the regulated area encompasses that portion of Mission Bay, San Diego, California bounded by...

  17. 77 FR 66713 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of.... to 11:30 a.m. on November 11, 2012 on Mission Bay, CA in support of the San Diego Fall Classic. This... Bryan Gollogly, Waterways Management, U.S. Coast Guard Sector San Diego, CA; telephone (619) 278-7656...

  18. 78 FR 10523 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of..., Waterways Management, U.S. Coast Guard Sector San Diego, CA; telephone 619-278-7656, email . SUPPLEMENTARY INFORMATION: The Coast Guard will enforce the Special Local...

  19. 33 CFR 165.1122 - San Diego Bay, Mission Bay and their Approaches-Regulated navigation area. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false San Diego Bay, Mission Bay and... Coast Guard District § 165.1122 San Diego Bay, Mission Bay and their Approaches—Regulated navigation... waters of San Diego Bay, Mission Bay, and their approaches encompassed by a line commencing at Point La...

  20. 77 FR 72957 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of... of Lights, on the waters of Mission Bay, San Diego, California from 6 p.m. to 8 p.m. on 08 December... Deborah Metzger, Waterways Management, U.S. Coast Guard Sector San Diego, CA; telephone (619) 278-7656...

  1. 77 FR 72956 - Special Local Regulation; Southern California Annual Marine Events for the San Diego Captain of... (United States)


    ... the San Diego Captain of the Port Zone AGENCY: Coast Guard, DHS. ACTION: Notice of enforcement of regulation. SUMMARY: The Coast Guard will enforce special local regulations during the San Diego Parade of Lights, held on December 09 and December 16, 2012 from 5:30 p.m. to 8:30 p.m. on the San Diego Bay. These...

  2. 75 FR 19422 - Notice of Closure of Airport Mesa/Carizzo Creek Shooting Area in Eastern San Diego County, CA (United States)


    ... Diego County, CA AGENCY: Bureau of Land Management, Interior. ACTION: Notice of temporary closure... as the Airport Mesa/Carrizo Creek shooting area located in eastern San Diego County, California. The... eastern San Diego County to recreational shooting and target practice: San Bernardino Base and Meridian...

  3. 75 FR 15611 - Safety Zone; United Portuguese SES Centennial Festa, San Diego Bay, San Diego, CA (United States)


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; United Portuguese SES Centennial Festa, San... United Portuguese SES Centennial Festa. This temporary safety zone is necessary to provide for the safety... Spectaculars is sponsoring the United Portuguese SES Centennial Festa, which will include a fireworks...

  4. Anthelmintics: From discovery to resistance II (San Diego, 2016). (United States)

    Martin, Richard J; Wolstenholme, Adrian J; Caffrey, Conor R


    The second scientific meeting in the series: "Anthelmintics: From Discovery to Resistance" was held in San Diego in February, 2016. The focus topics of the meeting, related to anthelmintic discovery and resistance, were novel technologies, bioinformatics, commercial interests, anthelmintic modes of action and anthelmintic resistance. Basic scientific, human and veterinary interests were addressed in oral and poster presentations. The delegates were from universities and industries in the US, Europe, Australia and New Zealand. The papers were a great representation of the field, and included the use of C. elegans for lead discovery, mechanisms of anthelmintic resistance, nematode neuropeptides, proteases, B. thuringiensis crystal protein, nicotinic receptors, emodepside, benzimidazoles, P-glycoproteins, natural products, microfluidic techniques and bioinformatics approaches. The NIH also presented NIAID-specific parasite genomic priorities and initiatives. From these papers we introduce below selected papers with a focus on anthelmintic drug screening and development. Copyright © 2016. Published by Elsevier Ltd.

  5. 77 FR 52061 - Notice of Proposed Exemption Involving Sharp HealthCare Located in San Diego, CA (United States)


    ... Diego, CA AGENCY: Employee Benefits Security Administration, U.S. Department of Labor. ACTION: Notice of... system located in San Diego County. Sharp was created in 1946 as a non-profit association to raise funds... of Managed Health Care and is offered to San Diego employers and individuals. The Applicant notes...

  6. 78 FR 4981 - Pacific Imperial Railroad, Inc.-Change in Operator Exemption-Rail Line of San Diego and Arizona... (United States)


    ... San Diego and Arizona Eastern Railway Company Pacific Imperial Railroad, Inc. (PIR), a noncarrier, has filed a verified notice of exemption under 49 CFR 1150.31 to change operators from San Diego & Imperial... Diego and Arizona Eastern Railway Company (SD&AE). The change in operators for the line is being...

  7. 2011 Invasive Non-native Plant Inventory : San Diego National Wildlife Refuge (United States)

    US Fish and Wildlife Service, Department of the Interior — San Diego National Wildlife Refuge (NWR) was one of four refuges selected to participate in a NWRS pilot project to evaluate the similarities and differences in...

  8. Proposed South San Diego Bay National Wildlife Refuge: Level III preaquisition survey (United States)

    US Fish and Wildlife Service, Department of the Interior — A Level III Contaminant Preaquisition Survey was conducted during 1992 in the south San Diego Bay area to evaluate potential hazards to trustee resources and/or...

  9. Prioritizing Invasive Plant Populations with WHIPPET: Report to San Diego National Wildlife Refuge (United States)

    US Fish and Wildlife Service, Department of the Interior — This report is a summary of the WHIPPET analysis as applied to invasive plant data from San Diego National Wildlife Refuge (refuge). The WHIPPET analysis had two...

  10. California Clean Air Act: A compliance strategy for the City of San Diego`s non-emergency fleet

    Energy Technology Data Exchange (ETDEWEB)


    Historically, parts of California have had the worst air quality in the nation. The California Energy Commission began experimenting with alternate fuels in the 1970`s in an effort to reduce harmful automobile emissions and hence, improve air quality. It is recognized that the costs to California which result from our air quality problems are immense. Ten to twenty billion dollars each year is the estimated damage in terms of health impacts, materials damages, lost agricultural crop output and forest damages. As the California population increases and health care costs escalate, the total monetary damages from air pollution will increase. The California Energy Commission goal to improve air quality became a mandate in 1988 with the passage of the California Clean Air Act (CCAA). The CCAA requires a revised air quality strategy for the San Diego district since we do not meet State air quality standards for smog, carbon monoxide and nitrogen dioxide. Smog remains San Diego`s major air quality problem, even though the annual number of days each year over the Federal standard has been reduced by 55 percent in the past ten years. Ten years ago about two-thirds of San Diego`s smog was transported from Los Angeles. Today more than 60 per cent of the days San Diego exceeds the State standard are from locally generated smog. It is estimated that 57% of the reactive hydrocarbon emissions (which react with nitrogen dioxide in the presence of sunlight to form smog) is from cars, trucks and buses. The Air Pollution Control District (part of the County of San Diego) is the office that the Air Resources Board has put in charge of creating regulations and designing strategy to reduce polluting emissions. The purpose of this project is to determine the full cost of acquiring and operating a municipal fleet which meets the mandates of the California Clean Air Act. With that information, a plan to meet the Clear Air Act (CCAA) requirements can be formulated by local government.

  11. Degradation of tributyltin in San Diego Bay, California, waters

    Energy Technology Data Exchange (ETDEWEB)

    Seligman, P.F.; Valkirs, A.O.; Lee, R.F.


    Several experiments were carried out to determine the degradation rate of tributyltin (TBT) in microcosms containing harbor water. Unlabeled or /sup 14/C-labeled tributyltin was added to water samples collected from two stations in San Diego Bay, CA. Degradation rates were determined by calculating the rate of loss of the added parent TBT compound. Calculated half-lives in water collected from a yacht harbor (ambient concentration was 0.5 of TBT/L) were 6 and 7 days for light and dark treatments, respectively. Half-lives from a clean-water site (< 0.03 of TBT/L) were 9 and 19 days for light and dark treatments, respectively. The principal degradation product in all experiments was dibutyltin with lesser amounts of monobutyltin. Complete mineralization, measured by the formation of /sup 14/CO/sub 2/, proceeded slowly with a half-life of 50-75 days. Tributyltin at high concentrations (744 was not degraded in sunlight, indicating that photolysis was not taking place and that biological degradation was the primary degradative process for TBT at low ambient concentrations.

  12. Deaths associated with choking in San Diego county. (United States)

    Dolkas, Laura; Stanley, Christina; Smith, Alan M; Vilke, Gary M


    Death from choking is the fourth most common cause of unintentional-injury mortality, but little data are published on causes or locations of these episodes. These deaths typically are peaked at the extremes of age, with young children and the elderly having the greatest rate of fatal choking. Our objective was to characterize the causes of fatal airway obstruction in adults. The San Diego County Medical Examiner's database was searched for deaths attributed to choking in decedents 18 years and older during the 10-year period from 1994 to 2004. Data were abstracted regarding the underlying medical conditions, items choked on, location of the choking, and treatments involved in the individual cases. We found 133 victims who died from choking, with 14% having using alcohol or other sedatives and 55% having a documented neurological deficit or anatomic difficulty with swallowing. The most common specified food objects that victims choked on were meat products, and 45% occurred at home, followed by 26% at supervised facilities, and 14% at restaurants. Of the 19 choking episodes occurring in restaurants, only one employee was documented to attempt a resuscitative effort. Most victims who choked to death had an underlying neurological deficit, and occurred at home or supervised facilities appear to have an appropriate initial-response intervention.

  13. Epidemiologic Analysis of Onychomycosis in the San Diego Pediatric Population. (United States)

    Totri, Christine R; Feldstein, Stephanie; Admani, Shehla; Friedlander, Sheila F; Eichenfield, Lawrence F


    Onychomycosis (OM) is thought to be a rare disease in children, although there are few epidemiologic studies. This 3-year retrospective case series of nearly 400 children seen at Rady Children's Hospital-San Diego (RCHSD) describes the characteristics of OM found in this pediatric population. From 2011 to 2013, the Pediatric and Adolescent Dermatology Clinic at RCHSD saw a total of 36,634 unique patients, of whom 433 were unique patients with OM. Thirty-four patients met exclusion criteria, leaving 399 (1.1%) with a diagnosis of OM by a pediatric dermatologist. Nail cultures were obtained in 242 cases (60.7%), 116 (48.0%) of which were positive. Trichophyton rubrum was the most commonly isolated pathogen, responsible for 106 cases (91.3%) of positive cultures in the cohort. Our study provides important regional information regarding epidemiologic data in pediatric onychomycosis, highlighting the diagnostic methods most commonly used and the pathogens most frequently encountered in our practice. © 2016 Wiley Periodicals, Inc.

  14. Solar energy system economic evaluation for Elcam-Tempe, Tempe, Arizona and Elcam-San Diego, San Diego, California (United States)


    The long term economic performance of the solar energy system at its installation site is analyzed and four additional locations selected to demonstrate the viability of the design over a broad range of environmental and economic conditions. The economic analysis of the solar energy systems that were installed at Tempe, Arizona and San Diego, California, is developed for these and four other sites typical of a wide range of environmental and economic conditions in the continental United States. This analysis is accomplished based on the technical and economic models in the f Chart design procedure with inputs based on the characteristics of the installed system and local conditions. The results are expressed in terms of the economic parameters of present worth of system cost over a projected twenty year life: life cycle savings; year of positive savings; and year of payback for the optimized solar energy system at each of the analysis sites. The sensitivity of the economic evaluation to uncertainites in constituent system and economic variables is also investigated. The results demonstrate that the solar energy system is economically viable at all of the sites for which the analysis was conducted.

  15. Multibeam bathymetry and selected perspective views offshore San Diego, California (United States)

    Dartnell, Peter; Normark, William R.; Driscoll, Neal W.; Babcock, Jeffrey M.; Gardner, James V.; Kvitek, Rikk G.; Iampietro, Pat J.


    This set of two posters consists of a map on one sheet and a set of seven perspective views on the other. The ocean floor image was generated from multibeam-bathymetry data acquired by Federal and local agencies as well as academic institutions including: - U.S. Geological Survey mapped from the La Jolla Canyon south to the US-Mexico border using a Kongsberg Simrad multibeam echosounder system (MBES) (March - April 1998). Data and metadata available at - Woods Hole Oceanographic Institution and SCRIPPS Institution of Oceanography mapped the majority of the La Jolla Fan Valley including the sea floor to the north and south of the valley using a Seabeam 2100 MBES. Data available at Survey ID, AT07L09, Chief Scientists, Barrie Walden and Joseph Coburn (April 2002). - California State University, Monterey Bay, mapped Scripps Canyon and the head of La Jolla Canyon using a Reson 8101 MBES (October 2001). Data and metadata available at This work was funded by the California Department of Fish and Game California Coastal Conservancy, San Diego Association of Governments (SANDAG), California Department of Fish and Game, and Fugro Pelagos mapped the nearshore region out to about 35-40 m. - The sea floor within this image that has not been mapped with MBES is filled in with interpreted bathymetry gridded from single-beam data available at Depths are in meters below sea level, which is referenced to Mean Lower Low Water.

  16. 40 CFR 180.1108 - Delta endotoxin of Bacillus thuringiensis variety San Diego encapsulated into killed Pseudomonas... (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Delta endotoxin of Bacillus... From Tolerances § 180.1108 Delta endotoxin of Bacillus thuringiensis variety San Diego encapsulated... of Bacillus thuringiensis variety San Diego encapsulated into killed Pseudomonas fluorescens...

  17. 77 FR 52053 - Notice of Availability of the Record of Decision for San Diego Gas and Electric's East County... (United States)


    ...'s East County Substation Project, San Diego County, CA AGENCY: Bureau of Land Management, Interior... of the Record of Decision (ROD) for San Diego Gas and Electric's (SDG&E) East County (ECO) Substation... ECO Substation Project. The ECO Substation Project will provide an interconnection hub for renewable...

  18. K-12 Students Flock To ToxTown In San Diego: Results of an SOT K-12 Education Outreach Workshop (United States)

    Just prior to the start of the 2015 Annual Meeting in San Diego, hundreds of K-12 students, teachers, and science enthusiasts visited the ToxTown booth at the annual San Diego Festival of Science and Engineering grand finale event, EXPO Day. Over 20,000 attendees participated in ...

  19. 78 FR 21537 - Revisions to the California State Implementation Plan, Santa Barbara and San Diego County Air... (United States)


    ... From the Federal Register Online via the Government Publishing Office ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 52 Revisions to the California State Implementation Plan, Santa Barbara and San Diego... Air Pollution Control District (SBCAPCD) and San Diego County Air Pollution Control District (SDCAPCD...

  20. 78 FR 21580 - Revisions to the California State Implementation Plan, Santa Barbara and San Diego County Air... (United States)


    ... From the Federal Register Online via the Government Publishing Office ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 52 Revisions to the California State Implementation Plan, Santa Barbara and San Diego... District (SBCAPCD) and San Diego County Air Pollution Control District (SDCAPCD) portions of the California...

  1. Creating an Engaging Library Orientation: First Year Experience Courses at UC San Diego (United States)

    Goldman, Crystal; Turnbow, Dominique; Roth, Amanda; Friedman, Lia; Heskett, Karen


    This article focuses on the development of an engaging library orientation module for UC San Diego First Year Experience (FYE) courses. The library module included a brief in-class presentation about research concepts and library services, an online interactive library scavenger hunt given as an in-class activity, and a homework assignment where…

  2. San Diego State U. Defends Its Role in Federal Drug Sting (United States)

    Lipka, Sara


    When a freshman at San Diego State University (SDSU) died of a cocaine overdose last May, the campus police chief decided to pursue a full-scale investigation. In December, he summoned undercover agents from the federal Drug Enforcement Administration to pose as students and roam the campus in search of illegal drugs. According to college…

  3. Proceedings of the Great Literacy Crisis Symposium, San Diego State University, October 2, 1978. (United States)

    San Diego State Univ., CA.

    The "Great Literacy Crisis" Symposium was convened at San Diego State University to ascertain what scholarship reveals about literacy and whether that scholarship influences the public's perception of the issue. Topics discussed included the following: the effect of the literacy crisis on the professions; the reality or illusory nature of the…

  4. Communication Media and Perceptions of Undocumented Immigrants: The Case of San Diego. (United States)

    Hofstetter, C. Richard; Loveman, Brian

    A telephone survey of 500 adults in the San Diego, California, area was conducted to examine the role of mass media in shaping views of the respondents toward undocumented immigrants from Mexico. The sample, designed to reflect all adults in the area, was distorted somewhat by a refusal rate of approximately 30%. The results showed that the most…

  5. 75 FR 15429 - San Diego Gas & Electric Co.; California Independent System Operator; Notice of Filing (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission San Diego Gas & Electric Co.; California Independent System Operator; Notice of Filing March 22, 2010. Take notice that on July 20, 2009, Avista Energy, Inc. pursuant to the...

  6. 75 FR 27338 - San Diego Gas & Electric Company; Notice of Filing (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission San Diego Gas & Electric Company; Notice of Filing May 7, 2010. Take notice that on May 4, 2010, The California Power Exchange Corporation filed a refund report, pursuant to the...

  7. 75 FR 82243 - Security Zones; Moored Cruise Ships, Port of San Diego, CA (United States)


    ... a 100 yard radius around any cruise ship that is moored at any berth within the San Diego port area... for the safety of the cruise ship, vessels, and users of the waterway. Entry into these security zones... Broadway cruise ship terminal and the anticipated arrival of cruise ships immediately thereafter,...

  8. Hazardous waste reduction efforts of the Navy and DoD in the San Diego, California region


    Kane, Michael W.


    Approved for public release; distribution is unlimited. This research investigates the hazardous waste reduction efforts of the Department of Defense and the Navy in the San Diego, California region. It shows that previous efforts to reduce cost and generated waste have not been successful. The study reveals that efforts by Fleet Industrial Supply Center, San Diego should reduce both costs and wastes and that the improvements in the pricing schedule used by the Public Works Center, San Die...

  9. Rare Plants - City of San Diego [ds455 (United States)

    California Department of Resources — The Biological Monitoring Plan (BMP; Ogden 1996) for the Multiple Species Conservation Program (MSCP) was developed in 1996 and is a component of the City of San...

  10. Pollinator specificity and pollen limitation in the San Diego mesa mint, Pogogyne abramsii, a vernal pool endemic /


    Scioli, Justin Anthony


    Vernal pool ecosystems in California support a variety of narrowly distributed annual plants. As a result of the destruction, fragmentation, and degradation of vernal pool habitat, some vernal pool endemic plants are now considered threatened or endangered. The federally endangered San Diego mesa mint Pogogyne abramsii) is a vernal pool endemic now found only in a few locations in coastal San Diego County, California. To learn more about the pollination biology of this species, we conducted a...

  11. Navigation Improvement Design Memorandum Number 1, General Design for San Diego Harbor, San Diego County, California. Appendixes. (United States)


    ice-cooled refrigerator soon after recovery. The frozen samples and dry ice were packed in shipping containers and sent by air to the Environmental...DIEGO HAR POLUTION STUDY FOR PROPOSED CHANNEL DEPEIING AUTDRIZ&TION 1. Results of tests reported herein were requested by DA Form 2544, No. CIV-72-57, 29...was so strongehatolaaais his air hammer to stand up. gh a ola gis Drilling was hard from 0.0’ to about 3.0’ at which depth the C&PAbility of the air

  12. The impact of transit-oriented development on housing prices in San Diego, CA. (United States)

    Duncan, Michael


    This research measures the influence of transit-oriented development (TOD) on the San Diego, CA, condominium market. Many view TOD as a key element in creating a less auto dependent and more sustainable transport system. Price premiums indicate a potential for a market-driven expansion of TOD inventory. A hedonic price model is estimated to isolate statistically the effect of TOD. This includes interaction terms between station distance and various measures of pedestrian orientation. The resulting model shows that station proximity has a significantly stronger impact when coupled with a pedestrian-oriented environment. Conversely, station area condominiums in more auto-oriented environments may sell at a discount. This indicates that TOD has a synergistic value greater than the sum of its parts. It also implies a healthy demand for more TOD housing in San Diego.

  13. Glaucoma at the Hamilton Glaucoma Center and the University of California, San Diego

    Institute of Scientific and Technical Information of China (English)

    Robert N. Weinreb


    @@ Known for its unique cross-disciplinary investigative programs and clinical excellence, the scientists and clinicians at the Hamilton Glaucoma Center of the University of California, San Diego seek to enhance the discovery and translation of innovative research to clinical glaucoma care to prevent and cure glaucoma blindness.With state of the art laboratory and clinical facilities located on the La Jolla campus (Figure 1), the Center is a home for a worldrenowned team of scientists and staff.More than 100 post-doctoral fellows in Glaucoma, many of whom hold distinguished academic positions throughout the world, have been trained at the Hamilton Glaucoma Center and the University of California, San Diego.At the core of Hamilton Glaucoma Center activities are the outstanding faculty that are described below.

  14. University of California, San Diego (UCSD) Sky Imager Cloud Position Study Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Kleissl, J. [Univ. of California, San Diego, CA (United States); Urquhart, B. [Univ. of California, San Diego, CA (United States); Ghonima, M. [Univ. of California, San Diego, CA (United States); Dahlin, E. [Univ. of California, San Diego, CA (United States); Nguyen, A. [Univ. of California, San Diego, CA (United States); Kurtz, B. [Univ. of California, San Diego, CA (United States); Chow, C. W. [Univ. of California, San Diego, CA (United States); Mejia, F. A. [Univ. of California, San Diego, CA (United States)


    During the University of California, San Diego (UCSD) Sky Imager Cloud Position Study, two University of California, San Diego Sky Imagers (USI) (Figure 1) were deployed the U.S. Department of Energy(DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains SGP) research facility. The UCSD Sky Imagers were placed 1.7 km apart to allow for stereographic determination of the cloud height for clouds over approximately 1.5 km. Images with a 180-degree field of view were captured from both systems during daylight hours every 30 seconds beginning on March 11, 2013 and ending on November 4, 2013. The spatial resolution of the images was 1,748 × 1,748, and the intensity resolution was 16 bits using a high-dynamic-range capture process. The cameras use a fisheye lens, so the images are distorted following an equisolid angle projection.

  15. Transducer Workshop (17th) Held in San Diego, California on June 22-24, 1993 (United States)


    EctronJohn Huecke, President Walter Hanford , Vice-President, Marketing 215 Mason Circle 8159 Engineering Rd. Concord, CA 94520 San Diego, CA 92111CocrA...amplifier, the response could be extended below 0.1 Hz if needed for seismic measurement, etc. 6 Response Time and Slew Rate Real amplifiers have other...amplifier sensing element Seismic mass Hermetic sealed Preload ring connector Base Figure 2. Typical triangular shear ICP accelerometer, 206 3.0 SMART

  16. American Diabetes Association - 77th Scientific Sessions (June 9-13, 2017 - San Diego, California, USA). (United States)

    Lam, S


    The 77th American Diabetes Association (ADA) Sci-entific Sessions took place in San Diego, California. The meeting brought together scientists and professionals from a wide range of disciplines in the field of diabetes and provided a platform for networking, allowing experts and researchers to share ideas and learn about the significant advances in diabetes research, treatment and care. Over the course of the 5 days, participants received exclusive access to more than 2,500 original research presentations.

  17. ILIR 󈧅: SSC San Diego In-House Laboratory Independent Research 2001 Annual Report (United States)


    classification and detection results may accrue from using more accurate methods. 64 Stocker and Schaum [1] propose a stochastic mixture model in which each...then fit to the normal mixture model consisting of these classes. Stocker and Schaum demonstrate improved classification and detection using this...and other additive terms. By choosing ,0=c and constraints c.1 and c.2.a, the model reduces to the Schaum –Stocker model. The present approach has the

  18. Do PEV Drivers Park Near Publicly Accessible EVSE in San Diego but Not Use Them?

    Energy Technology Data Exchange (ETDEWEB)

    Francfort, James Edward [Idaho National Lab. (INL), Idaho Falls, ID (United States)


    The PEV charging stations deployed as part of The EV Project included both residential and non-residential sites. Non-residential sites included EVSE installed in workplace environments, fleet applications and those that were publicly accessible near retail centers, parking lots, and similar locations. The EV Project utilized its Micro-Climate® planning process to determine potential sites for publicly accessible EVSE in San Diego. This process worked with local stakeholders to target EVSE deployment near areas where significant PEV traffic and parking was expected. This planning process is described in The Micro-Climate deployment Process in San Diego1. The EV Project issued its deployment plan for San Diego in November 2010, prior to the sale of PEVs by Nissan and Chevrolet. The Project deployed residential EVSE concurrent with vehicle delivery starting in December 2010. The installation of non-residential EVSE commenced in April 2011 consistent with the original Project schedule, closely following the adoption of PEVs. The residential participation portion of The EV Project was fully subscribed by January 2013 and the non-residential EVSE deployment was essentially completed by August 2013.

  19. Reconnaissance of geothermal resources near US naval facilities in the San Diego area, California

    Energy Technology Data Exchange (ETDEWEB)

    Youngs, L.G.


    A reconnaissance study has found little evidence of potential geothermal resources useful at naval facilities in the greater San Diego metropolitan area. However, there is a zone of modest elevated water well temperatures and slightly elevated thermal gradients that may include the eastern portion of the Imperial Beach Naval Air Station south of San Diego Bay. An increase of 0.3/sup 0/ to 0.4/sup 0/F/100 ft over the regional thermal gradient of 1.56/sup 0/F/100 ft was conservatively calculated for this zone. The thermal gradient can be used to predict 150/sup 0/F temperatures at a depth of approximately 4000 ft. This zone of greatest potential for a viable geothermal resource lies within a negative gravity anomaly thought to be caused by a tensionally developed graben, approximately centered over the San Diego Bay. Water well production in this zone is good to high, with 300 gpm often quoted as common for wells in this area. The concentration of total dissolved solids (TDS) in the deeper wells in this zone is relatively high due to intrusion of sea water. Productive geothermal wells may have to be drilled to depths economically infeasible for development of the resource in the area of discussion.

  20. Community BMI Surveillance Using an Existing Immunization Registry in San Diego, California. (United States)

    Ratigan, Amanda R; Lindsay, Suzanne; Lemus, Hector; Chambers, Christina D; Anderson, Cheryl A M; Cronan, Terry A; Browner, Deirdre K; Wooten, Wilma J


    This study examines the demographic representativeness of the County of San Diego Body Mass Index (BMI) Surveillance System to determine if the BMI estimates being obtained from this convenience sample of individuals who visited their healthcare provider for outpatient services can be generalized to the general population of San Diego. Height and weight were transmitted from electronic health records systems to the San Diego Immunization Registry (SDIR). Age, gender, and race/ethnicity of this sample are compared to general population estimates by sub-regional area (SRA) (n = 41) to account for regional demographic differences. A < 10% difference (calculated as the ratio of the differences between the frequencies of a sub-group in this sample and general population estimates obtained from the U.S. Census Bureau) was used to determine representativeness. In 2011, the sample consisted of 352,924 residents aged 2-100 years. The younger age groups (2-11, 12-17 years) and the oldest age group (≥65 years) were representative in 90, 75, and 85% of SRAs, respectively. Furthermore, at least one of the five racial/ethnic groups was represented in 71% of SRAs. This BMI Surveillance System was found to demographically represent some SRAs well, suggesting that this registry-based surveillance system may be useful in estimating and monitoring neighborhood-level BMI data.

  1. Improving Population Health Through an Innovative Collaborative: The Be There San Diego Data for Quality Group. (United States)

    Fremont, Allen; Kranz, Ashley M; Phillips, Jessica; Garber, Chandra


    In 2012, leaders from disparate health care organizations established a data group aligned around a regional goal of preventing heart attacks and strokes in San Diego. The group---now named the Be There San Diego Data for Quality (DFQ) Group---is a safe venue for medical directors and other quality-improvement leaders to share performance data on quality-of-care measures for diabetes, hypertension, and cardiovascular disease, as well as insights, lessons learned, and challenges faced by each organization in treating these conditions. The DFQ Group has focused its efforts on improving the quality of services provided by each participating health care organization, and has placed a strong emphasis on analyzing trends in combined quality data to better understand the health of the entire San Diego population. By fostering collaboration among organizations that collectively serve a large portion of the local population and other key community stakeholders, the DFQ Group has helped form the foundation of a unique, multifaceted, multi-stakeholder, regional effort that is gaining national attention and funding for its community-driven approach.

  2. Differential experiences of Mexican policing by people who inject drugs residing in Tijuana and San Diego. (United States)

    Wood, Emily F; Werb, Dan; Beletsky, Leo; Rangel, Gudelia; Cuevas Mota, Jazmine; Garfein, Richard S; Strathdee, Steffanie A; Wagner, Karla D


    Research among people who inject drugs (PWIDs) in the USA and Mexico has identified a range of adverse health impacts associated with policing of PWIDs. We employed a mixed methods design to investigate how PWIDs from San Diego and Mexico experienced policing in Tijuana, and how these interactions affect PWIDs behavior, stratifying by country of origin. In 2012-2014, 575 PWIDs in San Diego, 102 of whom had used drugs in Mexico in the past six months, were enrolled in the STAHR-II study, with qualitative interviews conducted with a subsample of 20 who had recently injected drugs in Mexico. During this period, 735 PWIDs in Tijuana were also enrolled in the El Cuete-IV study, with qualitative interviews conducted with a subsample of 20 recently stopped by police. We calculated descriptive statistics for quantitative variables and conducted thematic analysis of qualitative transcripts. Integration of these data involved comparing frequencies across cohorts and using qualitative themes to explain and explore findings. Sixty-one percent of San Diego-based participants had been recently stopped by law enforcement officers (LEOs) in Mexico; 53% reported it was somewhat or very likely that they would be arrested while in Mexico because they look like a drug user. Ninety percent of Tijuana-based participants had been recently stopped by LEOs; 84% reported it was somewhat or very likely they could get arrested because they look like a drug user. Participants in both cohorts described bribery and targeting by LEOs in Mexico. However, most San Diego-based participants described compliance with bribery as a safeguard against arrest and detention, with mistreatment being rare. Tijuana-based participants described being routinely targeted by LEOs, were frequently detained, and reported instances of sexual and physical violence. Tijuana-based participants described modifying how, where, and with whom they injected drugs in response; and experienced feelings of stress, anxiety, and

  3. A basin-scale approach for assessing water resources in a semiarid environment: San Diego region, California and Mexico

    Directory of Open Access Journals (Sweden)

    L. E. Flint


    Full Text Available Many basins throughout the world have sparse hydrologic and geologic data, but have increasing demands for water and a commensurate need for integrated understanding of surface and groundwater resources. This paper demonstrates a methodology for using a distributed parameter water-balance model, gaged surface-water flow, and a reconnaissance-level groundwater flow model to develop a first-order water balance. Flow amounts are rounded to the nearest 5 million cubic meters per year.

    The San Diego River basin is 1 of 5 major drainage basins that drain to the San Diego coastal plain, the source of public water supply for the San Diego area. The distributed parameter water-balance model (Basin Characterization Model was run at a monthly timestep for 1940–2009 to determine a median annual total water inflow of 120 million cubic meters per year for the San Diego region. The model was also run specifically for the San Diego River basin for 1982–2009 to provide constraints to model calibration and to evaluate the proportion of inflow that becomes groundwater discharge, resulting in a median annual total water inflow of 50 million cubic meters per year. On the basis of flow records for the San Diego River at Fashion Valley (US Geological Survey gaging station 11023000, when corrected for upper basin reservoir storage and imported water, the total is 30 million cubic meters per year. The difference between these two flow quantities defines the annual groundwater outflow from the San Diego River basin at 20 million cubic meters per year. These three flow components constitute a first-order water budget estimate for the San Diego River basin. The ratio of surface-water outflow and groundwater outflow to total water inflow are 0.6 and 0.4, respectively. Using total water inflow determined using the Basin Characterization Model for the entire San Diego region and the 0.4 partitioning factor, groundwater outflow from the San Diego region, through

  4. Sebastián de Benavente y la capilla de San Diego de Alcalá


    Cruz Yábar, Juan María


    The correct interpretation of the documents concerning the chapel of San Diego in the convent of Santa María de Jesús in Alcalá de Henares demonstrates that the master-architect Sebastián de Benavente played a fundamental role in its invention and realization, including the main altarpiece. For both documental and stylistic reasons, the author attributes to Benavente the drawing from a Florentine private collection until now attributed to Alonso Cano.

    La ...

  5. Reclassification of SIDS cases--a need for adjustment of the San Diego classification?

    DEFF Research Database (Denmark)

    Jensen, Lisbeth Lund; Rohde, Marianne Cathrine; Banner, Jytte


    period from 1992 to 2007. Eighty-two (38%) were originally diagnosed as SIDS, 128 (59%) with identifiable causes of death, and 8 (4%) as unexplained. After review, 77 (35%) cases were reclassified as SIDS, a decrease of 6%. Twenty (26%) infants were classified as category IB SIDS and 57 (74%) as II SIDS....... None of the cases met the criteria for IA SIDS. Problems arose in assessing cases with failure to thrive, fever, and possible asphyxia. Modifications to the San Diego subclassifications might improve the consistency of categorizing these cases....

  6. Creating an Engaging Library Orientation: First Year Experience Courses at University of California, San Diego

    Directory of Open Access Journals (Sweden)

    Crystal Goldman


    Full Text Available This article focuses on the development of an engaging library orientation module for UC San Diego First Year Experience (FYE courses. The library module included a brief in-class presentation about research concepts and library services, an online interactive library scavenger hunt given as an in-class activity, and a homework assignment where students created public service announcements highlighting their favorite library space or resource. Over 400 FYE students completed the library module, and many indicated a marked increase in comfort using the library by the end of the module. Recommended practices are included for those wishing to create a similar module.

  7. Report of the American College of Cardiology (ACC) Scientific Sessions 2015, San Diego. (United States)

    Murohara, Toyoaki


    The 64th Annual Scientific Sessions and Exposition of the American College of Cardiology (ACC) were held at the San Diego Convention Center from March 14-16, 2015. The ACC Scientific Sessions are 1 of 2 major scientific cardiology meetings in the United States, with nearly 20,000 attendees, including 15,000 cardiovascular professionals. There were over 2,100 oral and poster abstracts, and more than 15 late-breaking clinical trials (LBCTs) abstructs. This report presents the highlights and several key presentations, especially the LBCTs, from the ACC Scientific Sessions 2015. I hope this review will help cardiologists update to the latest information.

  8. Sebastián de Benavente y la capilla de San Diego de Alcalá

    Directory of Open Access Journals (Sweden)

    Cruz Yábar, Juan María


    Full Text Available The correct interpretation of the documents concerning the chapel of San Diego in the convent of Santa María de Jesús in Alcalá de Henares demonstrates that the master-architect Sebastián de Benavente played a fundamental role in its invention and realization, including the main altarpiece. For both documental and stylistic reasons, the author attributes to Benavente the drawing from a Florentine private collection until now attributed to Alonso Cano.

    La correcta interpretación de los documentos relativos a la capilla de San Diego en el convento de Santa María de Jesús de Alcalá de Henares demuestra que el maestro arquitecto Sebastián de Benavente tuvo un papel fundamental en su invención y realización, incluido el retablo mayor. Consideramos suyo el dibujo de colección particular florentina hasta ahora atribuido a Alonso Cano, lo que defendemos por razones documentales y estilísticas.

  9. Economic integration and cross-border economic organizations: The case of San Diego-Tijuana

    Directory of Open Access Journals (Sweden)

    Jorge Eduardo Mendoza Cota


    Full Text Available The economic integration between the United States and Mexico has affected the economic, political and social relations in the border region. The paper seeks to relate the increasing economic integration and business cycles of the economies of San Diego and Tijuana to the development of both national and binational economic organizations in the border region. The methodology of analysis uses both statistical estimations of the economic integration of San Diego and Tijuana and semi-structured interviews of economic organizations to analyze the increasing economic integration and the role and achievements of the cross-border economic organizations. The results showed that cross-border cooperation is predominately controlled by federal and state governments on both sides of the border. However, the main achievements of cross-border economic cooperation have been accomplished by local private organizations. The perspective of further local economic development greatly depends on both the possibility of increased involvement of federal governments and the growing encouragement of regional organizations.

  10. Local responses to globalization: new opportunities for San Diego-Tijuana region

    Directory of Open Access Journals (Sweden)

    Norris Clement


    Full Text Available En este artículo se examinan las condiciones políticas, sociales, administrativas y económicas de las ciudades de San Diego y Tijuana, haciendo énfasis en este último aspecto y en la interrelación entre ambas ciudades, mismas que actualmente se encuentran en paulatina decadencia económica. Se realiza además una revisión conceptual que permita abordar el estudio de la problemática de la región, así como un análisis comparativo tanto de modelos norteamericanos como europeos, que puedan proveer información útil para implementar estrategias de desarrollo regional. Se toca también el tema de la "desmilitarización" de San Diego, y sus efectos en la economía local. Por último, se proponen planes alternativos de desarrollo para la zona, tomando en cuenta los problemas relacionados con la frontera internacional, y se plantean hipótesis del posible resultado de cada uno de estos planes

  11. Assessment of Family Planning Services at Community Pharmacies in San Diego, California

    Directory of Open Access Journals (Sweden)

    Sally Rafie


    Full Text Available Levonorgestrel emergency contraception and other contraceptive methods are available over-the-counter (OTC; however youth continue to face a number of barriers in accessing healthcare services, including lack of knowledge of the method, fear of loss of privacy, difficulties in finding a provider, and cost. A descriptive, nonexperimental, cross-sectional study of a sample of 112 community pharmacies in San Diego, California was conducted between December 2009 and January 2010 to assess community pharmacy practices related to the availability and accessibility of family planning health pharmacy services and products, particularly to youth. A majority (n = 79/112, 70.5% of the pharmacies carried a wide selection of male condoms; however, the other OTC nonhormonal contraceptive products were either not available or available with limited selection. A majority of the pharmacies sold emergency contraception (n = 88/111, 78.6%. Most patient counseling areas consisted of either a public or a semi-private area. A majority of the pharmacy sites did not provide materials or services targeting youth. Significant gaps exist in providing family planning products and services in the majority of community pharmacies in San Diego, California. Education and outreach efforts are needed to promote provision of products and services, particularly to the adolescent population.

  12. Hip dysplasia in koalas (Phascolarctos cinereus) at the San Diego Zoo. (United States)

    Pye, Geoffrey W; Hamlin-Andrus, Chris; Moll, Jennifer


    A retrospective/prospective radiographic study documented 55 cases of moderate to severe hip dysplasia, with varying degrees of shallowing of the acetabulum, flattening or loss of the femoral head, widening or loss of the femoral neck, and femoral diaphyseal abnormalities in northern koalas (Phascolarctos cinereus) in the San Diego Zoo (San Diego, California, USA) collection. For the retrospective study, historic radiographs were examined when availble. For the prospective study, three standard views (ventrodorsal extended leg, ventrodorsal frog leg, and lateral extended leg) were used. A scoring system was developed using four areas (acetabulum, femoral head, femoral neck, and femur) and ranges of 0 to 5 (0 = not affected to 5 = severely affected) for each area, creating a total score out of 40. Scores were graded as follows: 0-2 = normal dysplasia; 3-6 = mild dysplasia; 10-19 = moderate dysplasia; and 20-40 = severe dysplasia. Thirty koalas were graded as severe, 25 koalas as moderate, and 38 koalas as excellent or mild. Affected koalas may or may not demonstrate gait abnormalities. Mild to severe degenerative joint disease may develop and symptoms may be alleviated with glucosamine/chondroitin sulfate and nonsteroidal anti-inflammatory drugs. The etiology of hip dysplasia in koalas is not currently understood.

  13. Predictors of Dropouts From a San Diego Diabetes Program: A Case Control Study

    Directory of Open Access Journals (Sweden)

    Stephen R. Benoit


    Full Text Available Introduction The objective of this study was to determine the demographic, treatment, clinical, and behavioral factors associated with dropping out of a nurse-based, low-income, multiethnic San Diego diabetes program. Methods Data were collected during a 17-month period in 2000 and 2002 on patients with type 2 diabetes from Project Dulce, a disease management program in San Diego County designed to care for an underserved diabetic population. The study sample included 69 cases and 504 controls representing a racial/ethnic mix of 53% Hispanic, 7% black, 16% Asian, 22% white, and 2% other. Logistic regression was used to determine factors associated with patient dropout. Results Patients who had high initial clinical indicators including blood pressure and hemoglobin A1c and those who smoked currently or smoked in the past were more likely to drop out of the diabetes program. Conclusion This study provides markers of patient dropout in a low-income, multiethnic, type 2 diabetic population. Reasons for dropout in this program can be investigated to prevent further cohort loss.

  14. Under- and over-nutrition among refugees in San Diego County, California. (United States)

    Rondinelli, Amanda J; Morris, Meghan D; Rodwell, Timothy C; Moser, Kathleen S; Paida, Paulino; Popper, Steve T; Brouwer, Kimberly C


    Resettled refugees often arrive in their host country with little knowledge of nutrition or available food choices. We explored nutrition-related issues of recent refugee arrivals to San Diego County-the second largest California resettlement site. In-depth interviews (n = 40) were conducted with refugees, health care practitioners, and refugee service organizations. Content analysis identified nutrition-related themes. Unhealthy weight gain after arrival was the most common concern and was attributed to social pressures among adolescents, food choices and a more sedentary lifestyle. Conversely, undernutrition remained a concern due to poor diets. Factors influencing nutritional problems included continuation of past habits, acculturation, unfamiliarity with available foods and socio-economic influences. The nutritional concerns encountered by resettled refugees in San Diego are not unique to this group but are aggravated by their past experiences, and abrupt changes to food choices and behavior. Addressing contextual factors of poor food choices may prevent some of the long term health consequences of poor nutrition.

  15. Occurrence and distribution of polycyclic aromatic hydrocarbons in surface sediments of San Diego Bay marinas. (United States)

    Neira, Carlos; Cossaboon, Jennifer; Mendoza, Guillermo; Hoh, Eunha; Levin, Lisa A


    Polycyclic aromatic hydrocarbons (PAHs) have garnered much attention due to their bioaccumulation, carcinogenic properties, and persistence in the environment. Investigation of the spatial distribution, composition, and sources of PAHs in sediments of three recreational marinas in San Diego Bay, California revealed significant differences among marinas, with concentrations in one site exceeding 16,000ngg(-1). 'Hotspots' of PAH concentration suggest an association with stormwater outfalls draining into the basins. High-molecular weight PAHs (4-6 rings) were dominant (>86%); the average percentage of potentially carcinogenic PAHs was high in all sites (61.4-70%) but ecotoxicological risks varied among marinas. Highly toxic benzo(a)pyrene (BaP) was the main contributor (>90%) to the total toxic equivalent quantity (TEQ) in marinas. PAHs in San Diego Bay marina sediments appear to be derived largely from pyrogenic sources, potentially from combustion products that reach the basins by aerial deposition and stormwater drainage from nearby streets and parking lots. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Annual National Small Business Conference (5th) Held in San Diego, California on May 19-21, 2008 (United States)


    Systems Solutions u Mr. James Lasswell, President & CEO, INDUS Technology u Ms. Patricia Mercado , San Diego Area Manager and Senior Principal, SRA...Department of Labor ; HK MP-5 Sub-Machine Gun Instructor; HK Tactical Rifle Instructor; Diversionary Devise Instructor; Law Enforcement Chemical Agent

  17. 75 FR 63167 - San Diego Gas and Electric Company v. Sellers of Energy and Ancillary Services Into Markets... (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission San Diego Gas and Electric Company v. Sellers of Energy and Ancillary Services Into Markets Operated by the California Independent System Operator Corporation and the...

  18. 77 FR 28618 - Notice of Availability of the San Diego Gas & Electric Ocotillo Sol Solar Project Draft... (United States)


    ... Office at the above address and at the El Centro Field Office, 1661 S. 4th Street, El Centro, California... Centro, and 82 miles east of San Diego. The proposed project site is located within the BLM's CDCA, the... Alternative. The issues evaluated in the Draft EIS include the physical, biological, cultural, socioeconomic...

  19. 78 FR 45268 - Notice of Availability of the San Diego Gas & Electric Ocotillo Sol Solar Project Final... (United States)


    ... los Lagos, Moreno Valley, CA 92553 and at the El Centro Field Office, 1661 S. 4th Street, El Centro... miles south of Seeley, 9 miles southwest of El Centro, and 82 miles east of San Diego. The proposed... the Final EIS include the physical, biological, cultural, socioeconomic, and other resources that have...

  20. A Tale of Two Cities: San Diego (USA) and Tijuana (Mexico) El Niño Readiness (United States)

    Stewart, C.; Kinoshita, A. M.; Nishikawa, T.; Briones-Gamboa, F.


    This research seeks to define the characteristics of an El Niño Ready City (ENRC) by comparing two neighboring cities, San Diego, United States and Tijuana, Mexico, with diverse management and social conditions, yet similar climatology. Notable El Niño years, 1982-83 and 1997-98, brought heavy precipitation and consequently significant flooding in southern California and northwest Mexico. Using the 2015-16 El Niño, we were able to investigate both Cities' historical and current preparation for hazardous events and identify lessons learned from previous events. Preparation activities include steps taken to prepare storm-related infrastructure, develop emergency protocols, establish communication and coordination efforts, and encourage public outreach and awareness. Literature, media searches, and interviews with local and regional agencies such as the San Diego Department of Transportation and Storm Water, San Diego Lifeguard Services and River Rescue Team, Tijuana State Civil Protection, and Mexican Meteorological Service Departments provided insight into the current and ongoing management for these urban Cities during the 2015-2016 El Niño. Both San Diego and Tijuana were cognizant of the 2015-2016 El Niño and anticipated above-average precipitation and had public agencies that were concerned with potential El Niño related impacts. Common challenges of inter-agency communication and coordination were noted for both Cities. By tracking the electronic media in Tijuana, we observed that local institutions respond proactively, but in a specific period of time. While, in the case of San Diego, the media analysis indicated a focus on El Niño related weather and its implications for the City as evidenced by the total number of articles related to weather across four decades. A challenge for both Cities will be to develop readiness capacities for long-term periods even if El Niño signals are weak or not present.

  1. Physical activity promotion among churchgoing Latinas in San Diego, California: does neighborhood cohesion matter? (United States)

    Martinez, Suzanna M; Arredondo, Elva M; Roesch, Scott


    This study examined the reciprocal relationship between Latinas' leisure-time physical activity and neighborhood cohesion following the implementation of a 6-month promotora-delivered pilot intervention. A one-group study design was used to promote leisure-time physical activity and build neighborhood cohesion among 143 churchgoing Latinas in San Diego, California. Using a three-wave autoregressive cross-lagged panel model, leisure-time physical activity and neighborhood cohesion (assessed at baseline, 3 and 6 months) were analyzed. Leisure-time physical activity and neighborhood cohesion increased across time. Neighborhood cohesion at 3 months predicted leisure-time physical activity at 6 months. A promotora model in the context of a faith-based setting may be appropriate to promote Latinas' leisure-time physical activity and make socioenvironmental improvements.

  2. Promotion of water consumption in elementary school children in San Diego, USA and Tlaltizapan, Mexico. (United States)

    Elder, John P; Holub, Christina K; Arredondo, Elva M; Sánchez-Romero, Luz María; Moreno-Saracho, Jessica E; Barquera, Simón; Rivera, Juan


    Consumption of water may help promote health and prevent obesity in children by decreasing consumption of sugar-sweetened beverages. This study used evidence-based strategies to increase water consumption in Mexican-American and Mexican children. In 2012, two schools in San Diego, USA and two other in Tlaltizapan, Mexico were recruited to Agua para Niños (Water for Kids), a program designed to promote water consumption among elementary grade students. Guided by operant psychology, the intervention focused on school and classroom activities to encourage water consumption. One control and one intervention school in each country were included. Agua para Niños resulted in increases in observed water consumption and bottle possession among US and Mexican students. Teacher receptivity to the program was very positive in both countries. Agua para Niños yielded sufficiently positive behavioral changes to be used in a future fully randomized design, and to contribute to school nutrition policy changes.

  3. Copper bioavailability and toxicity to Mytilus galloprovincialis in Shelter Island Yacht Basin, San Diego, CA. (United States)

    Bosse, Casey; Rosen, Gunther; Colvin, Marienne; Earley, Patrick; Santore, Robert; Rivera-Duarte, Ignacio


    The bioavailability and toxicity of copper (Cu) in Shelter Island Yacht Basin (SIYB), San Diego, CA, USA, was assessed with simultaneous toxicological, chemical, and modeling approaches. Toxicological measurements included laboratory toxicity testing with Mytilus galloprovincialis (Mediterranean mussel) embryos added to both site water (ambient) and site water spiked with multiple Cu concentrations. Chemical assessment of ambient samples included total and dissolved Cu concentrations, and Cu complexation capacity measurements. Modeling was based on chemical speciation and predictions of bioavailability and toxicity using a marine Biotic Ligand Model (BLM). Cumulatively, these methods assessed the natural buffering capacity of Cu in SIYB during singular wet and dry season sampling events. Overall, the three approaches suggested negligible bioavailability, and isolated observed or predicted toxicity, despite an observed gradient of increasing Cu concentration, both horizontally and vertically within the water body, exceeding current water quality criteria for saltwater. Published by Elsevier Ltd.

  4. Fire risk in San Diego County, California: A weighted Bayesian model approach (United States)

    Kolden, Crystal A.; Weigel, Timothy J.


    Fire risk models are widely utilized to mitigate wildfire hazards, but models are often based on expert opinions of less understood fire-ignition and spread processes. In this study, we used an empirically derived weights-of-evidence model to assess what factors produce fire ignitions east of San Diego, California. We created and validated a dynamic model of fire-ignition risk based on land characteristics and existing fire-ignition history data, and predicted ignition risk for a future urbanization scenario. We then combined our empirical ignition-risk model with a fuzzy fire behavior-risk model developed by wildfire experts to create a hybrid model of overall fire risk. We found that roads influence fire ignitions and that future growth will increase risk in new rural development areas. We conclude that empirically derived risk models and hybrid models offer an alternative method to assess current and future fire risk based on management actions.

  5. The Role of Social Influences on Pro-Environment Behaviors in the San Diego Region. (United States)

    Estrada, Mica; Schultz, P Wesley; Silva-Send, Nilmini; Boudrias, Michel A


    From a social psychological perspective, addressing the threats of climate change involves not only education, which imparts objective facts upon a passive individual, but also a socializing process. The Tripartite Integration Model of Social Influence (TIMSI) provides a theoretical framework that connects acquiring climate change knowledge with integration into a community, which results in greater engagement in climate friendly behaviors. Survey data were collected from 1000 residents in San Diego County. Measures included (a) knowledge about climate change; (b) self-efficacy, what pro-environmental actions they felt they could do; (c) identity, to what extent they identified as part of a community that is concerned about climate change; (d) values, endorsement of values of the community that is concerned about climate change; and (e) pro-environmental behavior, engagement in conservation behaviors. Results indicated that self-efficacy and values mediated the relationship between knowledge and pro-environmental behavior.

  6. Time Evolution of Man-Made Harbor Modifications in San Diego: Effects on Tsunamis

    Directory of Open Access Journals (Sweden)

    Aggeliki Barberopoulou


    Full Text Available San Diego, one of the largest ports on the U.S. West Coast and home to the largest U.S. Navy base, is exposed to various local and distant tsunami sources. During the first half of the twentieth century, extensive modifications to the port included but were not limited to dredging, expansion of land near the airport and previous tidal flats, as well as creation of jetties. Using historical nautical charts and available Digital Elevation Models, this study gives an overview of changes to San Diego harbor in the last 150+ years due to human intervention and examines the effects of these changes on tsunamis. Two distant and two local scenarios were selected to demonstrate the impact of modified nearshore topography and bathymetry to incoming tsunamis. Inundation pattern, flow depths, and flooded localities vary greatly from year to year in the four scenarios. Specifically, flooded areas shift from the inner harbor to outer locations. Currents induced by the distant tsunamis intensify with modifications and shift from locations primarily outside the harbor to locations inside. A new characteristic in tsunami dynamics associated with port modifications is the introduction of high current spots. Numerical results also show that the introduction of high currents could threaten navigation, vessels, and facilities at narrow openings and also along the harbor “throat”—therefore, at an increased number of locations. Modifications in the port show that changes could have a negative but also a positive impact through constraint of flooding outside of the harbor and shifting of high currents to locations of minimal impact. The results of this study may be used as a first step toward future harbor design plans to reduce tsunami damages.

  7. Cooling rates and crystallization dynamics of shallow level pegmatite-aplite dikes, San Diego County, California (United States)

    Webber, Karen L.; Simmons, William B.; Falster, Alexander U.; Foord, Eugene E.


    Pegmatites of the Pala and Mesa Grande Pegmatite Districts, San Diego County, California are typically thin, sheet-like composite pegmatite-aplite dikes. Aplitic portions of many dikes display pronounced mineralogical layering referred to as "line rock," characterized by fine-grained, garnet-rich bands alternating with albite- and quartz-rich bands. Thermal modeling was performed for four dikes in San Diego County including the 1 m thick Himalaya dike, the 2 m thick Mission dike, the 8 m thick George Ashley dike, and the 25 m thick Stewart dike. Calculations were based on conductive cooling equations accounting for latent heat of crystallization, a melt emplacement temperature of 650 °C into 150 °C fractured, gabbroic country rock at a depth of 5 km, and an estimated 3 wt% initial H2O content in the melt. Cooling to -5 cm/s. Crystal size distribution (CSD) studies of garnet from layered aplites suggest growth rates of about 10-6 cm/s. These results indicate that the dikes cooled and crystallized rapidly, with variable nucleation rates but high overall crystal-growth rates. Initial high nucleation rates coincident with emplacement and strong undercooling can account for the millimeter-size aplite grains. Lower nucleation rates coupled with high growth rates can explain the decimeter-size minerals in the hanging walls, cores, and miarolitic cavities of the pegmatites. The presence of tourmaline and/or lepidolite throughout these dikes suggests that although the melts were initially H2O-undersaturated, high melt concentrations of incompatible (or fluxing) components such as B, F, and Li (±H2O), aided in the development of large pegmatitic crystals that grew rapidly in the short times suggested by the conductive cooling models.

  8. Recent faulting in the Gulf of Santa Catalina: San Diego to Dana Point (United States)

    Ryan, H.F.; Legg, M.R.; Conrad, J.E.; Sliter, R.W.


    We interpret seismic-reflection profiles to determine the location and offset mode of Quaternary offshore faults beneath the Gulf of Santa Catalina in the inner California Continental Borderland. These faults are primarily northwest-trending, right-lateral, strike-slip faults, and are in the offshore Rose Canyon-Newport-Inglewood, Coronado Bank, Palos Verdes, and San Diego Trough fault zones. In addition we describe a suite of faults imaged at the base of the continental slope between Dana Point and Del Mar, California. Our new interpretations are based on high-resolution, multichannel seismic (MCS), as well as very high resolution Huntec and GeoPulse seismic-reflection profiles collected by the U.S. Geological Survey from 1998 to 2000 and MCS data collected by WesternGeco in 1975 and 1981, which have recently been made publicly available. Between La Jolla and Newport Beach, California, the Rose Canyon and Newport-Inglewood fault zones are multistranded and generally underlie the shelf break. The Rose Canyon fault zone has a more northerly strike; a left bend in the fault zone is required to connect with the Newport-Inglewood fault zone. A prominent active anticline at mid-slope depths (300-400 m) is imaged seaward of where the Rose Canyon fault zone merges with the Newport-Inglewood fault zone. The Coronado Bank fault zone is a steeply dipping, northwest-trending zone consisting of multiple strands that are imaged from south of the U.S.-Mexico border to offshore of San Mateo Point. South of the La Jolla fan valley, the Coronado Bank fault zone is primarily transtensional; this section of the fault zone ends at the La Jolla fan valley in a series of horsetail splays. The northern section of the Coronado Bank fault zone is less well developed. North of the La Jolla fan valley, the Coronado Bank fault zone forms a positive flower structure that can be mapped at least as far north as Oceanside, a distance of ??35 km. However, north of Oceanside, the Coronado Bank

  9. Data for monitoring breeding and migration of neotropical migratory birds at Point Loma, San Diego County, California, 5-year summary, 2011–15 (United States)

    U.S. Geological Survey, Department of the Interior — We operated a bird banding station on the Point Loma peninsula in western San Diego County, California, during spring and summer from 2011 to 2015. The station was...

  10. San Diego Multiple Species Conservation Program (MSCP) Rare Plant Monitoring Review and Revision (United States)

    McEachern, Kathryn; Pavlik, Bruce M.; Rebman, Jon; Sutter, Rob


    Introduction The San Diego Multiple Species Conservation Program (MSCP) was developed for the conservation of plants and animals in the south part of San Diego County, under the California Natural Community Conservation Planning Act of 1991 (California Department of Fish and Game) and the Federal Endangered Species Act of 1973, as amended (16 U.S. Code 1531-1544.) The Program is on the leading edge of conservation, as it seeks to both guide development and conserve at-risk species with the oversight of both State and Federal agencies. Lands were identified for inclusion in the MSCP based on their value as habitat for at-risk plants or plant communities (Natural Community Conservation Planning, 2005). Since its inception in the mid-1990s the Program has protected over 100,000 acres, involving 15 jurisdictions and the U.S. Fish and Wildlife Service (USFWS) and California Department of Fish and Game (CDFG) in the conservation of 87 taxa. Surveys for covered species have been conducted, and management and monitoring have been implemented at some high priority sites. Each jurisdiction or agency manages and monitors their conservation areas independently, while collaborating regionally for long-term protection. The San Diego MSCP is on the forefront of conservation, in one of the most rapidly growing urban areas of the country. The planning effort that developed the MSCP was state-of-the-art, using expert knowledge, spatial habitat modeling, and principles of preserve design to identify and prioritize areas for protection. Land acquisition and protection are ahead of schedule for most jurisdictions. Surveys have verified the locations of many rare plant populations known from earlier collections, and they provide general information on population size and health useful for further conservation planning. Management plans have been written or are in development for most MSCP parcels under jurisdictional control. Several agencies are developing databases for implementation

  11. Habitat distribution for non-native Amazona viridigenalis within San Diego County using Maxent predictive model (United States)

    Meseck, Kristin April

    Human propagated changes to the environment have adversely affected certain species while advantaging other species. Psittacines, or species that fall within the parrot family, have been found to be well adapted to modified environments. Over time, transportation of various parrot species for use in the exotic pet trade has caused accidental releases of individual parrots, resulting in species groups forming and colonizing in new, non-native environments, specifically urban and suburban ones. Amazona viridigenalis, the Red-crowned parrot, is a species that has adapted to living in several regions within the United States including Texas, Florida, and California. This species is endangered within its native range in the lowlands of eastern Mexico, yet has the largest population of any other psittacine species in California. Despite this interesting dichotomy this species remains severely understudied in its new range. Using geographic information systems and Maxent predictive model, this research aims to achieve a greater understanding of the extent of habitat suitable to the Amazona viridigenalis within San Diego County and the habitat variables that enable its establishment success. Presence locations where individuals of the species were using habitat were collected along with 12 important variables that represent Red-crowned parrot habitat elements. These were used in the creation of a predictive habitat model utilizing Maxent machine-learning technique. Three models were created using three different background extents from which the pseudo-absence points were generated. These models were tested for statistical significance and predictive accuracy. It was found that model performance significantly decreased with a decrease in size of model extent. The largest extent was chosen to model habitat using the five variables that were found to be the least correlated, achieved the most gain, and had the most explanatory power for the earlier models. The final model

  12. A Heat Warning System to Reduce Heat Illness in San Diego County (United States)

    Tardy, A. O.; Corcus, I.; Guirguis, K.; Gershunov, A.; Basu, R.; Stepanski, B.


    The National Weather Service (NWS) has issued official heat alerts to the public and decision making partners for many years by developing a single criterion or regional criteria from heat indices which combine temperature and humidity. The criteria have typically relied on fixed thresholds and did not consider impact from a particular heat episode, nor did it factor seasonality, population acclimatization, or impacts on the most vulnerable subgroups. In 2013, the NWS San Diego office began modifying their criteria to account for local climatology with much less dependence on humidity or the heat index. These local changes were based on initial findings from the California Department of Public Health, EpiCenter California Injury Data Online system (EPIC), which document heat health impacts. The Scripps Institution of Oceanography (SIO) in collaboration with the California Environmental Protection Agency's Office of Environmental Health Hazard Assessment and the NWS completed a study of hospital visits during heat waves in California showing significant health impacts occurred in the past when no regional heat warning was issued. Therefore, the results supported the need for an exploratory project to implement significant modification of the traditional local criteria. To understand the impacts of heat on community health, medical outcome data were provided by the County of San Diego Emergency Medical Services Branch (EMS), which is provided by the County's Public Health Officer to monitor heat-related illness and injury daily during specific heat episodes. The data were combined with SIO research to inform the modification of local NWS heat criteria and establish trigger points to pilot new procedures for the issuance of heat alerts. Finally, procedures were customized for each of the county health departments in the NWS area of responsibility across extreme southwest California counties in collaboration with their Office of Emergency Services (OES). The

  13. Effects of dissolved and complexed copper on heterotrophic bacterial production in San Diego bay. (United States)

    Boyd, Thomas J; Wolgast, David M; Rivera-Duarte, Ignacio; Holm-Hansen, Osmund; Hewes, Christopher D; Zirino, Alberto; Chadwick, D Bart


    Bacterial abundance and production, free (uncomplexed) copper ion concentration, total dissolved copper concentration, dissolved organic carbon (DOC), total suspended solids (TSS), and chlorophyll a were measured over the course of 1 year in a series of 27 sample "Boxes" established within San Diego Bay. Water was collected through a trace metal-clean system so that each Box's sample was a composite of all the surface water in that Box. Bacterial production, chlorophyll a, TSS, DOC, and dissolved copper all generally increased from Box 1 at the mouth of the Bay to Box 27 in the South or back Bay. Free copper ion concentration generally decreased from Box 1 to Box 27 presumably due to increasing complexation capacity within natural waters. Based on correlations between TSS, chlorophyll a, bacterial production or DOC and the ratio of dissolved to free Cu ion, both DOC and particulate (bacteria and algae) fractions were potentially responsible for copper complexation, each at different times of the year. CuCl2 was added to bacterial production assays from 0 to 10 microg L(-1) to assess acute copper toxicity to the natural microbial assemblage. Interestingly, copper toxicity appeared to increase with decreases in free copper from the mouth of the Bay to the back Bay. This contrasts the free-ion activity model in which higher complexation capacity should afford greater copper protection. When cell-specific growth rates were calculated, faster growing bacteria (i.e. toward the back Bay) appeared to be more susceptible to free copper toxicity. The protecting effect of natural dissolved organic material (DOM) concentrated by tangential flow ultrafiltration (>1 kDa), illite and kaolinite minerals, and glutathione (a metal chelator excreted by algae under copper stress) was assessed in bacterial production assays. Only DOM concentrate offered any significant protection to bacterial production under increased copper concentrations. Although the potential copper protecting

  14. Navigating High School Academics: A Qualitative Study of Education and Transnationalism in the San Diego-Tijuana Border Region



    Thousands of Mexican students commute from Mexico to the United States each day to attend school. South San Diego's transfronterizo, or cross-border, students (most U.S. citizens) offer a colorful microcosm of the greater diversity evident in American schools. But little is known about this phenomenon of transfronterizos. The topic demands penetrating research to understand how we can effectively help these students navigate the U.S. education system and routes into higher education. The shif...

  15. Resilient development and environmental justice in divided territory: political ecology in the San Diego-Tijuana bioregion.


    Haines, K.


    This paper explores issues in the expansion of environmental justice rhetoric to the developing world, and propose insights from resilience theory, political ecology, and bioregionalism as supplements. I do this from the frame of the San Diego-Tijuana region, where regional inequalities are stark and global processes have a heavy local footprint. Sharing a broadly-defined natural region, the growing evidence of ecological crisis increasingly calls for collaboration between two communities whi...

  16. CoSMoS v3.0 Phase 2 flood-hazard projections: San Diego County (United States)

    Barnard, Patrick; Erikson, Li; O'Neill, Andrea; Foxgrover, Amy; Herdman, Liv


    CoSMoS (Coastal Storm Modeling System) v3.0 for Southern California. Phase 2 data for Southern California include flood-hazard information for a variety of storm conditions and sea-level rise scenarios. Several changes from Phase 1 projections are reflected in many areas. Data will be disseminated by county, with San Diego County being the first of Phase 2 data releases.

  17. Copper toxicity to larval stages of three marine invertebrates and copper complexation capacity in San Diego Bay, California. (United States)

    Rivera-Duarte, Ignacio; Rosen, Gunther; Lapota, David; Chadwick, David B; Kear-Padilla, Lora; Zirino, Alberto


    Temporal and spatial measurements of the toxicity (EC50), chemical speciation, and complexation capacity (Cu-CC) of copper in waters from San Diego Bay suggest control of the Cu-CC over copper bioavailability. While spatial distributions of total copper (CuT) indicate an increase in concentration from the mouth toward the head of San Diego Bay, the distribution of aqueous free copper ion (Cu(II)aq) shows the opposite trend. This suggests that the bioavailability of copper to organisms decreases toward the head of the bay, and is corroborated by the increase in the amount of copper needed to reach an EC50, observed for larval stages of three marine invertebrates (Mediterranean mussel, Mytilus galloprovincialis, sand dollar, Dendraster excentricus, and purple sea urchin, Strongylocentrotus purpuratus), and by the increase in Cu-CC heading into the head of the bay. The amount of Cu(II)aq required to produce a 50% reduction in normal larval development (referred to here as pCuTox,) of the mussel, the most sensitive of the three marine invertebrates, was generally at or above approximately 1 x 10(-11) mol L(-1) equivalents of Cu (i.e., pCuTox approximately 11 = -(log [Cu(II)aq])). These results suggest that the copper complexation capacity in San Diego Bay controls copper toxicity by keeping the concentration of Cu(II)aq at nontoxic levels.

  18. Knowledge, attitudes and practices regarding influenza prevention and control measures among Hispanics in San Diego County--2006. (United States)

    Bethel, Jeffrey W; Waterman, Stephen H


    Influenza vaccination is the most effective method to avoid influenza virus infection and its potential serious complications; however, influenza vaccine is underutilized especially among minority groups. We assessed the knowledge, attitudes, and practices (KAP) regarding influenza prevention and control measures among Hispanics in San Diego County. We used a multistage cluster sampling scheme to administer an in-person, door-to-door KAP survey to 226 Hispanics aged > or = 18 years in three regions of San Diego County during July-August 2006. Hispanics in the three regions sampled for this survey varied widely by age, country of birth, years living in the United States, number of border crossings in previous month, and number of people in household. Awareness of the influenza vaccine was nearly 90% among survey respondents. The percentage of Hispanic males and females aged 50-64 years who received an influenza vaccination in the previous 12 months was 7.7% and 23.5%, respectively, and the percentage of Hispanic males and females aged > or = 65 years who received an influenza vaccination in the previous 12 months was 33.3% and 59.1%, respectively. This survey showed high awareness of the influenza vaccine among Hispanics in San Diego County but relatively low vaccination rates among respondents aged > or = 50 years, a group targeted for influenza vaccination. Differences in awareness and vaccination rates between Hispanic males and females across all age groups indicate that educational outreach efforts should specifically target Hispanic men.

  19. Pollutants and the health of green sea turtles resident to an urbanized estuary in San Diego, CA. (United States)

    Komoroske, Lisa M; Lewison, Rebecca L; Seminoff, Jeffrey A; Deheyn, Dimitri D; Dutton, Peter H


    Rapid expansion of coastal anthropogenic development means that critical foraging and developmental habitats often occur near highly polluted and urbanized environments. Although coastal contamination is widespread, the impact this has on long-lived vertebrates like the green turtle (Chelonia mydas) is unclear because traditional experimental methods cannot be applied. We coupled minimally invasive sampling techniques with health assessments to quantify contaminant patterns in a population of green turtles resident to San Diego Bay, CA, a highly urbanized and contaminated estuary. Several chemicals were correlated with turtle size, suggesting possible differences in physiological processes or habitat utilization between life stages. With the exception of mercury, higher concentrations of carapace metals as well as 4,4'-dichlorodiphenyldichloroethylene (DDE) and γ chlordane in blood plasma relative to other sea turtle studies raises important questions about the chemical risks to turtles resident to San Diego Bay. Mercury concentrations exceeded immune function no-effects thresholds and increased carapace metal loads were correlated with higher levels of multiple health markers. These results indicate immunological and physiological effects studies are needed in this population. Our results give insight into the potential conservation risk contaminants pose to sea turtles inhabiting this contaminated coastal habitat, and highlight the need to better manage and mitigate contaminant exposure in San Diego Bay. Copyright © 2011 Elsevier Ltd. All rights reserved.

  20. (De)constructing literacy: Education inequalities and the production of space in San Diego, California (United States)

    Tangeman, Andrew Gerrit

    Since its inception, the No Child Left Behind Act of 2001 (NCLB) and recent additions to the U.S. Elementary and Secondary Education Act (ESEA) have elicited a broad swath of responses from the educational community. These responses include critical discussions of how standardized testing requirements proliferate a "teach for the test" mentality that transforms how reading, writing, and mathematics are taught in public schools. This thesis focused specifically on "literacy" in relation to the policies that challenge its status as a subjective form of communication, knowledge sharing, and story-telling. Embedded within the term "literacy" are sets of socially-constructed dualisms such as "good school" vs. "bad school," "literate" vs. "illiterate," and "reader" vs. "test-taker" that are propagated under education reform. Investigating these dualisms involved a mixed methods approach, which included the use of critical theory, geovisualization, and geographic analysis. The resulting data allows for a comprehensive look into the economic, political, social, and cultural forces involved in the production of literate space(s) in San Diego, California.

  1. Arte, literatura y acción colectiva en Tijuana-San Diego

    Directory of Open Access Journals (Sweden)

    Aurelio Meza Valdez


    Full Text Available Aquí se describe y analiza el impacto de las acciones colectivas en los campos artístico- literarios de Tijuana y San Diego. Se expone que estos campos se conforman generalmente por acciones colectivas, algunas con impacto local y a corto plazo (desde abajo, y otras con el apoyo de aparatos institucionales (desde arriba. Se distingue entre colectivos formativos y consolida - dos, con funciones diversas. Los casos estudiados (Colectivo Intransigente, Agitprop Art Space y Cog∙nate Collective, dado su carácter independiente, surgieron con funciones formativas, y sus acciones eran desde abajo. Sin embargo, su participación en proyectos colectivos ha contribuido a su consolidación, individual o grupalmente, en los campos restringidos. Después, se esboza el marco teórico para describir las acciones colectivas y los tipos de colectivos que existen de acuer - do con su función. Se analizan algunos ejemplos de acción colectiva en los grupos escogidos, su finalidad y estrategia a seguir, así como sus repercusiones en los campos artístico y literario. Por último, se hace un pequeño recuento de las actitudes de sociólogos y filósofos en torno al arte contemporáneo, y cómo los casos estudiados modifican o refuerzan estas reflexiones.

  2. Persistent organic pollutants in plastic marine debris found on beaches in San Diego, California. (United States)

    Van, Almira; Rochman, Chelsea M; Flores, Elisa M; Hill, Kish L; Vargas, Erica; Vargas, Serena A; Hoh, Euhna


    Plastic debris were collected from eight beaches around San Diego County, California. Debris collected include: pre-production pellets and post-consumer plastics including fragments, polystyrene (PS) foam, and rubber. A total of n = 2453 pieces were collected ranging from products, and chlordanes. PAH concentrations ranged from 30 ng g(-1) to 1900 ng g(-1), PCBs from non-detect to 47 ng g(-1), chlordanes from 1.8 ng g(-1) to 60 ng g(-1), and DDTs from non-detect to 76 ng g(-1). Consistently higher PAH concentrations found in PS foam samples (300-1900 ng g(-1)) led us to examine unexposed PS foam packaging materials and PS virgin pellets. Unexposed PS foam contained higher concentrations of PAHs (240-1700 ng g(-1)) than PS virgin pellets (12-15 ng g(-1)), suggesting that PAHs may be produced during manufacturing. Temporal trends of debris were investigated at one site, Ocean Beach, where storm events and beach maintenance were found to be important variables influencing debris present at a given time.

  3. Chemistry and toxicity of sediments from San Diego Bay, including a biomarker (P450 RGS) response

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, J.W. [Columbia Analytical Services, Carlsbad, CA (United States); Newton, F.C.; Hardin, J. [MEC Analytical Systems, Carlsbad, CA (United States); Tukey, R.H. [Univ. of California, San Diego, CA (United States). Dept. of Pharmacology; Richter, K.E. [NRaD, San Diego, CA (United States)


    Thirty sediment samples were collected from the vicinity of the Naval Docking Facility in San Diego Bay and used to conduct bioassays with amphipods, oyster larvae, Microtox, and a new rapid screening test called the cytochrome P450 Reporter Gene System (RGS). This RGS cell line, from a human liver cancer cell, has been engineered to produce luciferase, when the CYP1A1 gene on the chromosome is induced by toxic and carcinogenic organics (dioxin, coplanar PCBs, PAHs). Elutriates were tested with both Microtox and oyster larvae, and organic extracts of sediments were tested with Microtox and the P450 RGS assay. Chemical analyses included total organic carbon (TOC), and acid volatile sulfides (AVS) along with a wide range of metals and organic chemicals. The simultaneously extracted metals (SEM) to AVS ratio was compared to the toxic response of oyster larvae and amphipods. Along each of the piers sampled, contaminant concentrations decreased with distance from shore. A correlation matrix analysis of all biological and chemical data was conducted. The strongest correlation between a chemical measurement and a biological response was that of total PAH versus the P450 RGS response. The use of P450 RGS as a screening tool to assess the relative risk of contaminants on sediments is biologically meaningful, and is a rapid and inexpensive means of determining which samples require complete chemical characterization.

  4. Mycobacterium tuberculosis infection among persons who inject drugs in San Diego, California. (United States)

    Armenta, R F; Collins, K M; Strathdee, S A; Bulterys, M A; Munoz, F; Cuevas-Mota, J; Chiles, P; Garfein, R S


    Persons who inject drugs (PWID) might be at increased risk for Mycobacterium tuberculosis infection and reactivation of latent tuberculous infection (LTBI) due to their injection drug use. To determine prevalence and correlates of M. tuberculosis infection among PWID in San Diego, California, USA. PWID aged 18 years underwent standardized interviews and serologic testing using an interferon-gamma release assay (IGRA) for LTBI and rapid point-of-care assays for human immunodeficiency virus (HIV) and hepatitis C virus (HCV) infections. Independent correlates of M. tuberculosis infection were identified using multivariable log-binomial regression. A total of 500 participants met the eligibility criteria. The mean age was 43.2 years (standard deviation 11.6); most subjects were White (52%) or Hispanic (30.8%), and male (75%). Overall, 86.7% reported having ever traveled to Mexico. Prevalence of M. tuberculosis infection was 23.6%; 0.8% were co-infected with HIV and 81.7% were co-infected with HCV. Almost all participants (95%) had been previously tested for M. tuberculosis; 7.6% had been previously told they were infected. M. tuberculosis infection was independently associated with being Hispanic, having longer injection histories, testing HCV-positive, and correctly reporting that people with 'sleeping' TB cannot infect others. Strategies are needed to increase awareness about and treatment for M. tuberculosis infection among PWID in the US/Mexico border region.

  5. Status and understanding of groundwater quality in the San Diego Drainages Hydrogeologic Province, 2004: California GAMA Priority Basin Project (United States)

    Wright, Michael T.; Belitz, Kenneth


    Groundwater quality in the approximately 3,900-square-mile (mi2) San Diego Drainages Hydrogeologic Province (hereinafter San Diego) study unit was investigated from May through July 2004 as part of the Priority Basin Project of the Groundwater Ambient Monitoring and Assessment (GAMA) Program. The study unit is located in southwestern California in the counties of San Diego, Riverside, and Orange. The GAMA Priority Basin Project is being conducted by the California State Water Resources Control Board in collaboration with the U.S. Geological Survey (USGS) and the Lawrence Livermore National Laboratory. The GAMA San Diego study was designed to provide a statistically robust assessment of untreated-groundwater quality within the primary aquifer systems. The assessment is based on water-quality and ancillary data collected by the USGS from 58 wells in 2004 and water-quality data from the California Department of Public Health (CDPH) database. The primary aquifer systems (hereinafter referred to as the primary aquifers) were defined by the depth interval of the wells listed in the California Department of Public Health (CDPH) database for the San Diego study unit. The San Diego study unit consisted of four study areas: Temecula Valley (140 mi2), Warner Valley (34 mi2), Alluvial Basins (166 mi2), and Hard Rock (850 mi2). The quality of groundwater in shallow or deep water-bearing zones may differ from that in the primary aquifers. For example, shallow groundwater may be more vulnerable to surficial contamination than groundwater in deep water-bearing zones. This study had two components: the status assessment and the understanding assessment. The first component of this study-the status assessment of the current quality of the groundwater resource-was assessed by using data from samples analyzed for volatile organic compounds (VOC), pesticides, and naturally occurring inorganic constituents, such as major ions and trace elements. The status assessment is intended to

  6. Using Local Climate Science to Educate "Key Influentials" and their Communities in the San Diego Region (United States)

    Boudrias, M. A.; Estrada, M.; Anders, S.; Silva-Send, N. J.; Yin, Z.; Schultz, P.; Young, E.


    The San Diego Regional Climate Education Partnership has formed an innovative and collaborative team whose mission is to implement a research-based climate science education and communications program to increase knowledge about climate science among highly-influential leaders and their communities and foster informed decision making based on climate science and impacts. The team includes climate scientists, behavioral psychologists, formal and informal educators and communication specialists. The Partnership's strategic plan has three major goals: (1) raise public understanding of the causes and consequences of climate change; (2) identify the most effective educational methods to educate non-traditional audiences (Key Influentials) about the causes and consequences of climate change; and (3) develop and implement a replicable model for regional climate change education. To implement this strategic plan, we have anchored our project on three major pillars: (1) Local climate science (causes, impacts and long-term consequences); (2) theoretical, research-based evaluation framework (TIMSI); and (3) Key! Influentials (KI) as primary audience for messages (working w! ith and through them). During CCEP-I, the Partnership formed and convened an advisory board of Key Influentials, completed interviews with a sample of Key Influentials, conducted a public opinion survey, developed a website ( , compiled inventories on literature of climate science education resources and climate change community groups and local activities, hosted stakeholder forums, and completed the first phase of on an experiment to test the effects of different messengers delivering the same local climate change message via video. Results of 38 KI Interviews provided evidence of local climate knowledge, strong concern about climate change, and deeply held values related to climate change education and regional leadership. The most intriguing result was that while 90% of Key

  7. HCV infection prevalence lower than expected among 18-40-year-old injection drug users in San Diego, CA. (United States)

    Garfein, Richard S; Rondinelli, Amanda; Barnes, Richard F W; Cuevas, Jazmine; Metzner, Mitcheal; Velasquez, Michele; Rodriguez, David; Reilly, Meredith; Xing, Jian; Teshale, Eyasu H


    San Diego, California shares the world's busiest land border crossing with Tijuana, Mexico-a city where 95 % of injection drug users (IDUs) test hepatitis C virus (HCV) antibody-positive. Yet, little is known about the prevalence and risk behaviors for HCV among IDUs in San Diego. In 2009-2010, 18-40-year-old IDUs in San Diego County completed a risk assessment interview and serologic testing for HCV and HIV infection. Recruitment involved respondent-driven sampling, venue-based sampling at a syringe exchange program, and convenience sampling. Correlates of HCV infection were identified by multivariable logistic regression. Among 510 current IDUs, 26.9 % (95 % CI 23.0-30.7 %) and 4.2 % (95 % CI 2.4-5.9 %) had been infected with HCV and HIV, respectively. Overall, median age was 28 years; 74 % were male; 60 % white and 29 % Hispanic; and 96 % were born in the U.S. Median years of injecting was 6; 41 % injected daily; 60 % injected heroin most often; 49 % receptively shared syringes and 68 % shared other injection paraphernalia; and only 22 % reported always using new syringes in the past 3 months. Two thirds had ever traveled to Mexico and 19 % injected in Mexico. HCV infection was independently associated with sharing injection paraphernalia (adjusted odds ratio [AOR] = 1.69) and SEP use (AOR = 2.17) in the previous 3 months, lifetime history of drug overdose (AOR = 2.66), and increased years of injecting (AOR = 2.82, all P values Diego was modest compared to other US cities and much lower than Tijuana. Given that known individual-level HCV risk factors were common in San Diego, the city's lower HCV prevalence might be due to differences in social and structural factors between the cities.

  8. Brucellosis in San Diego: epidemiology and species-related differences in acute clinical presentations. (United States)

    Troy, Stephanie B; Rickman, Leland S; Davis, Charles E


    Although aggressive public health measures have greatly reduced the number of brucellosis cases in the United States, there is a resurgence of interest in this worldwide zoonosis because of its potential as a bioweapon and its 8-fold higher incidence in California, Texas, and the other borderlands between the United States and Mexico compared with the national rate. Accordingly, we reviewed the clinical records of 28 patients diagnosed at a university hospital in San Diego, CA, between 1979 and 2002 to look for new epidemiologic trends and to test the hypothesis that there are species-specific differences in clinical presentations. In contrast to the latest California-wide study completed in 1992, Brucella abortus infections were more common (73%) than Brucella melitensis after 1992, and women were more commonly infected (77% compared with 39%) than men. Major risk factors remained Hispanic ethnicity, travel to Mexico, and ingestion of nonpasteurized dairy products. Analysis of diagnostic procedures suggested that the traditional practice of prolonged incubation of blood cultures increased their sensitivity for Brucella, even in automated radiometric systems. Direct comparison of the clinical manifestations of infections with B. abortus and B. melitensis strongly supported differences in acute presentations. B. melitensis presented more acutely as fevers of unknown origin with statistically significant higher rates of abdominal tenderness, hepatomegaly, splenomegaly, thrombocytopenia, pancytopenia, and hepatic dysfunction. These results suggest that the epidemiology of brucellosis in California may be evolving, and they show, to our knowledge for the first time in a single series, that species-specific differences in presentations may account for some of the protean manifestations of brucellosis. Familiarity with manifestations of brucellosis and the optimal laboratory techniques for its diagnosis could help physicians protect the public against this reemerging

  9. Initial source and site characterization studies for the U. C. San Diego campus

    Energy Technology Data Exchange (ETDEWEB)

    Day, S.; Erick, F.; Heuze, F.E.; Mellors, R.; Minster, B.; Park, S.; Wagoner, J.


    The basic approach of the Campus Laboratory Collaboration (CLC) project is to combine the substantial expertise that exists within the University of California (UC) system in geology, seismology, geotechnical engineering, and structural engineering to evaluate the effects of large earthquakes on UC facilities. These estimates draw upon recent advances in hazard assessment, seismic wave propagation modeling in rocks and soils, dynamic soil testing, and structural dynamics. The UC campuses currently chosen for applications of our integrated methodology are Riverside, San Diego, and Santa Barbara. The basic procedure is first to identify possible earthquake source regions and local campus site conditions that may affect estimates of strong ground motion. Combined geological , geophysical, and geotechnical studies are conducted to characterize each campus with specific focus on the location of particular target buildings of special interest to the campus administrators. The project will then drill and log deep boreholes next to the target structure, to provide direct in-situ measurements of subsurface material properties and to install uphole and downhole 3-component seismic sensors capable of recording both weak and strong motions. The boreholes provide access to deeper materials, below the soil layers, that have relatively high seismic shear-wave velocities. Analysis of conjugate downhole and uphole records provides a basis for optimizing the representation of the low-strain response of the sites. Earthquake rupture scenarios of identified causative faults are combined with the earthquake records and nonlinear soil models to provide site-specific estimates of strong motions at the selected target locations. The predicted ground motions are then used as input to the dynamic analysis of the buildings.

  10. Gastrointestinal torsions and intussusception in northern koalas (Phascolarctos cinereus) at San Diego Zoo (1976-2012). (United States)

    Joyce-Zuniga, Nicole M; Roesler, Jennifer; Andrus, Chris Hamlin; Sutherland-Smith, Meg; Rideout, Bruce A; Pye, Geoffrey W


    The recent classification as threatened status of the northern koala (Phascolarctos cinereus) by the Australian Government highlights the importance of the conservation and health management of this iconic Australian marsupial. This case series describes gastrointestinal torsion and intussusception in six northern koalas (three males, three females, 2-11 yr old) at the San Diego Zoo from 1976 to 2012. Two koalas died shortly after presentation. Diagnoses of ileocecal intussusception, resulting from enteritis in one case and cecal torsion in the other, were made at postmortem examination. One koala died 4 days after an exploratory laparotomy, with negative findings, and an acute double colonic intussusception was diagnosed at postmortem examination. Two small intestinal mesenteric torsion and one proximal colon mesenteric torsion cases were successfully corrected surgically. In the case of colonic mesenteric torsion, the koala had recurrent clinical signs 2 wk later, and a second surgery requiring resection and anastomosis of ischemic jejunum was performed, with the koala dying shortly afterward. One koala with small intestinal torsion had a recurrence of torsion 22 mo later and subsequently died. The koala with the second case of small intestinal torsion remains alive 14 mo postsurgical correction. All six koalas presented with signs of colic that included anorexia, lethargy, depression, acute abdominal distension, abdominal stretching, decreased fecal output, open-mouth gasping, or a combination of symptoms. Abdominal radiographs may show stacked gastrointestinal linear gas patterns and contrast stasis. Prevalence of torsion and intussusception is low at this institution (2%), although recurrence in individuals is common (50%) and overall survival is poor (83%), which emphasizes the importance of timely recognition, surgical correction, and postoperative management. While inciting etiologies were unable to be determined in these cases, monitoring generalized

  11. Patterns of mortality in a montane mixed-conifer forest in San Diego County, California. (United States)

    Freeman, Mary Pyott; Stow, Douglas A; An, Li


    We examine spatial patterns of conifer tree mortality and their changes over time for the montane mixed-conifer forests of San Diego County. These forest areas have recently experienced extensive tree mortality due to multiple factors. A spatial contextual image processing approach was utilized with high spatial resolution digital airborne imagery to map dead trees for the years 1997, 2000, 2002, and 2005 for three study areas: Palomar, Volcan, and Laguna mountains. Plot-based fieldwork was conducted to further assess mortality patterns. Mean mortality remained static from 1997 to 2002 (4, 2.2, and 4.2 trees ha(-1) for Palomar, Volcan, and Laguna) and then increased by 2005 to 10.3, 9.7 and 5.2 trees ha(-1) , respectively. The increase in mortality between 2002 and 2005 represents the temporal pattern of a discrete disturbance event, attributable to the 2002-2003 drought. Dead trees are significantly clustered for all dates, based on spatial cluster analysis, indicating that they form distinct groups, as opposed to spatially random single dead trees. Other tests indicate no directional shift or spread of mortality over time, but rather an increase in density. While general temporal and spatial mortality processes are uniform across all study areas, the plot-based species and quantity distribution of mortality, and diameter distributions of dead versus living trees, vary by study area. The results of this study improve our understanding of stand- to landscape-level forest structure and dynamics, particularly by examining them from the multiple perspectives of field and remotely sensed data. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  12. Voluntarily Reported Immunization Registry Data: Reliability and Feasibility to Predict Immunization Rates, San Diego, California, 2013. (United States)

    Madewell, Zachary J; Wester, Robert B; Wang, Wendy W; Smith, Tyler C; Peddecord, K Michael; Morris, Jessica; DeGuzman, Heidi; Sawyer, Mark H; McDonald, Eric C

    Accurate data on immunization coverage levels are essential to public health program planning. Reliability of coverage estimates derived from immunization information systems (IISs) in states where immunization reporting by medical providers is not mandated by the state may be compromised by low rates of participation. To overcome this problem, data on coverage rates are often acquired through random-digit-dial telephone surveys, which require substantial time and resources. This project tested both the reliability of voluntarily reported IIS data and the feasibility of using these data to estimate regional immunization rates. We matched telephone survey records for 553 patients aged 19-35 months obtained in 2013 to 430 records in the San Diego County IIS. We assessed concordance between survey data and IIS data using κ to measure the degree of nonrandom agreement. We used multivariable logistic regression models to investigate differences among demographic variables between the 2 data sets. These models were used to construct weights that enabled us to predict immunization rates in areas where reporting is not mandated. We found moderate agreement between the telephone survey and the IIS for the diphtheria, tetanus, and acellular pertussis (κ = 0.49), pneumococcal conjugate (κ = 0.49), and Haemophilus influenzae type b (κ = 0.46) vaccines; fair agreement for the varicella (κ = 0.39), polio (κ = 0.39), and measles, mumps, and rubella (κ = 0.35) vaccines; and slight agreement for the hepatitis B vaccine (κ = 0.17). Consistency in factors predicting immunization coverage levels in a telephone survey and IIS data confirmed the feasibility of using voluntarily reported IIS data to assess immunization rates in children aged 19-35 months.

  13. Whole-genome analysis of mycobacteria from birds at the San Diego Zoo. (United States)

    Pfeiffer, Wayne; Braun, Josephine; Burchell, Jennifer; Witte, Carmel L; Rideout, Bruce A


    Mycobacteria isolated from more than 100 birds diagnosed with avian mycobacteriosis at the San Diego Zoo and its Safari Park were cultured postmortem and had their whole genomes sequenced. Computational workflows were developed and applied to identify the mycobacterial species in each DNA sample, to find single-nucleotide polymorphisms (SNPs) between samples of the same species, to further differentiate SNPs between as many as three different genotypes within a single sample, and to identify which samples are closely clustered genomically. Nine species of mycobacteria were found in 123 samples from 105 birds. The most common species were Mycobacterium avium and Mycobacterium genavense, which were in 49 and 48 birds, respectively. Most birds contained only a single mycobacterial species, but two birds contained a mixture of two species. The M. avium samples represent diverse strains of M. avium avium and M. avium hominissuis, with many pairs of samples differing by hundreds or thousands of SNPs across their common genome. By contrast, the M. genavense samples are much closer genomically; samples from 46 of 48 birds differ from each other by less than 110 SNPs. Some birds contained two, three, or even four genotypes of the same bacterial species. Such infections were found in 4 of 49 birds (8%) with M. avium and in 11 of 48 birds (23%) with M. genavense. Most were mixed infections, in which the bird was infected by multiple mycobacterial strains, but three infections with two genotypes differing by ≤ 10 SNPs were likely the result of within-host evolution. The samples from 31 birds with M. avium can be grouped into nine clusters within which any sample is ≤ 12 SNPs from at least one other sample in the cluster. Similarly, the samples from 40 birds with M. genavense can be grouped into ten such clusters. Information about these genomic clusters is being used in an ongoing, companion study of mycobacterial transmission to help inform management of bird collections.

  14. El ferrocarril San Diego-Arizona y el ferrocarril Tijuana-Tecate: Un corredor de herencia cultural binacional

    Directory of Open Access Journals (Sweden)

    María Eugenia Castillo


    Full Text Available En este artículo se discuten algunos lineamientos teóricos para identificar el antiguo ferrocarril estadounidense San Diego-Arizona –del cual forma parte el ferrocarril mexicano Tijuana-Tecate– como un corredor de herencia binacional. Asimismo se analiza una aproximación metodológica dentro del campo de la geografía cultural y de la preservación histórica para su valorización e integración al desarrollo regional fronterizo.

  15. El ferrocarril San Diego-Arizona y el ferrocarril Tijuana-Tecate: Un corredor de herencia cultural binacional



    En este artículo se discuten algunos lineamientos teóricos para identificar el antiguo ferrocarril estadounidense San Diego-Arizona del cual forma parte el ferrocarril mexicano Tijuana-Tecate como un corredor de herencia binacional. Asimismo se analiza una aproximación metodológica dentro del campo de la geografía cultural y de la preservación histórica para su valorización e integración al desarrollo regional fronterizo.

  16. Highlights from the 58th meeting of the American Society of Haematology, 1-6 December 2016, San Diego, USA. (United States)

    Mazzarella, Luca


    The recent 58th Annual American Society of Haematology (ASH) meeting held in San Diego shed light on the usual mixture of groundbreaking basic and translational science and the recent practice-changing clinical trials. Recurrent themes this year were the use of recent next-generation sequencing (NGS) techniques to perfect prognostic stratification and disease monitoring. Newer prospects on the role of metabolism in normal and malignant haemopoiesis and mature data on long-awaited trials on immunotherapy and CAR-T cells in lymphoid neoplasms were also discussed.

  17. Quantitative sampling of nanobiota (microbiota) of the deep-sea benthos—III. The bathyal San Diego trough (United States)

    Burnett, Bryan R.


    Nanobiota (microbiota) from the 1200-m bottom of the San Diego Trough were sampled in 5-m layers to approx. 100 mm deep in the sediment. Unlike the macrofauna, the nanobiota were relatively uniformly distributed to at least 60 and perhaps to 100-mm depths. However, there is probably a thin surface film richer both in numbers and protoplasm volume (biovolume) than the sediment layer immediately below. Yeast-like cells were the predominant nanobiotal organisms, typically constituting over 70% of the biovolume of the sediment. Yeast-like cells may occupy part of the decomposer niche normally occupied by bacteria in marine sediments from shallower depths.

  18. Incorporating genetic sampling in long-term monitoring and adaptive management in the San Diego County Management Strategic Plan Area, Southern California (United States)

    Vandergast, Amy G.


    Habitat and species conservation plans usually rely on monitoring to assess progress towards conservation goals. Southern California, USA, is a hotspot of biodiversity and home to many federally endangered and threatened species. Here, several regional multi-species conservation plans have been implemented to balance development and conservation goals, including in San Diego County. In the San Diego County Management Strategic Plan Area (MSPA), a monitoring framework for the preserve system has been developed with a focus on species monitoring, vegetation monitoring, threats monitoring and abiotic monitoring. Genetic sampling over time (genetic monitoring) has proven useful in gathering species presence and abundance data and detecting population trends, particularly related to species and threats monitoring objectives. This report reviews genetic concepts and techniques of genetics that relate to monitoring goals and outlines components of a genetic monitoring scheme that could be applied in San Diego or in other monitoring frameworks throughout the Nation.

  19. Strong earthquake motion estimates for three sites on the U.C. San Diego campus

    Energy Technology Data Exchange (ETDEWEB)

    Day, S; Doroudian, M; Elgamal, A; Gonzales, S; Heuze, F; Lai, T; Minster, B; Oglesby, D; Riemer, M; Vernon, F; Vucetic, M; Wagoner, J; Yang, Z


    The approach of the Campus Earthquake Program (CEP) is to combine the substantial expertise that exists within the UC system in geology, seismology, and geotechnical engineering, to estimate the earthquake strong motion exposure of UC facilities. These estimates draw upon recent advances in hazard assessment, seismic wave propagation modeling in rocks and soils, and dynamic soil testing. The UC campuses currently chosen for application of our integrated methodology are Riverside, San Diego, and Santa Barbara. The procedure starts with the identification of possible earthquake sources in the region and the determination of the most critical fault(s) related to earthquake exposure of the campus. Combined geological, geophysical, and geotechnical studies are then conducted to characterize each campus with specific focus on the location of particular target buildings of special interest to the campus administrators. We drill, sample, and geophysically log deep boreholes next to the target structure, to provide direct in-situ measurements of subsurface material properties, and to install uphole and downhole 3-component seismic sensors capable of recording both weak and strong motions. The boreholes provide access below the soil layers, to deeper materials that have relatively high seismic shear-wave velocities. Analyses of conjugate downhole and uphole records provide a basis for optimizing the representation of the low-strain response of the sites. Earthquake rupture scenarios of identified causative faults are combined with the earthquake records and with nonlinear soil models to provide site-specific estimates of strong motions at the selected target locations. The predicted ground motions are shared with the UC consultants, so that they can be used as input to the dynamic analysis of the buildings. Thus, for each campus targeted by the CEP project, the strong motion studies consist of two phases, Phase 1--initial source and site characterization, drilling

  20. Prevalence and treatment of latent tuberculosis infection among newly arrived refugees in San Diego County, January 2010-October 2012. (United States)

    Bennett, Rachel J; Brodine, Stephanie; Waalen, Jill; Moser, Kathleen; Rodwell, Timothy C


    We determined the prevalence and treatment rates of latent tuberculosis infection (LTBI) in newly arrived refugees in San Diego County, California, and assessed demographic and clinical characteristics associated with these outcomes. We analyzed data from LTBI screening results of 4280 refugees resettled in San Diego County between January 2010 and October 2012. Using multivariate logistic regression, we calculated the associations between demographic and clinical risk factors and the outcomes of LTBI diagnosis and LTBI treatment initiation. The prevalence of LTBI was highest among refugees from sub-Saharan Africa (43%) and was associated with current smoking and having a clinical comorbidity that increases the risk for active tuberculosis. Although refugees from sub-Saharan Africa had the highest prevalence of infection, they were significantly less likely to initiate treatment than refugees from the Middle East. Refugees with postsecondary education were significantly more likely to initiate LTBI treatment. Public health strategies are needed to increase treatment rates among high-risk refugees with LTBI. Particular attention is required among refugees from sub-Saharan Africa and those with less education.

  1. Assessing the potential health impacts of the 2003 and 2007 firestorms on bottlenose dolphins (Tursiops trucatus) in San Diego Bay. (United States)

    Venn-Watson, Stephanie; Smith, Cynthia R; Jensen, Eric D; Rowles, Teri


    Firestorms negatively affected air quality throughout San Diego County during 2003 and 2007, including the San Diego Bay, which houses the Navy's bottlenose dolphins (Tursiops truncatus). To assess the potential impact of the 2003 and 2007 fires on dolphin health. Hematology and serum chemistry values were evaluated retrospectively among Navy dolphins the year and month before; during; and the month after the 2003 and 2007 fires. Both 2003 and 2007 fires were associated with lower calcium either during or the month post-fire compared to the control periods. During and the month following the 2003 fire, dolphins had higher serum carbon dioxide compared to the control periods. Dolphins during and the month following the 2007 fire had lower absolute or percent neutrophils and higher chloride. The 2007 fire was also associated with increased percent eosinophils during the fire and higher percent monocytes and bilirubin the month following the fire compared to the control periods. Consistent with what has been previously reported in humans and other animals, this study supports that fire smoke inhalation may have mild effects on dolphin physiology, including calcium homeostasis, lung function and immune response.

  2. Resilient development and environmental justice in divided territory: political ecology in the San Diego-Tijuana bioregion.

    Directory of Open Access Journals (Sweden)

    K. Haines


    Full Text Available This paper explores issues in the expansion of environmental justice rhetoric to the developing world, and propose insights from resilience theory, political ecology, and bioregionalism as supplements. I do this from the frame of the San Diego-Tijuana region, where regional inequalities are stark and global processes have a heavy local footprint. Sharing a broadly-defined natural region, the growing evidence of ecological crisis increasingly calls for collaboration between two communities which often perceive themselves as relatively disconnected. Understanding challenges to social-ecological resilience and environmental justice in the San Diego-Tijuana region, however, also requires understanding it as an inflection point for global economic, military, and human migration flows occurring at many scales. It is in the context of building effective regional collaboration that environmental justice must engage the analyses of scale and political economy contained in political ecology as a challenge. I suggest, however, that any environmental justice discourse informed by political ecology cannot remain abstract from the local context. A “bioregional” community forged around shared ecological systems may serve as an important resource for creating social-ecological resilience in politically divided territory.

  3. Results of the Multi-Jurisdictional Conference on the Farmworker and Day Laborer Housing Crisis (San Diego, California, February 21, 1991). (United States)

    San Diego City Council, CA.

    In February 1991, policymakers and representatives of resource agencies and nonprofit organizations met to find solutions to a major regional crisis--the lack of housing for farmworkers and day laborers in San Diego County. The region contains about 200 worker camps, usually situated in undeveloped canyons and fields near suburban residential…

  4. Interpretation of geology, geophysics and hydrochemistry for selection of geothermal drilling sites, Canon de San Diego Grant, Sandoval county, New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Koenig, J.B.; McIntyre, J.R.; Klein, C.W.; Beyer, J.H.


    This project began in mid-1977 as an evaluation of the geology and hydrogeology of the Canon de San Diego Grant for Sunoco Energy Development Co. (Sunedco) and evolved late in 1977, at Sunedco's direction, into a more comprehensive study of geophysical, geologic and hydrogeochemical data. This has been used to select sites for the possible drilling of deep geothermal wells.

  5. Proceedings of the Annual Conference of the Military Testing Association (27th) Held in San Diego, California on 21-25 October 1985. Volume 1 (United States)


    and Development Center (NPRDC). The Conference was held at the Bahia Hotel in San Diego, California, 21 through 25 October 1985. A total of 169 paper...different xuthds of ensurrng job performance yield quite different results." Campbell at.o narris 1escro-be the results of attempting to interpret

  6. Reconstructing Equality on New Political Ground: The Politics of Representation in the Charter School Debate at the University of California, San Diego (United States)

    Rosen, Lisa; Mehan, Hugh


    Attacks on the legitimacy of affirmative action pose new challenges for public universities committed to creating a diverse student population without considering race or ethnicity as factors in admissions. On the basis of a case study of the controversy surrounding the building of a charter school at the University of California, San Diego, in…

  7. Proceedings of the Conference on Joint Problem Solving and Microcomputers (San Diego, California, March 31 - April 2, 1983). Technical Report No. 1. (United States)

    Cole, Michael; And Others

    A group of American and Japanese psychologists, anthropologists, linguists, and computer scientists gathered at the University of California, San Diego, to exchange ideas on models of joint problem solving and their special relevance to the design and implementation of computer-based systems of instruction. Much of the discussion focused on…

  8. Apropiación de la figura de san Diego de Alcalá por una comunidad maya de Campeche

    Directory of Open Access Journals (Sweden)

    David de Ángel García


    Full Text Available En este trabajo se ilustran algunos mecanismos implementados por los mayas peninsulares de la comunidad de Nunkiní, Campeche, para apropiarse de la figura de san Diego de Alcalá, el santo patrono del pueblo. Basándome en datos etnográficos y en testimonios orales, me ocuparé de tres ámbitos en los que se ponen de manifiesto las profundas transformaciones y reelaboraciones que ha sufrido este personaje sagrado desde su llegada a Nunkiní. Pretendo mostrar cómo una entidad tan extraña al universo cultural indígena pudo pasar a convertirse en una deidad con características propias de las potencias mesoamericanas y una identidad marcadamente local.

  9. Individual and socio-environmental factors associated with unsafe injection practices among young adult injection drug users in San Diego (United States)

    Muñoz, Fátima; Burgos, José Luis; Cuevas-Mota, Jazmine; Teshale, Eyasu; Garfein, Richard S.


    Unsafe injection practices significantly increase the risk of hepatitis C virus and human immunodeficiency virus (HIV) infection among injection drug users (IDUs). We examined individual and socio-environmental factors associated with unsafe injection practices in young adult IDUs in San Diego, California. Of 494 IDUs, 46.9% reported receptive syringe sharing and 68.8% sharing drug preparation paraphernalia in the last 3 months. Unsafe injection practices were associated with increased odds of having friends who injected drugs with used syringes, injecting with friends, sexual partners, and injecting heroin. Perceived high susceptibility to HIV and perceived barriers to obtaining sterile syringes were associated with increased odds of receptive syringe sharing, but not with sharing injection paraphernalia. Over half IDUs reported unsafe injection practices, and our results suggest that personal relationships might influence IDUs’ perceptions that dictate behavior. Integrated interventions addressing individual and socio-environmental factors are needed to promote safe injection practices in this population. PMID:24920342

  10. Migración y transnacionalismo. Experiencias de inmigrantes en el transporte público de San Diego, California, 2004

    Directory of Open Access Journals (Sweden)

    Gloria Ciria Valdéz-Gardea


    Full Text Available Con la idea de que las prácticas cotidianas entre los inmigrantes mexicanos permiten construir y redefinir el espacio transnacional, como punto de partida, en este artículo se explorará la noción de la migración desde la perspectiva del transnacionalismo, en el marco de las tendencias contemporáneas del fenómeno migratorio en México. Al examinar las interacciones de los inmigrantes en el transporte público en San Diego, California, se buscará entender cómo se crean y recrean sus acciones. Este acercamiento desde un espacio social, permite analizar las interacciones específicas entre sociedades con historias y procesos de desarrollo diferentes.

  11. Polyplacophora (Mollusca) from the San Diego Formation: A remarkable assemblage of fossil chitons from the Pliocene of southern Califoria (United States)

    Vendrasco, Michael J.; Eernisse, Douglas J.; Powell, Charles L.; Fernandez, Christine Z.


    A rich chiton assemblage consisting of more than 15,000 valves (shell plates) was collected by George P. Kanakoff (1897–1973) from Pliocene exposures of the San Diego Formation just north of the U.S./Mexican border. The assemblage includes 16 extant species, three extinct species (Callistochiton sphaerae n. sp., Lepidozona kanakoffi n. sp., and Amicula solivaga n. sp.), and three indeterminate species. The collection is dominated by the genus Callistochiton and also includes the genera Leptochiton, Oldroydia, Lepidozona, Stenoplax, Amicula, Mopalia, Placiphorella, Tonicella, Dendrochiton, and Nuttallina. This assemblage expands the known stratigraphic and paleogeographic ranges of many chiton genera and species and provides information about an apparent late Cenozoic diversification of chitons along the Pacific Coast of North America. Chitons appear to have diversified in the northeastern Pacific from the middle Miocene to Pleistocene, driven in part by regional increases in productivity and environmental heterogeneity during that time. The chitons are interpreted to have been deposited at inner-neritic depths (,25 m) in the mouth of a bay or in a continental shelf environment, and the annual temperature range and seasonality are inferred to have been similar to those that occur off the nearby San Diego coast today. However, the fossil assemblages also include a mixture of taxa that today range only to the north or to the south. The large sample sizes of chiton valves allow rigorous analysis of the ratio of valve types, revealing a divergence from the expected pattern. This divergence is even greater on average than what occurs in assemblages of chiton valves in Holocene sediments, revealing that

  12. Higher Environmental Relative Moldiness Index (ERMI) Values Measured in Homes of Asthmatic Children in Boston, Kansas City, and San Diego (United States)

    Vesper, Stephen; Barnes, Charles; Ciaccio, Christina E.; Johanns, Alan; Kennedy, Kevin; Murphy, Johnna S.; Nunez-Alvarez, Arcela; Sandel, Megan T.; Cox, David; Dewalt, Gary; Ashley, Peter J.


    Objective Mold in water-damaged homes has been linked to asthma. Our objective was to test a new metric to quantify mold exposures in asthmatic children’s homes in three widely dispersed cities in the United States. Methods The Environmental Relative Moldiness Index (ERMI) metric was created by the US Environmental Protection Agency, with assistance by the Department of Housing and Urban Development (HUD), to quantify mold contamination in US homes. The ERMI values in homes of asthmatic children were determined for the three widely dispersed cities of Boston, Kansas City, and San Diego. Results Asthmatic children in Boston (n = 76), Kansas City (n = 60), and San Diego (n = 93) were found to be living in homes with significantly higher ERMI values than were found in homes randomly selected during the 2006 HUD American Healthy Homes Survey (AHHS) from the same geographic areas (n = 34, 22, and 28, respectively). Taken together, the average ERMI value in the homes with an asthmatic child was 8.73 compared to 3.87 for the AHHS homes. In addition, Kansas City homes of children with “Mild, Moderate, or Severe Persistent Asthma” had average ERMI value of 12.4 compared to 7.9 for homes of children with only “Mild Intermittent Asthma.” Aspergillus niger was the only mold of the 36 tested which was measured in significantly greater concentration in the homes of asthmatic children in all three cities. Conclusion High ERMI values were associated with homes of asthmatic children in three widely dispersed cities in the United States. PMID:23137280

  13. The BirthPlace collaborative practice model: results from the San Diego Birth Center Study. (United States)

    Swartz; Jackson; Lang; Ecker; Ganiats; Dickinson; Nguyen


    Objective: The search for quality, cost-effective health care programs in the United States is now a major focus in the era of health care reform. New programs need to be evaluated as alternatives are developed in the health care system. The BirthPlace program provides comprehensive perinatal services with certified nurse-midwives and obstetricians working together in an integrated collaborative practice serving a primarily low-income population. Low-risk women are delivered by nurse-midwives in a freestanding birth center (The BirthPlace), which is one component of a larger integrated health network. All others are delivered by team obstetricians at the affiliated tertiary hospital. Wellness, preventive measures, early intervention, and family involvement are emphasized. The San Diego Birth Center Study is a 4-year research project funded by the U.S. Federal Agency for Health Care Policy and Research (#R01-HS07161) to evaluate this program. The National Birth Center Study (NEJM, 1989; 321(26): 1801-11) described the advantages and safety of freestanding birth centers. However, a prospective cohort study with a concurrent comparison group of comparable risk had not been conducted on a collaborative practice-freestanding birth center model to address questions of safety, cost, and patient satisfaction.Methods: The specific aims of this study are to compare this collaborative practice model to the traditional model of perinatal health care (physician providers and hospital delivery). A prospective cohort study comparing these two health care models was conducted with a final expected sample size of approximately 2,000 birth center and 1,350 traditional care subjects. Women were recruited from both the birth center and traditional care programs (private physicians offices and hospital based clinics) at the beginning of prenatal care and followed through the end of the perinatal period. Prenatal, intrapartum, postpartum and infant morbidity and mortality are being

  14. Slip rate on the San Diego trough fault zone, inner California Borderland, and the 1986 Oceanside earthquake swarm revisited (United States)

    Ryan, Holly F.; Conrad, James E.; Paull, C.K.; McGann, Mary


    The San Diego trough fault zone (SDTFZ) is part of a 90-km-wide zone of faults within the inner California Borderland that accommodates motion between the Pacific and North American plates. Along with most faults offshore southern California, the slip rate and paleoseismic history of the SDTFZ are unknown. We present new seismic reflection data that show that the fault zone steps across a 5-km-wide stepover to continue for an additional 60 km north of its previously mapped extent. The 1986 Oceanside earthquake swarm is located within the 20-km-long restraining stepover. Farther north, at the latitude of Santa Catalina Island, the SDTFZ bends 20° to the west and may be linked via a complex zone of folds with the San Pedro basin fault zone (SPBFZ). In a cooperative program between the U.S. Geological Survey (USGS) and the Monterey Bay Aquarium Research Institute (MBARI), we measure and date the coseismic offset of a submarine channel that intersects the fault zone near the SDTFZ–SPBFZ junction. We estimate a horizontal slip rate of about 1:5 0:3 mm=yr over the past 12,270 yr.

  15. Recent deformation on the San Diego Trough and San Pedro Basin fault systems, offshore Southern California: Assessing evidence for fault system connectivity. (United States)

    Bormann, J. M.; Kent, G. M.; Driscoll, N. W.; Harding, A. J.


    The seismic hazard posed by offshore faults for coastal communities in Southern California is poorly understood and may be considerable, especially when these communities are located near long faults that have the ability to produce large earthquakes. The San Diego Trough fault (SDTF) and San Pedro Basin fault (SPBF) systems are active northwest striking, right-lateral faults in the Inner California Borderland that extend offshore between San Diego and Los Angeles. Recent work shows that the SDTF slip rate accounts for 25% of the 6-8 mm/yr of deformation accommodated by the offshore fault network, and seismic reflection data suggest that these two fault zones may be one continuous structure. Here, we use recently acquired CHIRP, high-resolution multichannel seismic (MCS) reflection, and multibeam bathymetric data in combination with USGS and industry MCS profiles to characterize recent deformation on the SDTF and SPBF zones and to evaluate the potential for an end-to-end rupture that spans both fault systems. The SDTF offsets young sediments at the seafloor for 130 km between the US/Mexico border and Avalon Knoll. The northern SPBF has robust geomorphic expression and offsets the seafloor in the Santa Monica Basin. The southern SPBF lies within a 25-km gap between high-resolution MCS surveys. Although there does appear to be a through-going fault at depth in industry MCS profiles, the low vertical resolution of these data inhibits our ability to confirm recent slip on the southern SPBF. Empirical scaling relationships indicate that a 200-km-long rupture of the SDTF and its southern extension, the Bahia Soledad fault, could produce a M7.7 earthquake. If the SDTF and the SPBF are linked, the length of the combined fault increases to >270 km. This may allow ruptures initiating on the SDTF to propagate within 25 km of the Los Angeles Basin. At present, the paleoseismic histories of the faults are unknown. We present new observations from CHIRP and coring surveys at

  16. Mapping the Beat: A History and Geography through Music Curriculum at the University of California San Diego, ArtsBridge America Program - United States History from 1776-1865 for 5th Grade


    Scholl, Jennifer Coordinator; Baker, James; Boyer, William; Eidsheim, Nina


    In 2002, the University of California San Diego ArtsBridge America program initiated a project, funded by the National Geographic Society Education Foundation, that was designed to address the lack of standards-based geography content and culture-based arts instruction within San Diego elementary schools. Representatives from host ArtsBridge institutions identified the following factors contributing to this deficiency: • a perceived lack of arts and geography competence amongst elementary ...

  17. The Impact of Retail Beverage Service Training and Social Host Laws on adolescents' DUI rates in San Diego Co, California. (United States)

    Scherer, Michael; Romano, Eduardo; Caldwell, Susan; Taylor, Eileen


    Driving under the influence (DUI) citations are still a serious concern among drivers aged 16-20 years and have been shown to be related to increased risk of fatal and non-fatal crashes. A battery of laws and policies has been enacted to address this concern. While numerous studies have evaluated these policies, there is still a need for comprehensive policy evaluations that take into account a variety of contextual factors. Previous effort by this research team examined the impact of 20 minimum legal drinking age (MLDA)-21 laws in the state of California, as they impacted alcohol-related crash rates among drivers under 21 years of age while at the same time accounting for alcohol and gas taxes, unemployment rates, sex distribution among drivers, and sobriety checkpoints. The current research seeks to expand this evaluation to the county level (San Diego, County). More specifically, we evaluate the impact of measures subject to County control such as Retail Beverage Service (RBS) laws and Social Host (SH) laws, as well as media coverage, city employment, alcohol outlet density, number of sworn officers, alcohol consumption, and taxation policies to determine the most effective point of intervention for communities seeking to reduce underage DUI citations. Annual DUI citation data (2000 to 2013), RBS and SH policies, and city-wide demographic, economic, and environmental information were collected and applied to each of the 20 cities in San Diego County, California. A structural equation model was fit to estimate the relative contribution of the variables of interest to DUI citation rates. Alcohol consumption and alcohol outlet density both demonstrated a significant increase in DUI rates, while RBS laws, SH laws, alcohol tax rates, media clusters, gas tax rates and unemployment rates demonstrated significant decreases in DUI rates. At the county level, although RBS, SH laws, and media efforts were found to contribute to a significant reduction in DUI rates, the

  18. Collaborative Problem-Solving Environments; Proceedings for the Workshop CPSEs for Scientific Research, San Diego, California, June 20 to July 1, 1999

    Energy Technology Data Exchange (ETDEWEB)

    Chin, George


    A workshop on collaborative problem-solving environments (CPSEs) was held June 29 through July 1, 1999, in San Diego, California. The workshop was sponsored by the U.S. Department of Energy and the High Performance Network Applications Team of the Large Scale Networking Working Group. The workshop brought together researchers and developers from industry, academia, and government to identify, define, and discuss future directions in collaboration and problem-solving technologies in support of scientific research.

  19. Diego de San Pedro's Cárcel de Amor: Political and Social Consequences of the Mismatch of Laureola and the King

    Directory of Open Access Journals (Sweden)

    Joaquín Márquez


    Full Text Available This paper proposes a political and social analysis of Diego de San Pedro’s Cárcel de Amor. Our starting point will be the Laureola's rejection, which will contrast with the king's refusal to request of his vassals. From there, we will examine both the social ideology of courtly love for the social class of the nobility as well as the political implications of this situation for the government of the kingdom.

  20. Symposium on High-Speed Aerodynamics and Structures (3rd) Held at San Diego, California on March 25-27, 1958. Volume 1. (United States)


    3RD Symposium Cooý " HIGH-SPEED AERODYNAMICS AND STRUCTURES SAN DIEGO., CALIF DTIC Fft EELECTE ti"tSAUG0 419 F 1ThIU~~4 do ume hat be~ aapm p ubi...waves as shown in Fig. 19. 1-0 £ - 45 rnsee -. 5 rnsec t, t ime Fig. 19. The 5-Millisecond Buildup, Finite Rise Time Wave Form 155 The distance at which a

  1. Policy challenges in the fight against childhood obesity: low adherence in San Diego area schools to the California Education Code regulating physical education. (United States)

    Consiglieri, G; Leon-Chi, L; Newfield, R S


    Assess the adherence to the Physical Education (PE) requirements per California Education Code in San Diego area schools. Surveys were administered anonymously to children and adolescents capable of physical activity, visiting a specialty clinic at Rady Children's Hospital San Diego. The main questions asked were their gender, grade, PE classes per week, and time spent doing PE. 324 surveys were filled, with 36 charter-school students not having to abide by state code excluded. We report on 288 students (59% females), mostly Hispanic (43%) or Caucasian (34%). In grades 1-6, 66.7% reported under the 200 min per 10 school days required by the PE code. Only 20.7% had daily PE. Average PE days/week was 2.6. In grades 7-12, 42.2% had reported under the 400 min per 10 school days required. Daily PE was noted in 47.8%. Average PE days/week was 3.4. Almost 17% had no PE, more so in the final two grades of high school (45.7%). There is low adherence to the California Physical Education mandate in the San Diego area, contributing to poor fitness and obesity. Lack of adequate PE is most evident in grades 1-6 and grades 11-12. Better resources, awareness, and enforcement are crucial.

  2. Policy Challenges in the Fight against Childhood Obesity: Low Adherence in San Diego Area Schools to the California Education Code Regulating Physical Education

    Directory of Open Access Journals (Sweden)

    G. Consiglieri


    Full Text Available Objective. Assess the adherence to the Physical Education (PE requirements per California Education Code in San Diego area schools. Methods. Surveys were administered anonymously to children and adolescents capable of physical activity, visiting a specialty clinic at Rady Children's Hospital San Diego. The main questions asked were their gender, grade, PE classes per week, and time spent doing PE. Results. 324 surveys were filled, with 36 charter-school students not having to abide by state code excluded. We report on 288 students (59% females, mostly Hispanic (43% or Caucasian (34%. In grades 1–6, 66.7% reported under the 200 min per 10 school days required by the PE code. Only 20.7% had daily PE. Average PE days/week was 2.6. In grades 7–12, 42.2% had reported under the 400 min per 10 school days required. Daily PE was noted in 47.8%. Average PE days/week was 3.4. Almost 17% had no PE, more so in the final two grades of high school (45.7%. Conclusions. There is low adherence to the California Physical Education mandate in the San Diego area, contributing to poor fitness and obesity. Lack of adequate PE is most evident in grades 1–6 and grades 11-12. Better resources, awareness, and enforcement are crucial.

  3. Youth advocacy as a tool for environmental and policy changes that support physical activity and nutrition: an evaluation study in San Diego County. (United States)

    Linton, Leslie S; Edwards, Christine C; Woodruff, Susan I; Millstein, Rachel A; Moder, Cheryl


    As evidence grows about the benefits of policy and environmental changes to support active living and healthy eating, effective tools for implementing change must be developed. Youth advocacy, a successful strategy in the field of tobacco control, should be evaluated for its potential in the field of obesity prevention. San Diego State University collaborated with the San Diego County Childhood Obesity Initiative to evaluate Youth Engagement and Action for Health! (YEAH!), a youth advocacy project to engage youth and adult mentors in advocating for neighborhood improvements in physical activity and healthy eating opportunities. Study objectives included documenting group process and success of groups in engaging in community advocacy with decision makers. In 2011 and 2012, YEAH! group leaders were recruited from the San Diego County Childhood Obesity Initiative's half-day train-the-trainer seminars for adult leaders. Evaluators collected baseline and postproject survey data from youth participants and adult group leaders and interviewed decision makers. Of the 21 groups formed, 20 completed the evaluation, conducted community assessments, and advocated with decision makers. Various types of decision makers were engaged, including school principals, food service personnel, city council members, and parks and recreation officials. Eleven groups reported change(s) implemented as a result of their advocacy, 4 groups reported changes pending, and 5 groups reported no change as a result of their efforts. Even a brief training session, paired with a practical manual, technical assistance, and commitment of adult leaders and youth may successfully engage decision makers and, ultimately, bring about change.

  4. Connectionist Models: Proceedings of the Summer School Held in San Diego, California on 1990 (United States)


    David, Brown University Burani, Cristina, Istituto Di Psicologia Carlin, Michael J., Naval Ocean Systems Center Camporese, Daniel S., University of... Psicologia Del C. N. R. Ossen, Arnfried, Technical University of Berlin Parisi, Domenico, Istituto Di Psicologia Del C. N. R. Pearlmutter, B...changes in thironmenadts pheng and maintenance of an ongoing cognitive model of one’san org nism’s life. In his case, learni g a apts eno- kin and social

  5. Gaining the necessary geologic, hydrologic, and geochemical understanding for additional brackish groundwater development, coastal San Diego, California, USA (United States)

    Danskin, Wesley R.


    Local water agencies and the United States Geological Survey are using a combination of techniques to better understand the scant freshwater resources and the much more abundant brackish resources in coastal San Diego, California, USA. Techniques include installation of multiple-depth monitoring well sites; geologic and paleontological analysis of drill cuttings; geophysical logging to identify formations and possible seawater intrusion; sampling of pore-water obtained from cores; analysis of chemical constituents including trace elements and isotopes; and use of scoping models including a three-dimensional geologic framework model, rainfall-runoff model, regional groundwater flow model, and coastal density-dependent groundwater flow model. Results show that most fresh groundwater was recharged during the last glacial period and that the coastal aquifer has had recurring intrusions of fresh and saline water. These intrusions disguise the source, flowpaths, and history of ground water near the coast. The flow system includes a freshwater lens resting on brackish water; a 100-meter-thick flowtube of freshwater discharging under brackish estuarine water and above highly saline water; and broad areas of fine-grained coastal sediment filled with fairly uniform brackish water. Stable isotopes of hydrogen and oxygen indicate the recharged water flows through many kilometers of fractured crystalline rock before entering the narrow coastal aquifer.

  6. Población commuter de la frontera norte: el caso de Mexicali-Calexico y Tijuana-San Diego

    Directory of Open Access Journals (Sweden)

    Germán Vega Briones


    Full Text Available El objetivo central de este trabajo es analizar el perfil sociodemográfico de los trabajadores transfronterizos o commuters de las ciudades de Tijuana-San Diego y Mexicali- Calexico de acuerdo con el sexo y el lugar donde se encuentra el trabajo. Los trabajadores transfronterizos o commuters son los individuos que residen en alguna ciudad de la frontera norte de México, pero cotidianamente cruzan la línea fronteriza para trabajar en la ciudad estadounidense contigua. La información que se utiliza para realizar este estudio es la obtenida por el Censo de Población y Vivienda mexicano del año 2010; sin embargo, el análisis sobre el perfil de los commuters se complementa con información de carácter etnográfico producto de diversas entrevistas realizadas a los trabajadores transfronterizos, principalmente en las ciudades de Tijuana y Mexicali. Consideramos que esta población tiene una imagen individual y cotidiana más completa de la compleja relación que se da en la frontera México-Estados Unidos, dada su característica principal de interacción continua entre ambos lados de la frontera. Ello al mismo tiempo nos permite contar con una visión más profunda de una realidad fronteriza que se basa en la dependencia creada y recreada en las sociedades tanto mexicana como estadounidense.

  7. Education in a Global Age: An Inter-California Strategy for the Tijuana-San Diego Region

    Directory of Open Access Journals (Sweden)

    Olga A. Vásquez


    Full Text Available Este artículo presenta un bosquejo para una estrategia Inter-California que enlazaría las áreas de San Diego y Tijuana como una sola fuerza regional. Esto intenta conceptualizar dos distintas y frecuentemente contradictorias áreas como una sola, haciendo una aproximación a grosso modo de las desiguales condiciones económicas y educativas en ambos lados de la frontera. Se discute la colaboración binacional en el pasado en educación, y se plantean las posibilidades para el futuro de dicha colaboración, ofreciendo recomendaciones y predicciones de las metas que podrían alcanzarse. Llamando a la región Inter-California, el artículotambién argumenta por una identidad global, y específicamente, por una educación que es relevante para la nueva economía, asi como los avances científicos y tecnológicos que están iluminando cada vez más una nueva sociedad global.

  8. Risk profile and HIV testing outcomes of women undergoing community-based testing in San Diego 2008–2014 (United States)

    Graves, Susannah K.; Little, Susan J.; Hoenigl, Martin


    Women comprised 19% of new HIV diagnoses in the United States in 2014, with significant racial and ethnic disparities in infection rates. This cross-sectional analysis of women enrolled in a cohort study compares demographics, risk behaviour, and sexually transmitted infections (STI) in those undergoing HIV testing in San Diego County. Data from the most recent screening visit of women undergoing voluntary HIV screening April 2008 –July 2014 was used. HIV diagnosis, risk behaviour and self-reported STIs were compared among women aged ≤24, 25–49, and ≥50, as well as between HIV-infected and uninfected women and between Hispanic and non-Hispanic women. Among the 2535 women included, Hispanic women were less likely than other women to report unprotected vaginal intercourse (p = 0.026) or stimulant drug use (p = 0.026), and more likely to report one or fewer partners (p awareness of partner risk and appropriate testing. PMID:28165056

  9. Can private land conservation reduce wildfire risk to homes? A case study in San Diego County, California, USA (United States)

    Butsic, Van; Syphard, Alexandra D.; Keeley, Jon E.; Bar-Massada, Avi


    The purchase of private land for conservation purposes is a common way to prevent the exploitation of sensitive ecological areas. However, private land conservation can also provide other benefits, one of these being natural hazard reduction. Here, we investigated the impacts of private land conservation on fire risk to homes in San Diego County, California. We coupled an econometric land use change model with a model that estimates the probability of house loss due to fire in order to compare fire risk at the county and municipality scale under alternative private land purchasing schemes and over a 20 year time horizon. We found that conservation purchases could reduce fire risk on this landscape, and the amount of risk reduction was related to the targeting approach used to choose which parcels were conserved. Conservation land purchases that targeted parcels designated as high fire hazard resulted in lower fire risk to homes than purchases that targeted low costs or high likelihood to subdivide. This result was driven by (1) preventing home placement in fire prone areas and (2) taking land off the market, and hence increasing development densities in other areas. These results raise the possibility that resource conservation and fire hazard reduction may benefit from combining efforts. With adequate planning, future conservation purchases could have synergistic effects beyond just protecting ecologically sensitive areas.

  10. Lack of association of the serotonin transporter polymorphism with the sudden infant death syndrome in the San Diego Dataset. (United States)

    Paterson, David S; Rivera, Keith D; Broadbelt, Kevin G; Trachtenberg, Felicia L; Belliveau, Richard A; Holm, Ingrid A; Haas, Elisabeth A; Stanley, Christina; Krous, Henry F; Kinney, Hannah C; Markianos, Kyriacos


    Dysfunction of medullary serotonin (5-HT)-mediated respiratory and autonomic function is postulated to underlie the pathogenesis of the majority of sudden infant death syndrome (SIDS) cases. Several studies have reported an increased frequency of the LL genotype and L allele of the 5-HT transporter (5-HTT) gene promoter polymorphism (5-HTTLPR), which is associated with increased transcriptional activity and 5-HT transport in vitro, in SIDS cases compared with controls. These findings raise the possibility that this polymorphism contributes to or exacerbates existing medullary 5-HT dysfunction in SIDS. In this study, we tested the hypothesis that the frequency of LL genotype and L allele are higher in 179 SIDS cases compared with 139 controls of multiple ethnicities in the San Diego SIDS Dataset. We observed no significant association of genotype or allele with SIDS cases either in the total cohort or on stratification for ethnicity. These observations do not support previous findings that the L allele and/or LL genotype of the 5-HTTLPR are associated with SIDS.

  11. Adjacent Band Interference from San Diego Area Transmitters to Goldstone Deep Space Network Receivers Near 2300 Megahertz (United States)

    Ho, C.; Bathker, D.; Sue, M.; Peng, T.


    The Federal Communications Commission (FCC) has recently granted a commercial company a license to potentially deploy its wireless Internet system in the San Diego area in the 2300- to 2305-MHz frequency range. Each of several base station emitters would transmit a relatively strong effective isotropic radiated power (EIRP) (about 50 W). The frequency band is immediately above the band (2290 to 2300 MHz) used by NASA Deep Space Network (DSN) receiving stations at Goldstone, California. A potential interference problem to DSN receivers thus exists through some anomalous propagation modes, such as tropospheric ducting and rain scattering, and interference must be kept under a very small percentage of time (0.001 percent), as required by NASA deep-space missions. In this article, we have estimated the effects of interference from the wireless Internet system to Goldstone receivers. The calculation results show that at 2300 MHz the interference received by the DSN could exceed the DSN protection level up to 0.1 percent of the time for ducting propagation. For rain scattering, this could occur up to 2.3 percent of the time. At 2290 MHz, due to the transmitter spectrum, interference through either mode is below the DSN protection level. Interference through terrain diffraction will suffer very large attenuations at both frequencies. After considering that in the middle of the path there is a tall mountain peak that largely blocks the surface ducting and direct illumination of rain clouds, the interference generated by the wireless system emitters and propagated


    Sadler, Ryan A; Lamberski, Nadine; Christopher, Mary M


    Captive waterbuck ( Kobus ellipsiprymnus ) that appear clinically healthy have been noted to have high serum bilirubin concentrations compared with other ruminants; however, questions remain about the physiologic factors affecting bilirubin concentration and its potential association with underlying disease and icteric serum or mucous membranes. Serum bilirubin concentrations of healthy and diseased waterbuck housed at the San Diego Zoo Safari Park from 1989 to 2012 were retrospectively analyzed to determine any link between icteric serum, total bilirubin concentration (tBili), and disease entities in this species. Total bilirubin and direct (dBili) bilirubin concentrations and the prevalence of icteric serum were compared by subspecies, age group, and health status; associations with complete blood count and biochemical results and clinical diagnosis were assessed. No significant differences were found in tBili or dBili between Ellipsen (n = 32) and Defassa (n = 29) subspecies or in juveniles (n = 22) versus adults (n = 39). Clinically healthy waterbuck (n = 40) had significantly higher tBili (mean ± 2SD, 7.9 ± 1.2 mg/dl; P bilirubin (2.2-6.2 mg/dl). These results suggest healthy waterbuck have relatively high tBili and dBili compared with related species. Icteric serum may be seen in up to 15% of healthy animals in the absence of icteric tissues.

  13. Cierre de fronteras, libre comercio y migrantes: el área binacional de San Diego – Tijuana como resultado inesperado

    Directory of Open Access Journals (Sweden)

    Ignacio García Marín


    Full Text Available La presente investigación analiza la aparición de áreas y ciudades binacionales a lo largo de la frontera entre Estados Unidos y México. Es decir, si son fruto de la interacción o bien de la integración. En este sentido, pareciera que este fenómeno ha vivido un incremento constante y progresivo en los últimos tiempos, a pesar de la combinación de medidas represivas ante la migración y su asociación a la inseguridad y el terrorismo. Se sostiene que las áreas binacionales serían un resultado no esperado de la creciente represión a la migración latinoamericana y, por otra, efecto de la difuminación de fronteras para mercancías y capitales entre los miembros del Tratado de Libre Comercio de América del Norte. En este sentido, el estudio de caso de la frontera San Diego – Tijuana no pareciera dibujar un área de convergencia económica, cultural y social a la luz de los datos, aunque sí de creciente interacción económica.

  14. Antibody Engineering & Therapeutics, the annual meeting of The Antibody Society December 7-10, 2015, San Diego, CA, USA. (United States)

    Pauthner, Matthias; Yeung, Jenny; Ullman, Chris; Bakker, Joost; Wurch, Thierry; Reichert, Janice M; Lund-Johansen, Fridtjof; Bradbury, Andrew R M; Carter, Paul J; Melis, Joost P M


    The 26th Antibody Engineering & Therapeutics meeting, the annual meeting of The Antibody Society united over 800 participants from all over the world in San Diego from 6-10 December 2015. The latest innovations and advances in antibody research and development were discussed, covering a myriad of antibody-related topics by more than 100 speakers, who were carefully selected by The Antibody Society. As a prelude, attendees could join the pre-conference training course focusing, among others, on the engineering and enhancement of antibodies and antibody-like scaffolds, bispecific antibody engineering and adaptation to generate chimeric antigen receptor constructs. The main event covered 4 d of scientific sessions that included antibody effector functions, reproducibility of research and diagnostic antibodies, new developments in antibody-drug conjugates (ADCs), preclinical and clinical ADC data, new technologies and applications for bispecific antibodies, antibody therapeutics for non-cancer and orphan indications, antibodies to harness the cellular immune system, building comprehensive IgVH-gene repertoires through discovering, confirming and cataloging new germline IgVH genes, and overcoming resistance to clinical immunotherapy. The Antibody Society's special session focused on "Antibodies to watch" in 2016. Another special session put the spotlight on the limitations of the new definitions for the assignment of antibody international nonproprietary names introduced by the World Health Organization. The convention concluded with workshops on computational antibody design and on the promise and challenges of using next-generation sequencing for antibody discovery and engineering from synthetic and in vivo libraries.

  15. Risk profile and HIV testing outcomes of women undergoing community-based testing in San Diego 2008-2014. (United States)

    Graves, Susannah K; Little, Susan J; Hoenigl, Martin


    Women comprised 19% of new HIV diagnoses in the United States in 2014, with significant racial and ethnic disparities in infection rates. This cross-sectional analysis of women enrolled in a cohort study compares demographics, risk behaviour, and sexually transmitted infections (STI) in those undergoing HIV testing in San Diego County. Data from the most recent screening visit of women undergoing voluntary HIV screening April 2008 -July 2014 was used. HIV diagnosis, risk behaviour and self-reported STIs were compared among women aged ≤24, 25-49, and ≥50, as well as between HIV-infected and uninfected women and between Hispanic and non-Hispanic women. Among the 2535 women included, Hispanic women were less likely than other women to report unprotected vaginal intercourse (p = 0.026) or stimulant drug use (p = 0.026), and more likely to report one or fewer partners (p < 0.0001), but also more likely to report sex with an HIV-infected individual (p = 0.027). New HIV infection was significantly more prevalent among Hispanic women (1.6% vs. 0.2%; p < 0.001). Hispanic women were more likely than other women to be diagnosed with HIV despite significantly lower rates of risk behaviour. Culturally specific risk reduction interventions for Hispanic women should focus on awareness of partner risk and appropriate testing.

  16. The Korean Version of the University of California San Diego Performance-based Skills Assessment: Reliability and Validity. (United States)

    Kim, Sung-Jin; Kim, Jung-Min; Shim, Joo-Cheol; Seo, Beom-Joo; Jung, Sung-Soo; Ryu, Jeoung-Whan; Seo, Young-Soo; Lee, Yu-Cheol; Moon, Jung-Joon; Jeon, Dong-Wook; Park, Kyoung-Duck; Jung, Do-Un


    The study's aim was to develop and standardize a Korean version of the University of California San Diego Performance-based Skills Assessment (K-UPSA), which is used to evaluate the daily living function of patients with schizophrenia. Study participants were 78 patients with schizophrenia and 27 demographically matched healthy controls. We evaluated the clinical states and cognitive functions to verify K-UPSA's reliability and validity. For clinical states, the Positive and Negative Syndrome Scale, Clinical Global Impression-Schizophrenia scale, and Social and Occupational Functioning Assessment Scale and Schizophrenia Quality of Life Scale-fourth revision were used. The Schizophrenia Cognition Rating Scale, Short-form of Korean-Wechsler Adult Intelligence Scale, and Wisconsin Card Sorting Test were used to assess cognitive function. The K-UPSA had statistically significant reliability and validity. The K-UPSA has high internal consistency (Cronbach's alpha, 0.837) and test-retest reliability (intra-class correlation coefficient, 0.381-0.792; p<0.001). The K-UPSA had significant discriminant validity (p<0.001). Significant correlations between the K-UPSA's scores and most of the scales and tests listed above demonstrated K-UPSA's concurrent validity (p<0.001). The K-UPSA is useful to evaluate the daily living function in Korean patients with schizophrenia.

  17. Lack of Association of the Serotonin Transporter Polymorphism With the Sudden Infant Death Syndrome in the San Diego Dataset (United States)

    Paterson, David S.; Rivera, Keith D.; Broadbelt, Kevin G.; Trachtenberg, Felicia L.; Belliveau, Richard A.; Holm, Ingrid A.; Haas, Elisabeth A.; Stanley, Christina; Krous, Henry F.; Kinney, Hannah C.; Markianos, Kyriacos


    Dysfunction of medullary serotonin (5-HT)-mediated respiratory and autonomic function is postulated to underlie the pathogenesis of the majority of sudden infant death syndrome (SIDS) cases. Several studies have reported an increased frequency of the LL genotype and L allele of the 5-HT transporter (5-HTT) gene promoter polymorphism (5-HTTLPR), which is associated with increased transcriptional activity and 5-HT transport in vitro, in SIDS cases compared with controls. These findings raise the possibility that this polymorphism contributes to or exacerbates existing medullary 5-HT dysfunction in SIDS. In this study, we tested the hypothesis that the frequency of LL genotype and L allele are higher in 179 SIDS cases compared with 139 controls of multiple ethnicities in the San Diego SIDS Dataset. We observed no significant association of genotype or allele with SIDS cases either in the total cohort or on stratification for ethnicity. These observations do not support previous findings that the L allele and/or LL genotype of the 5-HTTLPR are associated with SIDS. PMID:20661167

  18. Implementation of a food insecurity screening and referral program in student-run free clinics in San Diego, California. (United States)

    Smith, Sunny; Malinak, David; Chang, Jinnie; Perez, Maria; Perez, Sandra; Settlecowski, Erica; Rodriggs, Timothy; Hsu, Ming; Abrew, Alexandra; Aedo, Sofia


    Food insecurity is associated with many poor health outcomes yet is not routinely addressed in clinical settings. The purpose of this study was to implement a food insecurity screening and referral program in Student-run Free Clinics (SRFC) and to document the prevalence of food insecurity screening in this low-income patient population. All patients seen in three SRFC sites affiliated with one institution in San Diego, California were screened for food insecurity using the 6-item United States Department of Agriculture (USDA) Food Security Survey between January and July 2015 and referred to appropriate resources. The percentage of patients who were food insecure was calculated. The screening rate was 92.5% (430/463 patients), 74.0% (318/430) were food insecure, including 30.7% (132/430) with very low food security. A food insecurity registry and referral tracking system revealed that by January 2016, 201 participants were receiving monthly boxes of food onsite, 66 used an off-site food pantry, and 64 were enrolled in the Supplemental Nutrition Assistance Program (SNAP). It is possible to implement a food insecurity screening and referral program into SRFCs. The prevalence of food insecurity in this population was remarkably high yet remained largely unknown until this program was implemented. Other health care settings, particularly those with underserved patient populations, should consider implementing food insecurity screening and referral programs.

  19. Sexuality and HIV Education in Charter Schools: An Exploratory Study With Principals in San Diego County, California. (United States)

    Walsh-Buhi, Eric R; Dao, Brandon; Salgin, Linda; Marshall, James; Miller, Rachel; Fisher, Doug; Walsh-Buhi, Margaret


    Schools can address critical sexual and reproductive health (SRH) issues among youth. However, little is known about SRH education being implemented in charter schools. Thus, our purpose was to explore implementation of SRH education in charter schools. Using purposive sampling, semistructured telephone interviews were conducted with 20 charter school principals in San Diego County, California. Questions were guided by the Kaiser Family Foundation National Survey of Public Secondary School Principals. Analyses followed a case-oriented approach, examining aspects within each case (ie, a principal), and then a comparative analysis of a small number of cases (ie, all principals). Overall, 17 principals acknowledged offering sexuality education in the previous 2 years. Over half of these schools had provided content on: sexually transmitted diseases/human immunodeficiency virus/acquired immune deficiency syndrome (STDs/HIV/AIDS), reproduction/pregnancy/birth, pregnancy prevention methods, delaying sex, and managing sexual pressure. Condom use, sexual assault, sexual orientation, talking with partners about STD/pregnancy prevention, talking with parents about relationships/sex, and using/where to get contraception were less commonly taught. Abortion was not addressed. When asked the grade they would assign to their schools' sexuality/HIV instruction, principals assigned 1 A, 7 Bs, 7 Cs, and 1 D. Consistency between our findings and what has been reported elsewhere varies. As charter schools often have greater curricular flexibility than traditional schools, this study provides unique preliminary data to inform future innovative, or strengthen existing, SRH programming. © 2017, American School Health Association.

  20. Emergency Assessment of Debris-Flow Hazards from Basins Burned by the 2007 Poomacha Fire, San Diego County, Southern California (United States)

    Cannon, Susan H.; Gartner, Joseph E.; Michael, John A.; Bauer, Mark A.; Stitt, Susan C.; Knifong, Donna L.; McNamara, Bernard J.; Roque, Yvonne M.


    INTRODUCTION The objective of this report is to present a preliminary emergency assessment of the potential for debris-flow generation from basins burned by the Poomacha Fire in San Diego County, southern California in 2007. Debris flows are among the most hazardous geologic phenomena; debris flows that followed wildfires in southern California in 2003 killed 16 people and caused tens of millions of dollars of property damage. A short period of even moderate rainfall on a burned watershed can lead to debris flows. Rainfall that is normally absorbed into hillslope soils can run off almost instantly after vegetation has been removed by wildfire. This causes much greater and more rapid runoff than is normal from creeks and drainage areas. Highly erodible soils in a burn scar allow flood waters to entrain large amounts of ash, mud, boulders, and unburned vegetation. Within the burned area and downstream, the force of rushing water, soil, and rock can destroy culverts, bridges, roadways, and buildings, potentially causing injury or death. This emergency debris-flow hazard assessment is presented as relative ranking of the predicted median volume of debris flows that can issue from basin outlets in response to 2.25 inches (57.15 mm) of rainfall over a 3-hour period. Such a storm has a 10-year return period. The calculation of debris flow volume is based on a multiple-regression statistical model that describes the median volume of material that can be expected from a recently burned basin as a function of the area burned at high and moderate severity, the basin area with slopes greater than or equal to 30 percent, and triggering storm rainfall. Cannon and others (2007) describe the methods used to generate the hazard maps. Identification of potential debris-flow hazards from burned drainage basins is necessary to issue warnings for specific basins, to make effective mitigation decisions, and to help plan evacuation timing and routes.

  1. Emergency assessment of debris-flow hazards from basins burned by the 2007 Harris Fire, San Diego County, southern California (United States)

    Cannon, Susan H.; Gartner, Joseph E.; Michael, John A.; Bauer, Mark A.; Stitt, Susan C.; Knifong, Donna L.; McNamara, Bernard J.; Roque, Yvonne M.


    IntroductionThe objective of this report is to present a preliminary emergency assessment of the potential for debris-flow generation from basins burned by the Harris Fire in San Diego County, southern California in 2007. Debris flows are among the most hazardous geologic phenomena; debris flows that followed wildfires in southern California in 2003 killed 16 people and caused tens of millions of dollars of property damage. A short period of even moderate rainfall on a burned watershed can lead to debris flows. Rainfall that is normally absorbed into hillslope soils can run off almost instantly after vegetation has been removed by wildfire. This causes much greater and more rapid runoff than is normal from creeks and drainage areas. Highly erodible soils in a burn scar allow flood waters to entrain large amounts of ash, mud, boulders, and unburned vegetation. Within the burned area and downstream, the force of rushing water, soil, and rock can destroy culverts, bridges, roadways, and buildings, potentially causing injury or death. This emergency debris-flow hazard assessment is presented as relative ranking of the predicted median volume of debris flows that can issue from basin outlets in response to 1.75 inches (44.45 mm) of rainfall over a 3-hour period. Such a storm has a 10-year return period. The calculation of debris flow volume is based on a multiple-regression statistical model that describes the median volume of material that can be expected from a recently burned basin as a function of the area burned at high and moderate severity, the basin area with slopes greater than or equal to 30 percent, and triggering storm rainfall. Cannon and others (2007) describe the methods used to generate the hazard maps. Identification of potential debris-flow hazards from burned drainage basins is necessary to issue warnings for specific basins, to make effective mitigation decisions, and to help plan evacuation timing and routes.

  2. Emergency Assessment of Debris-Flow Hazards from Basins Burned by the 2007 Witch Fire, San Diego County, Southern California (United States)

    Cannon, Susan H.; Gartner, Joseph E.; Michael, John A.; Bauer, Mark A.; Stitt, Susan C.; Knifong, Donna L.; McNamara, Bernard J.; Roque, Yvonne M.


    INTRODUCTION The objective of this report is to present a preliminary emergency assessment of the potential for debris-flow generation from basins burned by the Witch Fire in San Diego County, southern California in 2007. Debris flows are among the most hazardous geologic phenomena; debris flows that followed wildfires in southern California in 2003 killed 16 people and caused tens of millions of dollars of property damage. A short period of even moderate rainfall on a burned watershed can lead to debris flows. Rainfall that is normally absorbed into hillslope soils can run off almost instantly after vegetation has been removed by wildfire. This causes much greater and more rapid runoff than is normal from creeks and drainage areas. Highly erodible soils in a burn scar allow flood waters to entrain large amounts of ash, mud, boulders, and unburned vegetation. Within the burned area and downstream, the force of rushing water, soil, and rock can destroy culverts, bridges, roadways, and buildings, potentially causing injury or death. This emergency debris-flow hazard assessment is presented as relative ranking of the predicted median volume of debris flows that can issue from basin outlets in response to 2.25 inches (57.15 mm) of rainfall over a 3-hour period. Such a storm has a 10-year return period. The calculation of debris flow volume is based on a multiple-regression statistical model that describes the median volume of material that can be expected from a recently burned basin as a function of the area burned at high and moderate severity, the basin area with slopes greater than or equal to 30 percent, and triggering storm rainfall. Cannon and others (2007) describe the methods used to generate the hazard maps. Identification of potential debris-flow hazards from burned drainage basins is necessary to issue warnings for specific basins, to make effective mitigation decisions, and to help plan evacuation timing and routes.

  3. Emergency Assessment of Debris-Flow Hazards from Basins Burned by the 2007 Rice Fire, San Diego County, Southern California (United States)

    Cannon, Susan H.; Gartner, Joseph E.; Michael, John A.; Bauer, Mark A.; Stitt, Susan C.; Knifong, Donna L.; McNamara, Bernard J.; Roque, Yvonne M.


    INTRODUCTION The objective of this report is to present a preliminary emergency assessment of the potential for debris-flow generation from basins burned by the Rice Fire in San Diego County, southern California in 2007. Debris flows are among the most hazardous geologic phenomena; debris flows that followed wildfires in southern California in 2003 killed 16 people and caused tens of millions of dollars of property damage. A short period of even moderate rainfall on a burned watershed can lead to debris flows. Rainfall that is normally absorbed into hillslope soils can run off almost instantly after vegetation has been removed by wildfire. This causes much greater and more rapid runoff than is normal from creeks and drainage areas. Highly erodible soils in a burn scar allow flood waters to entrain large amounts of ash, mud, boulders, and unburned vegetation. Within the burned area and downstream, the force of rushing water, soil, and rock can destroy culverts, bridges, roadways, and buildings, potentially causing injury or death. This emergency debris-flow hazard assessment is presented as relative ranking of the predicted median volume of debris flows that can issue from basin outlets in response to 1.75 inches (44.45 mm) of rainfall over a 3-hour period. Such a storm has a 10-year return period. The calculation of debris flow volume is based on a multiple-regression statistical model that describes the median volume of material that can be expected from a recently burned basin as a function of the area burned at high and moderate severity, the basin area with slopes greater than or equal to 30 percent, and triggering storm rainfall. Cannon and others (2007) describe the methods used to generate the hazard maps. Identification of potential debris-flow hazards from burned drainage basins is necessary to issue warnings for specific basins, to make effective mitigation decisions, and to help plan evacuation timing and routes.

  4. Emergency Assessment of Debris-Flow Hazards from Basins Burned by the 2007 Ammo Fire, San Diego County, Southern California (United States)

    Cannon, Susan H.; Gartner, Joseph E.; Michael, John A.; Bauer, Mark A.; Stitt, Susan C.; Knifong, Donna L.; McNamara, Bernard J.; Roque, Yvonne M.


    INTRODUCTION The objective of this report is to present a preliminary emergency assessment of the potential for debris-flow generation from basins burned by the Ammo Fire in San Diego County, southern California in 2007. Debris flows are among the most hazardous geologic phenomena; debris flows that followed wildfires in southern California in 2003 killed 16 people and caused tens of millions of dollars of property damage. A short period of even moderate rainfall on a burned watershed can lead to debris flows. Rainfall that is normally absorbed into hillslope soils can run off almost instantly after vegetation has been removed by wildfire. This causes much greater and more rapid runoff than is normal from creeks and drainage areas. Highly erodible soils in a burn scar allow flood waters to entrain large amounts of ash, mud, boulders, and unburned vegetation. Within the burned area and downstream, the force of rushing water, soil, and rock can destroy culverts, bridges, roadways, and buildings, potentially causing injury or death. This emergency debris-flow hazard assessment is presented as relative ranking of the predicted median volume of debris flows that can issue from basin outlets in response to 1.75 inches (44.45 mm) of rainfall over a 3-hour period. Such a storm has a 10-year return period. The calculation of debris flow volume is based on a multiple-regression statistical model that describes the median volume of material that can be expected from a recently burned basin as a function of the area burned at high and moderate severity, the basin area with slopes greater than or equal to 30 percent, and triggering storm rainfall. Cannon and others (2007) describe the methods used to generate the hazard maps. Identification of potential debris-flow hazards from burned drainage basins is necessary to issue warnings for specific basins, to make effective mitigation decisions, and to help plan evacuation timing and routes.

  5. Antibody engineering & therapeutics, the annual meeting of the antibody society December 7–10, 2015, San Diego, CA, USA (United States)

    Pauthner, Matthias; Yeung, Jenny; Ullman, Chris; Bakker, Joost; Wurch, Thierry; Reichert, Janice M.; Lund-Johansen, Fridtjof; Bradbury, Andrew R.M.; Carter, Paul J.; Melis, Joost P.M.


    ABSTRACT The 26th Antibody Engineering & Therapeutics meeting, the annual meeting of The Antibody Society united over 800 participants from all over the world in San Diego from 6–10 December 2015. The latest innovations and advances in antibody research and development were discussed, covering a myriad of antibody-related topics by more than 100 speakers, who were carefully selected by The Antibody Society. As a prelude, attendees could join the pre-conference training course focusing, among others, on the engineering and enhancement of antibodies and antibody-like scaffolds, bispecific antibody engineering and adaptation to generate chimeric antigen receptor constructs. The main event covered 4 d of scientific sessions that included antibody effector functions, reproducibility of research and diagnostic antibodies, new developments in antibody-drug conjugates (ADCs), preclinical and clinical ADC data, new technologies and applications for bispecific antibodies, antibody therapeutics for non-cancer and orphan indications, antibodies to harness the cellular immune system, building comprehensive IgVH-gene repertoires through discovering, confirming and cataloging new germline IgVH genes, and overcoming resistance to clinical immunotherapy. The Antibody Society's special session focused on “Antibodies to watch” in 2016. Another special session put the spotlight on the limitations of the new definitions for the assignment of antibody international nonproprietary names introduced by the World Health Organization. The convention concluded with workshops on computational antibody design and on the promise and challenges of using next-generation sequencing for antibody discovery and engineering from synthetic and in vivo libraries. PMID:26909869

  6. Antibody Engineering & Therapeutics 2016: The Antibody Society's annual meeting, December 11-15, 2016, San Diego, CA. (United States)

    Larrick, James W; Alfenito, Mark R; Scott, Jamie K; Parren, Paul W H I; Burton, Dennis R; Bradbury, Andrew R M; Lemere, Cynthia A; Messer, Anne; Huston, James S; Carter, Paul J; Veldman, Trudi; Chester, Kerry A; Schuurman, Janine; Adams, Gregory P; Reichert, Janice M

    Antibody Engineering & Therapeutics, the largest meeting devoted to antibody science and technology and the annual meeting of The Antibody Society, will be held in San Diego, CA on December 11-15, 2016. Each of 14 sessions will include six presentations by leading industry and academic experts. In this meeting preview, the session chairs discuss the relevance of their topics to current and future antibody therapeutics development. Session topics include bispecifics and designer polyclonal antibodies; antibodies for neurodegenerative diseases; the interface between passive and active immunotherapy; antibodies for non-cancer indications; novel antibody display, selection and screening technologies; novel checkpoint modulators / immuno-oncology; engineering antibodies for T-cell therapy; novel engineering strategies to enhance antibody functions; and the biological Impact of Fc receptor engagement. The meeting will open with keynote speakers Dennis R. Burton (The Scripps Research Institute), who will review progress toward a neutralizing antibody-based HIV vaccine; Olivera J. Finn, (University of Pittsburgh School of Medicine), who will discuss prophylactic cancer vaccines as a source of therapeutic antibodies; and Paul Richardson (Dana-Farber Cancer Institute), who will provide a clinical update on daratumumab for multiple myeloma. In a featured presentation, a representative of the World Health Organization's INN expert group will provide a perspective on antibody naming. "Antibodies to watch in 2017" and progress on The Antibody Society's 2016 initiatives will be presented during the Society's special session. In addition, two pre-conference workshops covering ways to accelerate antibody drugs to the clinic and the applications of next-generation sequencing in antibody discovery and engineering will be held on Sunday December 11, 2016.

  7. Endosymbiont interference and microbial diversity of the Pacific coast tick, Dermacentor occidentalis, in San Diego County, California. (United States)

    Gurfield, Nikos; Grewal, Saran; Cua, Lynnie S; Torres, Pedro J; Kelley, Scott T


    The Pacific coast tick, Dermacentor occidentalis Marx, is found throughout California and can harbor agents that cause human diseases such as anaplasmosis, ehrlichiosis, tularemia, Rocky Mountain spotted fever and rickettsiosis 364D. Previous studies have demonstrated that nonpathogenic endosymbiotic bacteria can interfere with Rickettsia co-infections in other tick species. We hypothesized that within D. occidentalis ticks, interference may exist between different nonpathogenic endosymbiotic or nonendosymbiotic bacteria and Spotted Fever group Rickettsia (SFGR). Using PCR amplification and sequencing of the rompA gene and intergenic region we identified a cohort of SFGR-infected and non-infected D. occidentalis ticks collected from San Diego County. We then amplified a partial segment of the 16S rRNA gene and used next-generation sequencing to elucidate the microbiomes and levels of co-infection in the ticks. The SFGR R. philipii str. 364D and R. rhipicephali were detected in 2.3% and 8.2% of the ticks, respectively, via rompA sequencing. Interestingly, next generation sequencing revealed an inverse relationship between the number of Francisella-like endosymbiont (FLE) 16S rRNA sequences and Rickettsia 16S rRNA sequences within individual ticks that is consistent with partial interference between FLE and SFGR infecting ticks. After excluding the Rickettsia and FLE endosymbionts from the analysis, there was a small but significant difference in microbial community diversity and a pattern of geographic isolation by distance between collection locales. In addition, male ticks had a greater diversity of bacteria than female ticks and ticks that weren't infected with SFGR had similar microbiomes to canine skin microbiomes. Although experimental studies are required for confirmation, our findings are consistent with the hypothesis that FLEs and, to a lesser extent, other bacteria, interfere with the ability of D. occidentalis to be infected with certain SFGR. The

  8. Youth Advocacy as a Tool for Environmental and Policy Changes That Support Physical Activity and Nutrition: An Evaluation Study in San Diego County (United States)

    Edwards, Christine C.; Woodruff, Susan I.; Millstein, Rachel A.; Moder, Cheryl


    Background As evidence grows about the benefits of policy and environmental changes to support active living and healthy eating, effective tools for implementing change must be developed. Youth advocacy, a successful strategy in the field of tobacco control, should be evaluated for its potential in the field of obesity prevention. Community Context San Diego State University collaborated with the San Diego County Childhood Obesity Initiative to evaluate Youth Engagement and Action for Health! (YEAH!), a youth advocacy project to engage youth and adult mentors in advocating for neighborhood improvements in physical activity and healthy eating opportunities. Study objectives included documenting group process and success of groups in engaging in community advocacy with decision makers. Methods In 2011 and 2012, YEAH! group leaders were recruited from the San Diego County Childhood Obesity Initiative’s half-day train-the-trainer seminars for adult leaders. Evaluators collected baseline and postproject survey data from youth participants and adult group leaders and interviewed decision makers. Outcomes Of the 21 groups formed, 20 completed the evaluation, conducted community assessments, and advocated with decision makers. Various types of decision makers were engaged, including school principals, food service personnel, city council members, and parks and recreation officials. Eleven groups reported change(s) implemented as a result of their advocacy, 4 groups reported changes pending, and 5 groups reported no change as a result of their efforts. Interpretation Even a brief training session, paired with a practical manual, technical assistance, and commitment of adult leaders and youth may successfully engage decision makers and, ultimately, bring about change. PMID:24674636

  9. Identification of early HIV infections using the fourth generation Abbott ARCHITECT HIV Ag/Ab Combo chemiluminescent microparticle immunoassay (CIA) in San Diego County. (United States)

    Manlutac, Anna Liza M; Giesick, Jill S; McVay, Patricia A


    HIV screening assays have gone through several generations of development in an effort to narrow the "window period" of detection. Utilizing a fourth generation HIV screening assay has the potential to detect earlier HIV infection, thus reducing HIV-1 transmission. To identify acute infections to decrease HIV transmission in San Diego County. Serum specimens were collected from clients seen by multiple submitters in San Diego County. All acceptable specimens were screened using the 4th Gen Combo Assay. Initially reactive specimens were repeated in duplicate and if repeatedly reactive, were confirmed by HIV-1 Immunofluorescent Antibody Assay (IFA). IFA negative/inconclusive specimens were sent for HIV-1 NAT and HIV-2 antibody testing to referral laboratories. BioRad Multispot HIV-1/HIV-2 Rapid Test was also performed on a subset of specimens. Of 14,559 specimens received in 20 months, 14,517 specimens were tested. Of the 14,517 specimens that were tested, a total of 279 (1.9%) specimens were CIA repeatedly reactive and 240 of the 279 confirmed by HIV-1 IFA. Thirty-nine gave IFA negative/inconclusive result and 30 were further tested for HIV-1 NAT and 36 for HIV-2 antibody. Thirteen specimens were considered false positives by CIA and 17 specimens were classified as acute infections. Eleven of 39 IFA negative/inconclusive specimens were further tested by Multispot. Five of the 11 were positive by Multispot. The fourth generation Abbott ARCHITECT HIV Ag/Ab Combo Assay identified 17 patients who may have been missed by the prior HIV-1 screening assay used at San Diego County Public Health Laboratory. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. Integrating with users is one thing, but living with them? A case study on loss of space from the Medical Center Library, University of California, San Diego. (United States)

    Haynes, Craig


    The University of California, San Diego (UCSD) Medical Center is the primary hospital for the UCSD School of Medicine. The UCSD Medical Center Library (MCL), a branch of the campus's biomedical library, is located on the medical center campus. In 2007, the medical center administration made a request to MCL for space in its facility to relocate pharmacy administration from the hospital tower. The university librarian brought together a team of library managers to deliberate and develop a proposal, which ultimately accommodated the medical center's request and enhanced some of MCL's public services.

  11. What influences Latino grocery shopping behavior? Perspectives on the small food store environment from managers and employees in San Diego, California. (United States)

    Sanchez-Flack, Jennifer C; Baquero, Barbara; Linnan, Laura A; Gittelsohn, Joel; Pickrel, Julie L; Ayala, Guadalupe X


    To inform the design of a multilevel in-store intervention, this qualitative study utilized in-depth semistructured interviews with 28 managers and 10 employees of small-to-medium-sized Latino food stores (tiendas) in San Diego, California, to identify factors within the tienda that may influence Latino customers' grocery-shopping experiences and behaviors. Qualitative data analysis, guided by grounded theory, was performed using open coding. Results suggest that future interventions should focus on the physical (i.e., built structures) and social (i.e., economic and sociocultural) dimensions of store environments, including areas where the two dimensions interact, to promote the purchase of healthy food among customers.

  12. Pandemic (H1N1) 2009 Surveillance in Marginalized Populations, Tijuana, Mexico, and West Nile Virus Knowledge among Hispanics, San Diego, California, 2006

    Centers for Disease Control (CDC) Podcasts


    This podcast describes public health surveillance and communication in hard to reach populations in Tijuana, Mexico, and San Diego County, California. Dr. Marian McDonald, Associate Director of CDC's Health Disparities in the National Center for Emerging and Zoonotic Infectious Diseases, discusses the importance of being flexible in determining the most effective media for health communications.  Created: 8/10/2010 by National Center for Emerging and Zoonotic Infectious Diseases, National Center for Immunization and Respiratory Diseases.   Date Released: 8/10/2010.

  13. National Weather Service, Emergency Medical Services, Scripps Institution of Oceanography/UCSD and California EPA Collaboration on Heat Health Impact and Public Notification for San Diego County (United States)

    Tardy, A. O.; Corcus, I.; Guirguis, K.


    The National Weather Service (NWS) has issued official heat alerts in the form of either a heat advisory or excessive heat warning product to the public and core partners for many years. This information has traditionally been developed through the use of triggers for heat indices which combine humidity and temperature. The criteria typically used numeric thresholds and did not consider impact from a particular heat episode, nor did it factor seasonality or population acclimation. In 2013, the Scripps Institution of Oceanography, University of California, San Diego in collaboration with the Office of Environmental Health Hazard Assessment, of the California Environmental Protection Agency and the NWS completed a study of heat health impact in California, while the NWS San Diego office began modifying their criteria towards departure from climatological normal with much less dependence on humidity or heat index. The NWS changes were based on initial findings from the California Department of Public Health, EpiCenter California Injury Data Online system which documents heat health impacts. Results from the UCSD study were finalized and published in 2014; they supported the need for significant modification of the traditional criteria. In order to better understand the impacts of heat on community health, medical outcome data were provided by the County of San Diego Emergency Medical Services Branch, which is charged by the County's Public Health Officer to monitor heat-related illness and injury daily from June through September. The data were combined with UCSD research to inform the modification of local NWS heat criteria and establish trigger points to pilot new procedures for the issuance of heat alerts. Finally, practices and procedures were customized for each of the county health departments in the NWS area of responsibility across extreme southwest California counties in collaboration with their Office of Emergency Services. The end result of the

  14. Prevalence and Treatment of Latent Tuberculosis Infection Among Newly Arrived Refugees in San Diego County, January 2010–October 2012 (United States)

    Bennett, Rachel J.; Brodine, Stephanie; Waalen, Jill; Moser, Kathleen; Rodwell, Timothy C.


    Objectives. We determined the prevalence and treatment rates of latent tuberculosis infection (LTBI) in newly arrived refugees in San Diego County, California, and assessed demographic and clinical characteristics associated with these outcomes. Methods. We analyzed data from LTBI screening results of 4280 refugees resettled in San Diego County between January 2010 and October 2012. Using multivariate logistic regression, we calculated the associations between demographic and clinical risk factors and the outcomes of LTBI diagnosis and LTBI treatment initiation. Results. The prevalence of LTBI was highest among refugees from sub-Saharan Africa (43%) and was associated with current smoking and having a clinical comorbidity that increases the risk for active tuberculosis. Although refugees from sub-Saharan Africa had the highest prevalence of infection, they were significantly less likely to initiate treatment than refugees from the Middle East. Refugees with postsecondary education were significantly more likely to initiate LTBI treatment. Conclusions. Public health strategies are needed to increase treatment rates among high-risk refugees with LTBI. Particular attention is required among refugees from sub-Saharan Africa and those with less education. PMID:24524534

  15. Twelve-year proximity relationships in a captive group of western lowland gorillas (Gorilla gorilla gorilla) at the San Diego Wild Animal Park, California, USA. (United States)

    Nakamichi, Masayuki; Onishi, Kenji; Silldorf, April; Sexton, Peggy


    Proximity data were collected in a captive breeding group of gorillas (Gorilla gorilla gorilla) at the San Diego Wild Animal Park (currently called the San Diego Zoo Safari Park) twice a year (spring and fall periods) for over 12 years, by using a convenient method in which individuals less than 5 m from each animal in the group were recorded by scan sampling, approximately once per hour. Immature females from infancy to young adulthood maintained relatively frequent proximity to both their mothers and the silverback male and spent little time alone (no animals within 10 m), with relatively large individual differences. On the other hand, immature males decreased the time spent near their mothers and the silverback male and increased the time spent alone with increasing age. Therefore, sex differences in proximity to mothers and the silverback male became apparent after late juvenility. Some adult females maintained increased frequency of proximity to the silverback male than that by other females over the 12-year period, indicating the presence of long-term, stable proximity relationships between the silverback male and the adult females. Such long-term, stable proximity relationships were also observed among adult females. Some association patterns reported in wild gorillas, such as frequent proximity between adult females with dependent offspring and the silverback male and close relationships between related females, were not observed in the present study. The idiosyncratic or individual factors influencing some association patterns were easily reflected in captive situations.

  16. Non-invasive genetic sampling of Southern Mule Deer (Odocoileus hemionus fuliginatus) reveals limited movement across California State Route 67 in San Diego County (United States)

    Mitelberg, Anna; Vandergast, Amy


    —The Southern Mule Deer is a mobile but non-migratory large mammal found throughout southern California and is a covered species in the San Diego Multi-Species Conservation Plan. We assessed deer movement and population connectivity across California State Route 67 and two smaller roads in eastern San Diego County using non-invasive genetic sampling. We collected deer scat pellets between April and November 2015, and genotyped pellets at 15 microsatellites and a sex determination marker. We successfully genotyped 71 unique individuals from throughout the study area and detected nine recapture events. Recaptures were generally found close to original capture locations (within 1.5 km). We did not detect recaptures across roads; however, pedigree analysis detected 21 first order relative pairs, of which approximately 20% were found across State Route 67. Exact tests comparing allele frequencies between groups of individuals in pre-defined geographic clusters detected significant genetic differentiation across State Route 67. In contrast, the assignment-based algorithm of STRUCTURE supported a single genetic cluster across the study area. Our data suggest that State Route 67 may reduce, but does not preclude, movement and gene flow of Southern Mule Deer.

  17. The Economically Active Population in Tijuana and that of Mexican Origin in San Diego from 1970 to 2010

    Directory of Open Access Journals (Sweden)

    Carolina Pineda Chávez


    Full Text Available tijuana y s an Diego forman una frontera de intensa dinámica demográf ica y socioeconó - mica, con población de origen mexicano creciente en s an Diego generada por oportunidades de empleo en esta ciudad. l as economías en interrelación modif ican la población y las ra - mas de trabajo. s e analiza el contexto económico de 1970 a 2010, incluyendo el Programa de industria lización Fronteriza, la ley s impson- rodino, el t ratado de l ibre c omercio de a mérica del n orte y la crisis de 2008. e n t ijuana predomina la industria de transformación, mientras que en s an Diego los servicios y el comercio requieren trabajadores de origen mexicano, que ahora incrementan su participación en servicios profesionales.

  18. Possible Connections Between the Coronado Bank Fault Zone and the Newport-Inglewood, Rose Canyon, and Palos Verdes Fault Zones Offshore San Diego County, California. (United States)

    Sliter, R. W.; Ryan, H. F.


    High-resolution multichannel seismic-reflection and deep-tow Huntec data collected by the USGS were interpreted to map the Coronado Bank fault zone (CBFZ) offshore San Diego County, California. The CBFZ is comprised of several major strands (eastern, central, western) that change in both orientation and degree of deformation along strike. Between Coronado Bank and San Diego, the CBFZ trends N25W and occupies a narrow 7 km zone. Immediately north of La Jolla submarine canyon (LJSC), the easternmost strand changes orientation to almost due north and appears to be offset in a right-lateral sense across the canyon axis. The strand merges with a prominent fault that follows the base of the continental slope in about 600 m water depth. The central portion of the CBFZ is mapped as a negative flower structure and deforms seafloor sediment as far north as 15 km north of LJSC. Farther north, this structure is buried by more than 400 m of basin sediment. Along the eastern edge of the Coronado Bank, the western portion of the CBFZ is characterized by high angle normal faults that dip to the east. North of the Coronado Bank, the western segment follows the western edge of a basement high; it cuts through horizontal basin reflectors and in places deforms the seafloor. We mapped an additional splay of the CBFZ that trends N40W; it is only observed north and west of LJSC. Although the predominant trend of the CBFZ is about N40W, along strike deviations from this orientation of some of the strands indicate that these strands connect with other offshore fault zones in the area. Based on the limited data available, the trend of the CBFZ south of Coronado Bank suggests that it might connect with the Rose Canyon fault zone (RCFZ) that has been mapped in San Diego Bay. North of Coronado Bank, the CBFZ is a much broader fault zone (about 25 km wide) composed of diverging fault strands. The westernmost strand may merge with the western strand of the Palos Verdes fault zone (PVFZ) south of

  19. Cross-border injection drug use and HIV and hepatitis C virus seropositivity among people who inject drugs in San Diego, California. (United States)

    Horyniak, Danielle; Wagner, Karla D; Armenta, Richard F; Cuevas-Mota, Jazmine; Hendrickson, Erik; Garfein, Richard S


    The prevalence of HIV and Hepatitis C Virus (HCV) are significantly lower among people who inject drugs (PWID) in San Diego, CA, USA compared with PWID in Tijuana, Mexico, located directly across the border. We investigated associations between cross-border injection drug use (IDU), HIV and HCV seroprevalence and engagement in injecting risk behaviours while on each side of the border. Using baseline interviews and serologic testing data from STAHR II, a longitudinal cohort study of PWID in San Diego, bivariate and multivariable logistic regression analyses examined associations between recent (past six months) cross-border IDU and HIV and HCV antibody seropositivity, socio-demographics, drug use characteristics, and participants' connections to, and perceptions about Mexico. Chi-squared tests and McNemar tests examined associations between cross-border IDU and injecting risk behaviours. Of the 567 participants (93% U.S.-born, 73% male, median age 45 years), 86 (15%) reported recent cross-border IDU. Cross-border IDU was not associated with HIV (OR: 0.85, 95% CI: 0.37-1.95) or HCV seropositivity (OR: 1.01, 95% CI: 0.62-1.65). Age, identifying as Hispanic or Latino/a, and being concerned about risk of violence when travelling to Mexico were independently associated with decreased odds of recent cross-border IDU. Injecting cocaine at least weekly, having ever lived in Mexico and knowing PWID who reside in Mexico were associated with increased odds of recent cross-border IDU. PWID who reported cross-border IDU were significantly less likely to engage in receptive needle sharing, equipment sharing, and public injection while in Mexico compared with in San Diego (all p<0.001). Prevalence of HIV and HCV infection was similar among PWID who had and had not injected in Mexico, possibly due to practising safer injecting while in Mexico. Research is needed to elucidate contextual factors enabling U.S. PWID to inject safely while in Mexico. Copyright © 2017 Elsevier B.V. All

  20. Water- and air-quality and surficial bed-sediment monitoring of the Sweetwater Reservoir watershed, San Diego County, California, 2003-09 (United States)

    Mendez, Gregory O.; Majewski, Michael S.; Foreman, William T.; Morita, Andrew Y.


    In 1998, the U.S. Geological Survey, in cooperation with the Sweetwater Authority, began a study to assess the overall health of the Sweetwater watershed in San Diego County, California. This study was designed to provide a data set that could be used to evaluate potential effects from the construction and operation of State Route 125 within the broader context of the water quality and air quality in the watershed. The study included regular sampling of water, air, and surficial bed sediment at Sweetwater Reservoir (SWR) for chemical constituents, including volatile organic compounds (VOCs), base-neutral and acid- extractable organic compounds (BNAs) that include polycyclic aromatic hydrocarbons (PAHs), pesticides, and metals. Additionally, water samples were collected for anthropogenic organic indicator compounds in and around SWR. Background water samples were collected at Loveland Reservoir for VOCs, BNAs, pesticides, and metals. Surficial bed-sediment samples were collected for PAHs, organochlorine pesticides, and metals at Sweetwater and Loveland Reservoirs.

  1. Population Effects of Influenza A(H1N1) Pandemic among Health Plan Members, San Diego, California, USA, October-December 2009. (United States)

    Bitar, Roger A


    Lacking population-specific data, activity of seasonal and pandemic influenza is usually tracked by counting the number of diagnoses and visits to medical facilities above a baseline. This type of data does not address the delivery of services in a specific population. To provide population-specific data, this retrospective study of patients with influenza-like illness, influenza, and pneumonia among members of a Kaiser Permanente health plan in San Diego, California, USA, during October-December 2009 was initiated. Population data included the number of outpatients accessing healthcare; the number of patients diagnosed with pneumonia; antimicrobial therapy administered; number of patients hospitalized with influenza, influenza-like illness, or pneumonia; level of care provided; and number of patients requiring specialized treatments (e.g., oxygen, ventilation, vasopressors). The rate of admissions specific to weeks and predictions of 2 epidemiologic models shows the strengths and weaknesses of those tools. Data collected in this study may improve planning for influenza pandemics.

  2. Improving Pediatric Cancer Care Disparities Across the United States–Mexico Border: Lessons Learned from a Transcultural Partnership between San Diego and Tijuana (United States)

    Aristizabal, Paula; Fuller, Spencer; Rivera, Rebeca; Beyda, David; Ribeiro, Raul C.; Roberts, William


    In 2007, the 5-year survival rate for children with acute leukemia in Baja California, Mexico was estimated at 10% (vs. 88% in the United States). In response, stakeholders at St. Jude Children’s Research Hospital, Rady Children’s Hospital San Diego, and the Hospital General de Tijuana (HGT) implemented a transcultural partnership to establish a pediatric oncology program. The aim was to improve clinical outcomes and overall survival for children in Baja California. An initial needs assessment evaluation was performed and a culturally sensitive, comprehensive, 5-year plan was designed and implemented. After six years, healthcare system accomplishments include the establishment of a fully functional pediatric oncology unit with 60 new healthcare providers (vs. five in 2007). Patient outcome improvements include a rise in 5-year survival for leukemia from 10 to 43%, a rise in new cases diagnosed per year from 21 to 70, a reduction in the treatment abandonment rate from 10% to 2%, and a 45% decrease in the infection rate. More than 600 patients have benefited from this program. Knowledge sharing has taken place between teams at the HGT and Rady Children’s Hospital San Diego. Further, one of the most significant outcomes is that the HGT has transitioned into a regional referral center and now mentors other hospitals in Mexico. Our results show that collaborative initiatives that implement long-term partnerships along the United States–Mexico border can effectively build local capacity and reduce the survival gap between children with cancer in the two nations. Long-term collaborative partnerships should be encouraged across other disciplines in medicine to further reduce health disparities across the United States–Mexico border. PMID:26157788

  3. Improving Pediatric Cancer Care Disparities Across the United States-Mexico Border: Lessons Learned from a Transcultural Partnership between San Diego and Tijuana. (United States)

    Aristizabal, Paula; Fuller, Spencer; Rivera, Rebeca; Beyda, David; Ribeiro, Raul C; Roberts, William


    In 2007, the 5-year survival rate for children with acute leukemia in Baja California, Mexico was estimated at 10% (vs. 88% in the United States). In response, stakeholders at St. Jude Children's Research Hospital, Rady Children's Hospital San Diego, and the Hospital General de Tijuana (HGT) implemented a transcultural partnership to establish a pediatric oncology program. The aim was to improve clinical outcomes and overall survival for children in Baja California. An initial needs assessment evaluation was performed and a culturally sensitive, comprehensive, 5-year plan was designed and implemented. After six years, healthcare system accomplishments include the establishment of a fully functional pediatric oncology unit with 60 new healthcare providers (vs. five in 2007). Patient outcome improvements include a rise in 5-year survival for leukemia from 10 to 43%, a rise in new cases diagnosed per year from 21 to 70, a reduction in the treatment abandonment rate from 10% to 2%, and a 45% decrease in the infection rate. More than 600 patients have benefited from this program. Knowledge sharing has taken place between teams at the HGT and Rady Children's Hospital San Diego. Further, one of the most significant outcomes is that the HGT has transitioned into a regional referral center and now mentors other hospitals in Mexico. Our results show that collaborative initiatives that implement long-term partnerships along the United States-Mexico border can effectively build local capacity and reduce the survival gap between children with cancer in the two nations. Long-term collaborative partnerships should be encouraged across other disciplines in medicine to further reduce health disparities across the United States-Mexico border.


    Directory of Open Access Journals (Sweden)

    Alejandra Araya


    Full Text Available La obra Convento Espiritual, de la religiosa Úrsula de San Diego, posiblemente escrita en el siglo XVI en Granada, España, forma parte de una tradición de escritura de mujeres como ejercicio ascético-místico en la vida religiosa y devota a ambos lados del Atlántico. En este trabajo se presenta un modo de leerlo en tanto género textual derivado de prácticas de organización del conocimiento provenientes de las artes de la memoria y, como tal, una forma de construcción del sujeto. Estas características son notables en este texto, y si bien no son exclusivas de él, es importante por formar parte de la historia de los primeros impresos en Chile luego de la independencia indicando con ello el reconocimiento pedagógico de este tipo de escritura femenina en las sociedades del Antiguo Régimen.The book Convento Espiritual (Spiritual Convent ofthe Spanish nun Ursula de San Diego, possibly written during the sixteenth century in Granada, Spain, is part of a tradition of womens' writing as an exercise in mystical-ascetic and devout religious life on both sides of the Atlantic. This essay proposes a reading this text within the frame of a textual genre originated in those practices of knowledge organization derived from the arts of memory; as a textual genre, it can also be understood as aform of subject construction. These are remarkable features to be foundin this text, and though they are not exclusive to it, they are important because the Convento espiritual belongs to the history of the early books printed in Chile after the Independence; this points out to the recognition of the educational value  of this type of writing women in those societies belonging to the Old Regime.

  5. Telegraph Canyon Creek, City of Chula Vista, San Diego County, California. Detailed Report for Flood Control. Volume 1. Main Report. (United States)


    social , and historical information concerning the Telegraph Canyon area is very limited. For that reason, and because the economy of the study area is...Diego Department of Sanitation and Flood Control by letter dated November 10, 1978 also reaffirmed its support of such solution. Such reaffirmation...marsh and tidal habitats predominate. This area, known as the J Street Marsh, is a valuable and productive habitat that supports many species of

  6. Arc-rift transition volcanism in the Volcanic Hills, Jacumba and Coyote Mountains, San Diego and Imperial Counties, california (United States)

    Fisch, Gregory Zane

    Neogene volcanism associated with the subduction of the Farallon-Pacific spreading center and the transition from a subduction zone to a rift zone has been studied extensively in Baja, California, Mexico. One of the main goals of these studies was to find a geochemical correlation with slab windows that may have formed during that complicated transition. While workers have been able to find distinct geochemical signatures in samples from Baja California, none have shown statistically significant correlation with samples from southern California that are thought to be related to the same arc-rift transition events. All of the basaltic samples from this study of southern California rocks have prominent Nb depletions typical of island-arc subduction-related volcanism, in contrast to the chemistry of Baja California volcanics that have trace element patterns typical of synrift related volcanism. The work done by previous investigators has been additionally complicated due to each investigator's choice of important ratios or patterns, which bears little, if any, correlation with work done by others working in the same area. For example, Martin-Barajas et al. (1995) use K/Rb ratios in their study of the Puertocitos Volcanic Province, while Castillo (2008) argues that Sr/Y vs. Y is a better indicator of petrogenetic processes. Little petrologic work has been done on Neogene volcanic rocks in the Imperial Valley and eastern San Diego County region of Southern California. This thesis combines new research with that of previous workers and attempts to establish a better understanding of the processes involved with the transition volcanism. Prior work documents significant differences in the geochemistry between some of these areas, especially those in close proximity to each other (e.g. the Volcanic Hills and Coyote Mountains). These differences were thought to be largely the result different magmatic sources. The potential of finding two differing magma types in close

  7. 77 FR 32986 - Notice of Inventory Completion: Marine Corps Base Camp Pendleton, U.S. Marine Corps, San Diego... (United States)


    ... the Pechanga Reservation, California; Rincon Band of Luiseno Mission Indians of the Rincon Reservation... Juaneno Band of Mission Indians and the San Luis Rey Band of Mission Indians. History and Description...


    Marinkovich, Matt; Wallace, Chelsea; Morris, Pat J; Rideout, Bruce; Pye, Geoffrey W


    The preshipment examination, with associated transmissible disease testing, has become standard practice in the movement of animals between zoos. An alternative disease risk-based approach, based on a comprehensive surveillance program including necropsy and preventive medicine examination testing and data, has been in practice since 2006 between the San Diego Zoo and San Diego Zoo Safari Park. A retrospective analysis, evaluating comprehensive necropsy data and preshipment testing over a 5-yr study period, was performed to determine the viability of this model for use with sending animals to other institutions. Animals (607 birds, 704 reptiles and amphibians, and 341 mammals) were shipped to 116 Association of Zoos and Aquariums (AZA)-accredited and 29 non-AZA-accredited institutions. The evaluation showed no evidence of the specific transmissible diseases tested for during the preshipment exam being present within the San Diego Zoo collection. We suggest that a risk-based animal and institution-specific approach to transmissible disease preshipment testing is more cost effective and is in the better interest of animal welfare than the current industry standard of dogmatic preshipment testing.

  9. AMS analyses of I-129 from the Fukushima Daiichi nuclear accident in the Pacific Ocean waters of the Coast La Jolla--San Diego, USA. (United States)

    Stan-Sion, C; Enachescu, M; Petre, A R


    This paper presents the results of an experimental study we performed by using the Accelerator Mass Spectrometry (AMS) method with iodine 129 (T1/2 = 15.7 My), to determine the increase of the radionuclide content in the USA West Pacific Coast waters, two years after the March 2011 Fukushima Daiichi nuclear power plant accident. The collection of the water samples took place between April and July 2013 at regular intervals of time, from the Pacific Ocean, at the cove of La Jolla, San Diego, USA. The results of the experiments showed a significant increase of the radionuclide concentration during the late spring of 2013. Compared to the isotopic ratio (129)I/(127)I, measured at a 40 km distance, offshore of Fukushima and immediately after the accident, our results show an increase on the USA West Coast that was more than a 2.5 factor higher. Also, compared with the pre-Fukushima background values, our results show an isotopic ratio of about two orders of magnitude higher. A distinct feature of the reconstructed radioactive plume was that it traveled with a speed of 12 cm s(-1), which we estimated and is consistent with the zonal speed in the Pacific. We coupled our (129)I results with the measurements from the June 2011 KOK cruise and we derived the levels of activity for (3)H and (137)Cs. On the USA West Coast, they did not exceed the international regulatory limits.

  10. Energy-water nexus analysis of enhanced water supply scenarios: a regional comparison of Tampa Bay, Florida, and San Diego, California. (United States)

    Mo, Weiwei; Wang, Ranran; Zimmerman, Julie B


    Increased water demand and scarce freshwater resources have forced communities to seek nontraditional water sources. These challenges are exacerbated in coastal communities, where population growth rates and densities in the United States are the highest. To understand the current management dilemma between constrained surface and groundwater sources and potential new water sources, Tampa Bay, Florida (TB), and San Diego, California (SD), were studied through 2030 accounting for changes in population, water demand, and electricity grid mix. These locations were chosen on the basis of their similar populations, land areas, economies, and water consumption characters as well as their coastal locations and rising contradictions between water demand and supply. Three scenarios were evaluated for each study area: (1) maximization of traditional supplies; (2) maximization of seawater desalination; and (3) maximization of nonpotable water reclamation. Three types of impacts were assessed: embodied energy, greenhouse gas (GHG) emission, and energy cost. SD was found to have higher embodied energy and energy cost but lower GHG emission than TB in most of its water infrastructure systems because of the differences between the electricity grid mixes and water resources of the two regions. Maximizing water reclamation was found to be better than increasing either traditional supplies or seawater desalination in both regions in terms of the three impact categories. The results further imply the importance of assessing the energy-water nexus when pursuing demand-side control targets or goals as well to ensure that the potentially most economical options are considered.

  11. The Interaction of Sexual Identity With Sexual Behavior and Its Influence on HIV Risk Among Latino Men: Results of a Community Survey in Northern San Diego County, California (United States)

    Zellner, Jennifer A.; Sañudo, Fernando; Fernández-Cerdeño, Araceli; Sipan, Carol L.; Hovell, Melbourne F.; Carrillo, Héctor


    Objectives. We examined the sexual behavior, sexual identities, and HIV risk factors of a community sample of Latino men to inform efforts to reduce Latinos' HIV risk. Methods. In 2005 and 2006, 680 Latino men in San Diego County, California, in randomly selected, targeted community venues, completed an anonymous, self-administered survey. Results. Most (92.3%) respondents self-identified as heterosexual, with 2.2%, 4.9%, and 0.6% self-identifying as bisexual, gay, or other orientation, respectively. Overall, 4.8% of heterosexually identified men had a lifetime history of anal intercourse with other men. Compared with behaviorally heterosexual men, heterosexually identified men who had sex with both men and women were more likely to have had a sexually transmitted infection, to have unprotected sexual intercourse with female partners, and to report having sex while under the influence of alcohol or other drugs. Bisexually identified men who had sex with men and women did not differ from behaviorally heterosexual men in these risk factors. Conclusions. Latino men who have a heterosexual identity and bisexual practices are at greater risk of HIV infection, and efforts to reduce HIV risk among Latinos should target this group. PMID:19008512

  12. Estudio piloto de los factores clásicos de riesgo cardiovascular en una comunidad rural del municipio San Diego, Venezuela

    Directory of Open Access Journals (Sweden)

    Marvin Querales


    Full Text Available Cardiovascular diseases represent a public health problem in both developed and undeveloped countries. These illnesses, although they have been more associated with urban populations, have shown an increase in rural communities. For this, the objective of this research was to make a preliminary diagnosis of classical cardiovascular risk factors in a rural community from San Diego, Venezuela. 185 people who were determined weight, height, waist circumference, blood pressure, blood glucose and lipid profile were evaluated. A survey to assess family history of cardiovascular disease and lifestyle was applied. High frequency of sedentary lifestyle and low HDL cholesterol (90%, CI=86,0-94,6, overweight/obesity (69%, CI=62,5-75,9, abdominal obesity (47%, CI=39,3-53,7 and hypertriglyceridemia (32%, CI=25,2-38,6 was obtained. The frequency of metabolic syndrome was between 41-45%. These results could guide the design of preventive strategies based on the promotion of physical activity and heart healthy diet as a basis for addressing cardiovascular health problems from this rural community.

  13. Associated pathways between neighborhood environment, community resource factors and leisure-time physical activity among Mexican-American adults in San Diego, CA (United States)

    Martinez, Suzanna M.; Ayala, Guadalupe X.; Patrick, Kevin; Arredondo, Elva M.; Roesch, Scott; Elder, John


    Purpose To examine pathways between individual, social, and environmental factors associated with leisure-time physical activity (LTPA) among Mexican-American adults. Design Cross-sectional design using random digit dialing to administer a structured telephone interview. Setting Mexican-American adults living in a U.S./Mexican border community in San Diego, CA (N=672). Measures Data were collected on LTPA, demographic characteristics, acculturation, and other psychosocial and environmental factors associated with LTPA. Analysis Structural equation modeling to test an a priori model of LTPA. Results Participants were mostly female (71%) with a mean age of 39 years (SD = 13). Only 32% of participants met PA guidelines in their leisure time, with men (39%) meeting the guidelines more than women (29%). Using structural equation modeling, neighborhood factors, both social and environmental, showed indirect relationships with meeting PA guidelines through community resource factors. Significant covariates included marital status and age. Conclusion Individual, social and environmental factors were associated with LTPA in this sample of Mexican-American adults. These findings can inform intervention studies that aim to increase LTPA in this population. PMID:22548422

  14. SSC RESTful Web Services API (United States)

    National Aeronautics and Space Administration — The Satellite Situation Center (SSC) web services allow a software developer to use portions of the SSC software in their own applications. SSC is a system to cast...

  15. Factors associated with continued participation in a matched monetary incentive programme at local farmers' markets in low-income neighbourhoods in San Diego, California. (United States)

    Ratigan, Amanda R; Lindsay, Suzanne; Lemus, Hector; Chambers, Christina D; Anderson, Cheryl Am; Cronan, Terry A; Browner, Deirdre K; Wooten, Wilma J


    The Farmers' Market Fresh Fund Incentive Program is a policy, systems and environmental intervention to improve access to fresh produce for participants on governmental assistance in the USA. The current study examined factors associated with ongoing participation in this matched monetary incentive programme. Relationship of baseline factors with number of Fresh Fund visits was assessed using Poisson regression. Mixed-effects modelling was used to explore changes in consumption of fruits and vegetables and diet quality. San Diego, California. Recipients of Supplemental Nutrition Assistance Program (SNAP), Special Supplemental Nutrition Program for Women, Infants, and Children (WIC) and Supplemental Security Income (SSI) who attended participating farmers' markets from 2010 to 2012 (n 7298). Among those with participation for ≤6 months, factors associated with increased visits included reporting more daily servings of fruits and vegetables (F&V) at baseline, being Vietnamese or Asian/Pacific Islander, and eligibility because of SNAP/CalFresh or SSI (v. WIC). Among those who came for 6-12 months, being Asian/Pacific Islander, eligibility because of SNAP/CalFresh and enrolling in the autumn, winter or spring were associated with a greater number of Fresh Fund visits. Among those who came for >12 months, being male and eligibility because of SSI were associated with a greater number of visits. Overall, the odds of increasing number of servings of F&V consumed increased by 2 % per month, and the odds of improved perception of diet quality increased by 10 % per month. Sustaining and increasing Fresh Fund-type programme operations should be a top priority for future policy decisions concerning farmers' market use in low-income neighbourhoods.

  16. The impact of evolving current rheology on multi-scale heterogeneity in submarine lobe strata: an example from the Upper Cretaceous Point Loma Formation, San Diego, California (United States)

    McGlown, A.; Mohrig, D. C.; Perillo, M. M.


    Increasing recognition of transitional flow deposits in submarine fans has shown that the evolution of flow rheology in sediment-gravity currents can have a significant impact on the heterogeneity of deepwater sediment accumulations. Sea-cliff exposure of the Cretaceous Point Loma Formation in San Diego, California, provides a unique opportunity to document the internal variability and spatial distribution of thin, fine-grained event beds. Upper portions of beds which commonly appear as featureless mud in exposures of typical quality are revealed as thin, clast-rich debrites in areas where sea cliffs are polished by waves. The ubiquity of these deposits in distal lobe strata suggests complex rheological evolution for nearly all currents that were able to run out to lobe margins. Here we supplement qualitative outcrop characterization with statistical analysis to quantify relationships between deposit thickness, grain size, and the spatial distribution of sedimentary facies. Intervals dominated by transitional flow deposits are shown to occur vertically near the base of coarsening-upward successions and laterally toward lobe margins, reflecting a combination of dynamic processes during individual events and the spatial distribution of consecutive deposits. We show that the ability to distinguish patterns of bed-scale variability reflecting flow evolution from patterns associated with larger-scale processes, such as distributary channel avulsion and compensational stacking, is critical if one is to accurately model heterogeneity within submarine fan systems. Furthermore, the observation that thin, fine-grained debrites can be nearly impossible to distinguish from featureless mud intervals unless exceptionally well-exposed may cast doubt on existing interpretations where outcrop quality is less than remarkable.

  17. Measuring affective temperaments: a systematic review of validation studies of the Temperament Evaluation in Memphis Pisa and San Diego (TEMPS) instruments. (United States)

    Elias, Liana R; Köhler, Cristiano A; Stubbs, Brendon; Maciel, Beatriz R; Cavalcante, Lígia M; Vale, Antonio M O; Gonda, Xénia; Quevedo, João; Hyphantis, Thomas N; Soares, Jair C; Vieta, Eduard; Carvalho, André F


    The assessment of affective temperaments has provided useful insights for the psychopathological understanding of affective disorders and for the conceptualization of bipolar spectrum disorders. The Temperament in Memphis Pisa and San Diego (TEMPS) instrument has been widely used in research, yet its psychometric properties and optimal factor structure are unclear. The PubMed/MEDLINE, PsycINFO, and EMBASE electronic databases were searched from inception until March 15th, 2016. Validation peer-reviewed studies of different versions of the TEMPS performed in adult samples were considered for inclusion. Twenty-seven studies (N=20,787) met inclusion criteria. Several versions of the TEMPS have been validated in 14 languages across 15 countries. The 110-item self-reported version of the TEMPS has been the most studied version. Most studies (50%) supported a five factor solution although few studies performed confirmatory factor analyses. A five-factor solution has consistently been reported for the 39-item version of the TEMPS-A. Overall, evidence indicates that different versions of the TEMPS have adequate internal consistency reliability, while the TEMPS-A-110 version has acceptable test-retest reliability. The methodological quality of included studies varied. A meta-analysis could not be performed due to the heterogeneity of settings and versions of the TEMPS utilized. Different versions of the TEMPS have been validated across different cultures. The short 39-item version of the TEMPS-A holds promise and merits further investigation. Culture-bound factors may influence the expression and/or assessment of affective temperaments with the TEMPS. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Morningness-eveningness and affective temperaments assessed by the Temperament Evaluation of Memphis, Pisa and San Diego-Autoquestionnaire (TEMPS-A). (United States)

    Chrobak, Adrian Andrzej; Tereszko, Anna; Dembinska-Krajewska, Daria; Arciszewska, Aleksandra; Siwek, Marcin; Dudek, Dominika; Rybakowski, Janusz


    Chronotype is a stable trait presenting one's circardian preference. Since chronotype disturbances are common in patients with affective disorders, our aim is to evaluate chronotypes related to affective temperaments, measured with the temperament evaluation of Memphis, Pisa and San Diego-Autoquestionnaire (TEMPS-A). The study included 618 subjects (151 men and 467 women) within the framework of web-based design. They all fulfilled a questionnaire, consisting of the Composite Scale of Morningness (CSM), Sleep Wake Pattern Assessment Questionnaire (SWPAQ), and the TEMPS-A scale. Multiple regression models revealed that after controlling for age and gender: irritable and cyclothymic temperaments were negatively associated with total CSM score, CSM morning affect and circadian preference components, Sleepability (S), Vigilance (V), Wakeability (W) and positively with Morningness (M) and Eveningness (E) subscales of SWPAQ; anxious temperament was negatively associated with total CSM scores, CSM morning affect and with S, V, W subscales of SWPAQ; depressive temperament was negatively associated with Falling asleep, S, V, W subscales of SWPAQ; hyperthymic temperament was positively associated with CSM morning affect and V, W and negatively with M subscales of SWPAQ. The results show distinctiveness of the associations between hyperthymic temperament and circadian preferences, compared to all other TEMPS-A temperaments (depressive, cyclothymic, irritable and anxious). In the CMS scale, only hyperthymic temperament was related to morning affect. In the SWPAQ scale, hyperthymic temperament was the only one associated with earlier morningness (earlier wake up time preference), increased parameters of vigor - wakeability, vigilance, and also the only one not associated with decreased plasticity of circadian rhythm (sleepability and falling asleep). Results also point to some similarities between cyclothymic and irritable temperaments in some aspects of the chronotype.

  19. Water- and Air-Quality Monitoring of Sweetwater Reservoir Watershed, San Diego County, California - Phase One Results Continued, 2001-2003 (United States)

    Mendez, Gregory O.; Foreman, William T.; Morita, Andrew; Majewski, Michael S.


    In 1998, the U.S. Geological Survey, in cooperation with the Sweetwater Authority, began a study to monitor water, air, and sediment at the Sweetwater and Loveland Reservoirs in San Diego County, California. The study includes regular sampling of water and air at Sweetwater Reservoir for chemical constituents, including volatile organic compounds (VOC), polynuclear aromatic hydrocarbons (PAH), pesticides, and major and trace elements. The purpose of this study is to monitor changes in contaminant composition and concentration during the construction and operation of State Route 125. To accomplish this, the study was divided into two phases. Phase One sampling (water years 1998-2004) determined baseline conditions for the detection frequency and the concentrations of target compounds in air and water. Phase Two sampling (starting water year 2005) continues at selected monitoring sites during and after construction of State Route 125 to assess the chemical impact this roadway alignment may have on water quality in the reservoir. Water samples were collected for VOCs and pesticides at Loveland Reservoir during Phase One and will be collected during Phase Two for comparison purposes. Air samples collected to monitor changes in VOCs, PAHs, and pesticides were analyzed by adapting methods used to analyze water samples. Bed-sediment samples have been and will be collected three times during the study; at the beginning of Phase One, at the start of Phase Two, and near the end of the study. In addition to the ongoing data collection, several special studies were initiated to assess the occurrence of specific chemicals of concern, such as trace metals, anthropogenic indicator compounds, and pharmaceuticals. This report describes the study design, and the sampling and analytical methods, and presents data from water and air samples collected during the fourth and fifth years of Phase One of the study (October 2001 to September 2003). Data collected during the first three

  20. Femoral Artery Atherosclerosis Is Associated With Physical Function Across the Spectrum of the Ankle-Brachial Index: The San Diego Population Study. (United States)

    Wassel, Christina L; Ellis, Alicia M; Suder, Natalie C; Barinas-Mitchell, Emma; Rifkin, Dena E; Forbang, Nketi I; Denenberg, Julie O; Marasco, Antoinette M; McQuaide, Belinda J; Jenny, Nancy S; Allison, Matthew A; Ix, Joachim H; Criqui, Michael H


    The ankle-brachial index (ABI) is inadequate to detect early-stage atherosclerotic disease, when interventions to prevent functional decline may be the most effective. We determined associations of femoral artery atherosclerosis with physical functioning, across the spectrum of the ABI, and within the normal ABI range. In 2007-2011, 1103 multiethnic men and women participated in the San Diego Population Study, and completed all components of the summary performance score. Using Doppler ultrasound, superficial and common femoral intima media thickness and plaques were ascertained. Logistic regression was used to assess associations of femoral atherosclerosis with the summary performance score and its individual components. Models were adjusted for demographics, lifestyle factors, comorbidities, lipids, and kidney function. In adjusted models, among participants with a normal-range ABI (1.00-1.30), the highest tertile of superficial intima media thickness was associated with lower odds of a perfect summary performance score of 12 (odds ratio=0.56 [0.36, 0.87], P=0.009), and lower odds of a 4-m walk score of 4 (0.34 [0.16, 0.73], P=0.006) and chair rise score of 4 (0.56 [0.34, 0.94], P=0.03). Plaque presence (0.53 [0.29, 0.99], P=0.04) and greater total plaque burden (0.61 [0.43, 0.87], P=0.006) were associated with worse 4-m walk performance in the normal-range ABI group. Higher superficial intima media thickness was associated with lower summary performance score in all individuals (P=0.02). Findings suggest that use of femoral artery atherosclerosis measures may be effective in individuals with a normal-range ABI, especially, for example, those with diabetes mellitus or a family history of peripheral artery disease, when detection can lead to earlier intervention to prevent functional declines and improve quality of life. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley.

  1. Nuevas fronteras para la innovación tecnológica: colaboración y cooperación en la región Tijuana-San Diego

    Directory of Open Access Journals (Sweden)

    Minerva Celaya Tentori


    Full Text Available La manera en que se constituyen formas de colaboración y cooperación en regiones binacionales alude a procesos complejos de interacción entre actores institucionales. Las diferencias y las enormes asimetrías, que en lo general prevalecen entre países con grados de desarrollo distintos, dificulta la construcción de agendas comunes. Esta situación se ha puesto de manifiesto en el área de Tijuana- San Diego, en donde parecen abrirse oportunidades para la implementación de acciones conjuntas orientadas a la innovación tecnológica, que corresponden a un modelo peculiar de colaboración. Aquí se intenta responder las siguientes preguntas sobre la región Tijuana-San Diego: ¿bajo qué marco de acción pública se promueve la colaboración trasfronteriza para el desarrollo económico?; ¿cuáles fueron las condiciones en las que se gestaron las capacidades territoriales actuales que dan soporte al sector productivo?; ¿cuáles son las características del entramado institucional?; ¿qué formas de cooperación o colaboración existen, para fomentar la trasferencia de conocimiento tecnológico y la innovación desde el entorno?

  2. University of California, San Diego (United States)

    Provides trainees with a balanced combination comprehensive cancer biology, engineering, and entrepreneurship didactic training, including cancer researcher, clinical/translational cancer faculty, and practical skills in small business environments.

  3. SSC Safety Review Document

    Energy Technology Data Exchange (ETDEWEB)

    Toohig, T.E. [ed.


    The safety strategy of the Superconducting Super Collider (SSC) Central Design Group (CDG) is to mitigate potential hazards to personnel, as far as possible, through appropriate measures in the design and engineering of the facility. The Safety Review Document identifies, on the basis of the Conceptual Design Report (CDR) and related studies, potential hazards inherent in the SSC project independent of its site. Mitigative measures in the design of facilities and in the structuring of laboratory operations are described for each of the hazards identified.

  4. Shielding calculations for SSC

    Energy Technology Data Exchange (ETDEWEB)

    Van Ginneken, A.


    Monte Carlo calculations of hadron and muon shielding for SSC are reviewed with emphasis on their application to radiation safety and environmental protection. Models and algorithms for simulation of hadronic and electromagnetic showers, and for production and transport of muons in the TeV regime are briefly discussed. Capabilities and limitations of these calculations are described and illustrated with a few examples. 12 refs., 3 figs.

  5. Tipos de bullying y autoconcepto en los estudiantes del octavo año de la educación media del colegio Liceo Nuevo de San Diego, Costa Rica, 2014.


    Moss Joseph, Glaeson Fernando


    Esta investigación se realizó con propósito de conocer: ¿Cuál es la relación de los tipos de Bullying con el Autoconcepto de los estudiantes del octavo año de la educación media del colegio Liceo Nuevo de San Diego, Costa Rica, 2014. Este trabajo demuestra que no hay relación entre los Tipos de Bullying y el Autoconcepto en los estudiantes en sus siete dimensiones: manipulación social, coacción, exclusión social, amenaza a la integridad, intimidación, bloqueo social y hostigamiento. La poblac...

  6. Monitoring breeding and migration of neotropical migratory birds at Point Loma, San Diego County, California, 5-year summary, 2011–15 (United States)

    Lynn, Suellen; Madden, Melanie C.; Kus, Barbara E.


    Executive SummaryWe operated a bird banding station on the Point Loma peninsula in western San Diego County, California, during spring and summer from 2011 to 2015. The station was established in 2010 as part of a long-term monitoring program for neotropical migratory birds during spring migration and for breeding birds as part of the Monitoring Avian Productivity and Survivorship (MAPS) program.During spring migration (April and May), 2011–15, we captured 1,760 individual birds of 54 species, 91 percent (1,595) of which were newly banded, fewer than 1 percent (3) of which were recaptures that were banded in previous years, and 9 percent (143 hummingbirds, 2 hawks, and 17 other birds) of which we released unbanded. We observed an additional 22 species that were not captured. Thirty-four individuals were captured more than once. Bird capture rate averaged 0.49 ± 0.07 captures per net-hour (range 0.41–0.56). Species richness per day averaged 6.87 ± 0.33. Cardellina pusilla (Wilson’s warbler) was the most abundant spring migrant captured, followed by Empidonax difficilis (Pacific-slope flycatcher), Vireo gilvus (warbling vireo), Zonotrichia leucophrys (white-crowned sparrow), and Selasphorus rufus (rufous hummingbird). Captures of white-crowned sparrow decreased, and captures of Pacific-slope flycatcher increased, over the 5 years of our study. Fifty-six percent of known-sex individuals were male and 44 percent were female. The peak number of new species arriving per day ranged from April 1 (2013-six species) to April 16 (2012-five species). A significant correlation was determined between the number of migrants captured each day per net-hour and the density of echoes on the Next-Generation Radar (NEXRAD) images across all 5 years, and in each year except 2014. NEXRAD radar imagery appears to be a useful tool for detecting pulses in migration.Our results indicate that Point Loma provides stopover habitat during migration for 76 migratory species, including 20

  7. Proceedings of the Conference on Fleet Marine Force Combat Casualty Information System Held at San Diego, California on 2-4 April 1984 (United States)


    Quantico, VA 2213.0 CAPT Bernard R. Blais, MC, USN CiDP , J. R. Crim Force Medical Officer Groulp Surgeon Mit I tary Sea Lilt Command 1st 6SSC, FMF PACC...member may rest on the corpsman for days or weeks, even -4 in peace time. For this reason an Independent Duty Submarine Corpsman (8402) is - more...for example, as nonspecific abdominal pain. For that reason , we conducted observational studies in which one or two persons trained for that purpose

  8. Evaluating the impact of Mexico's drug policy reforms on people who inject drugs in Tijuana, B.C., Mexico, and San Diego, CA, United States: a binational mixed methods research agenda. (United States)

    Robertson, Angela M; Garfein, Richard S; Wagner, Karla D; Mehta, Sanjay R; Magis-Rodriguez, Carlos; Cuevas-Mota, Jazmine; Moreno-Zuniga, Patricia Gonzalez; Strathdee, Steffanie A


    Policymakers and researchers seek answers to how liberalized drug policies affect people who inject drugs (PWID). In response to concerns about the failing "war on drugs," Mexico recently implemented drug policy reforms that partially decriminalized possession of small amounts of drugs for personal use while promoting drug treatment. Recognizing important epidemiologic, policy, and socioeconomic differences between the United States-where possession of any psychoactive drugs without a prescription remains illegal-and Mexico-where possession of small quantities for personal use was partially decriminalized, we sought to assess changes over time in knowledge, attitudes, behaviors, and infectious disease profiles among PWID in the adjacent border cities of San Diego, CA, USA, and Tijuana, Baja California, Mexico. Based on extensive binational experience and collaboration, from 2012-2014 we initiated two parallel, prospective, mixed methods studies: Proyecto El Cuete IV in Tijuana (n = 785) and the STAHR II Study in San Diego (n = 575). Methods for sampling, recruitment, and data collection were designed to be compatible in both studies. All participants completed quantitative behavioral and geographic assessments and serological testing (HIV in both studies; hepatitis C virus and tuberculosis in STAHR II) at baseline and four semi-annual follow-up visits. Between follow-up assessment visits, subsets of participants completed qualitative interviews to explore contextual factors relating to study aims and other emergent phenomena. Planned analyses include descriptive and inferential statistics for quantitative data, content analysis and other mixed-methods approaches for qualitative data, and phylogenetic analysis of HIV-positive samples to understand cross-border transmission dynamics. Investigators and research staff shared preliminary findings across studies to provide feedback on instruments and insights regarding local phenomena. As a result, recruitment and data

  9. Evaluating the impact of Mexico’s drug policy reforms on people who inject drugs in Tijuana, B.C., Mexico, and San Diego, CA, United States: a binational mixed methods research agenda (United States)


    Background Policymakers and researchers seek answers to how liberalized drug policies affect people who inject drugs (PWID). In response to concerns about the failing “war on drugs,” Mexico recently implemented drug policy reforms that partially decriminalized possession of small amounts of drugs for personal use while promoting drug treatment. Recognizing important epidemiologic, policy, and socioeconomic differences between the United States—where possession of any psychoactive drugs without a prescription remains illegal—and Mexico—where possession of small quantities for personal use was partially decriminalized, we sought to assess changes over time in knowledge, attitudes, behaviors, and infectious disease profiles among PWID in the adjacent border cities of San Diego, CA, USA, and Tijuana, Baja California, Mexico. Methods Based on extensive binational experience and collaboration, from 2012–2014 we initiated two parallel, prospective, mixed methods studies: Proyecto El Cuete IV in Tijuana (n = 785) and the STAHR II Study in San Diego (n = 575). Methods for sampling, recruitment, and data collection were designed to be compatible in both studies. All participants completed quantitative behavioral and geographic assessments and serological testing (HIV in both studies; hepatitis C virus and tuberculosis in STAHR II) at baseline and four semi-annual follow-up visits. Between follow-up assessment visits, subsets of participants completed qualitative interviews to explore contextual factors relating to study aims and other emergent phenomena. Planned analyses include descriptive and inferential statistics for quantitative data, content analysis and other mixed-methods approaches for qualitative data, and phylogenetic analysis of HIV-positive samples to understand cross-border transmission dynamics. Results Investigators and research staff shared preliminary findings across studies to provide feedback on instruments and insights regarding local

  10. Vegetation - San Felipe Valley [ds172 (United States)

    California Department of Resources — This Vegetation Map of the San Felipe Valley Wildlife Area in San Diego County, California is based on vegetation samples collected in the field in 2002 and 2005 and...

  11. Seroepidemiologic Investigation of an Outbreak of Pandemic Influenza A H1N1 2009 Aboard a U.S. Navy Vessel - San Diego, 2009 (United States)


    Naval Health Research Center Seroepidemiologic Investigation of An Outbreak of Pandemic Influenza A H1N1 2009 Aboard A US Navy Vessell – San...Journal Article 3. DATES COVERED (from – to) 2009 4. TITLE Seroepidemiologic Investigation of an Outbreak of Pandemic Influenza A H1N1 2009...outbreaks. 15. SUBJECT TERMS Adolescent; adult; Disease Outbreaks; H1N1 Subtype/genetics; epidemiology; Influenza A Virus; military personnel 16

  12. Dicty_cDB: SSC471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC471 (Link to dictyBase) - - - Contig-U16339-1 SSC471E (Link to Original site) SSC...471F 448 SSC471Z 246 SSC471P 694 SSC471E 665 Show SSC471 Library SS (Link to library) Clone ID SSC...nal site URL Representative seq. ID SSC...471E (Link to Original site) Representative DNA sequence >SSC471 (SSC471Q) /CSM/SS/SSC4-C/SSC...SGFT KIDDPKFIGTVEYLEKKLRRGKYIIQSPDSVSASTTFTLYYISCIAKMGRKEEARELFEN ILNDCTPLGLISQDV


    Wallace, Chelsea; Marinkovich, Matt; Morris, Pat J; Rideout, Bruce; Pye, Geoffrey W


    Quarantine is designed primarily to prevent the introduction of transmissible diseases to zoological collections. Improvements in preventive medicine, disease eradication, and comprehensive pathology programs call into question current industry quarantine standards. Disease risk analysis was used at the San Diego Zoo (SDZ) and the SDZ Safari Park to eliminate quarantine isolation and transmissible disease testing for animals transferred between the two institutions. To determine if a risk-based approach might be valid between other institutions and SDZ, we reviewed quarantine data for animals arriving at SDZ from 81 Association of Zoos and Aquariums (AZA)-accredited and 124 other sources (e.g., non-AZA-accredited institutions, private breeders, private dealers, governmental bodies) over a 5-yr period (2009-2013). No mammal or herptile failed quarantine due to transmissible diseases of concern. Approximately 2.5% of incoming birds failed quarantine due to transmissible disease; however, all 14 failed individuals were obtained from three nonaccredited sources (private breeders, confiscation). The results of our study suggest that a risk-based approach could be used to minimize or eliminate quarantine for the transfer of animals from institutions with comprehensive disease surveillance programs and/or preshipment testing practices. Quarantine isolation with testing remains an essential defense against introducing transmissible diseases of concern when there is a lack of health knowledge about the animals being received.

  14. 美国圣地亚哥创新集群发展的原因探析%The Discussions on Reasons of the Development of San Diego's Innovation Cluster

    Institute of Scientific and Technical Information of China (English)



    Innovation Cluster is major developmental strategy for promoting industrial innovation, economic development and enhancing the national competitiveness. San Diego's Innovation Cluster is the third largest technology innovation center while also belongs to the world's a real biotechnology industry Cluster. Its rapidly rise is accused to The role of regional land use decisions and of state infrastructure Investments、The major commitment of time and resources by the private sector and encouraging local culture of collaboration between academic, public and private sectors.%创新集群是推动产业创新、促进经济发展和增强国家竞争力的重大发展战略,圣地亚哥创新集群是美国第三大科技中心和世界上唯一的一个真正的生物科技产业集聚区,其快速崛起主要是因为州政府土地政策的大力扶持、高效率、专业化的技术创新与服务机构以及鼓励创新与强调知识应用的文化传统。

  15. IBC's 21st Annual Antibody Engineering and 8th Annual Antibody Therapeutics International Conferences and 2010 Annual Meeting of the Antibody Society. December 5-9, 2010, San Diego, CA USA. (United States)

    Arnett, Samantha O; Teillaud, Jean-Luc; Wurch, Theirry; Reichert, Janice M; Dunlop, Cameron; Huber, Michael


    The 21st Annual Antibody Engineering and 8th Annual Antibody Therapeutics international conferences, and the 2010 Annual Meeting of The Antibody Society, organized by IBC Life Sciences with contributions from The Antibody Society and two Scientific Advisory Boards, were held December 5-9, 2010 in San Diego, CA. The conferences were organized with a focus on antibody engineering only on the first day and a joint engineering/therapeutics session on the last day. Delegates could select from presentations that occurred in two simultaneous sessions on days 2 and 3. Day 1 included presentations on neutralizing antibodies and the identification of vaccine targets, as well as a historical overview of 20 years of phage display utilization. Topics presented in the Antibody Engineering sessions on day 2 and 3 included antibody biosynthesis, structure and stability; antibodies in a complex environment; antibody half-life; and targeted nanoparticle therapeutics. In the Antibody Therapeutics sessions on days 2 and 3, preclinical and early stage development and clinical updates of antibody therapeutics, including TRX518, SYM004, MM111, PRO140, CVX-241, ASG-5ME, U3-1287 (AMG888), R1507 and trastuzumab emtansine, were discussed, and perspectives were provided on the development of biosimilar and biobetter antibodies, including coverage of regulatory and intellectual property issues. The joint engineering/therapeutics session on the last day focused on bispecific and next-generation antibodies.

  16. IBC's 22nd Annual Antibody Engineering and 9th Annual Antibody Therapeutics International Conferences and the 2011 Annual Meeting of The Antibody Society, December 5-8, 2011, San Diego, CA. (United States)

    Nilvebrant, Johan; Dunlop, D Cameron; Sircar, Aroop; Wurch, Thierry; Falkowska, Emilia; Reichert, Janice M; Helguera, Gustavo; Piccione, Emily C; Brack, Simon; Berger, Sven


    The 22nd Annual Antibody Engineering and 9th Annual Antibody Therapeutics international conferences, and the 2011 Annual Meeting of The Antibody Society, organized by IBC Life Sciences with contributions from The Antibody Society and two Scientific Advisory Boards, were held December 5-8, 2011 in San Diego, CA. The meeting drew ~800 participants who attended sessions on a wide variety of topics relevant to antibody research and development. As a preview to the main events, a pre-conference workshop held on December 4, 2011 focused on antibodies as probes of structure. The Antibody Engineering Conference comprised eight sessions: (1) structure and dynamics of antibodies and their membrane receptor targets; (2) model-guided generation of binding sites; (3) novel selection strategies; (4) antibodies in a complex environment: targeting intracellular and misfolded proteins; (5) rational vaccine design; (6) viral retargeting with engineered binding molecules; (7) the biology behind potential blockbuster antibodies and (8) antibodies as signaling modifiers: where did we go right, and can we learn from success? The Antibody Therapeutics session comprised five sessions: (1)Twenty-five years of therapeutic antibodies: lessons learned and future challenges; (2) preclinical and early stage development of antibody therapeutics; (3) next generation anti-angiogenics; (4) updates of clinical stage antibody therapeutics and (5) antibody drug conjugates and bispecific antibodies.

  17. Maternal attitudes and behaviors regarding feeding practices in elementary school-aged Latino children: a pilot qualitative study on the impact of the cultural role of mothers in the US-Mexican border region of San Diego, California. (United States)

    Martinez, Suzanna M; Rhee, Kyung; Blanco, Estela; Boutelle, Kerri


    This study aimed to explore the attitudes and behaviors of Latino mothers around feeding their children. Using qualitative methods, we conducted four focus groups in Spanish with 41 Latino mothers of elementary school-age children in San Diego County, CA. Latino mothers' mean age was 41 years; 90% were foreign-born; and 74% had a high school education or less. We explored cultural viewpoints around feeding and cooking and feeding strategies used. Focus groups were analyzed based on a priori and emergent themes. The following themes around feeding emerged: feeding attitudes central to the maternal responsibility of having well-fed children and feeding behaviors that centered on cooking methods, supportive behaviors, and reinforcement strategies for "eating well." These findings increase our understanding of the Latino maternal role to feed children and can help to inform more culturally appropriate research to effectively address nutritional issues and obesity prevention in Latino children. Copyright © 2014 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

  18. Triggering requirements for SSC physics

    Energy Technology Data Exchange (ETDEWEB)

    Gilchriese, M.G.D. [Lawrence Berkeley Lab., CA (United States)


    Some aspects of triggering requirements for high P{sub T} physics processes at the Superconducting Super Collider (SSC) are described. A very wide range of trigger types will be required to enable detection of the large number of potential physics signatures possible at the SSC. Although in many cases trigger rates are not now well understood, it is possible to conclude that the ability to trigger on transverse energy, number and energy of jets, number and energy of leptons (electrons and muons), missing energy and combinations of these will be required. An SSC trigger system must be both highly flexible and redundant to ensure reliable detection of many new physics processes at the SSC.

  19. Dicty_cDB: SSC418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC418 (Link to dictyBase) - - - Contig-U01562-1 SSC418E (Link to Original site) SSC...418F 448 - - SSC418P 545 SSC418E 443 Show SSC418 Library SS (Link to library) Clone ID SSC... URL Representative seq. ID SSC...418E (Link to Original site) Representative DNA sequence >SSC418 (SSC418Q) /CSM/SS/SSC4-A/SSC4...fygkklvnyfqlvmn*iykknkn*nkillifx** scnitffnkkkkkkkkkkkkkkkkkkk Frame B: fke**y*se

  20. Dicty_cDB: SSC172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC172 (Link to dictyBase) - - - Contig-U15618-1 SSC172P (Link to Original site) SSC...172F 288 SSC172Z 529 SSC172P 817 - - Show SSC172 Library SS (Link to library) Clone ID SSC... URL Representative seq. ID SSC...172P (Link to Original site) Representative DNA sequence >SSC172 (SSC172Q) /CSM/SS/SSC1-C/SSC1...HIEENLNSTQISYRRNFYVFDCKTL CPRNETINFEIEVCKVNGMDMYGIKFKRLSGDAWSYSSSCIKIVESLKL*lkkkk

  1. Dicty_cDB: SSC190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC190 (Link to dictyBase) - - - Contig-U01589-1 SSC190P (Link to Original site) SSC...190F 599 SSC190Z 469 SSC190P 1068 - - Show SSC190 Library SS (Link to library) Clone ID SSC...e URL Representative seq. ID SSC...190P (Link to Original site) Representative DNA sequence >SSC190 (SSC190Q) /CSM/SS/SSC1-D/SSC...fwfknpw*p**fyfqinrfrkn*ksqryfvwkgnq*sscng*n* ket*kl*skvflys*prynhiiihgy*sl*cfnylc

  2. Dicty_cDB: SSC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC252 (Link to dictyBase) - - - Contig-U16560-1 SSC252Z (Link... to Original site) - - SSC252Z 516 - - - - Show SSC252 Library SS (Link to library) Clone ID SSC252 (Link Representative seq. ID SSC25...2Z (Link to Original site) Representative DNA sequence >SSC252 (SSC252Q) /CSM/SS/SSC2-C/SSC252Q.Seq.d/ XXXXX...5-B/SSE525Q.Seq.d/ 898 0.0 SSC252 (SSC252Q) /CSM/SS/SSC2-C/SSC252Q.Seq.d/ 898 0.0 SSC150 (SSC150Q) /CSM/SS/SSC1-C/SSC

  3. SSC OCIO, IT SUMMIT 2011 (United States)

    Cottrell, Dinna L.


    The Stennis Space Center (SSC) Records Retention Facility is a centralized location for all SSC records, Records Management staff, and the SSC History Office. The building is a storm resistant facility and provides a secure environment for records housing. The Records Retention Facility was constructed in accordance with The National Archives and Records Administration (NARA) requirements for records storage, making it the first NARA compliant facility in the agency. Stennis Space Center's Records Retention Facility became operational in May 2010. The SSC Records Retention Facility ensures that the required federal records are preserved, managed and accessible to all interested personnel. The facility provides 20,000 cubic feet of records storage capacity for the purpose of managing the centers consolidated records within a central, protected environment. Records housed in the facility are in the form of paper, optical, film and magnetic media. Located within the SSC Records Retention Facility, the Records Management Office provides comprehensive records management services in the form of: a) Storage and life-cycle management of inactive records of all media types; b) Digitizing/scanning of records and documents; c) Non-textual/digital electronic records media storage, migration and transfer; d) Records Remediation.

  4. Distribution and abundance of Least Bell’s Vireos (Vireo bellii pusillus) and Southwestern Willow Flycatchers (Empidonax traillii extimus) on the Middle San Luis Rey River, San Diego, southern California—2016 data summary (United States)

    Allen, Lisa D.; Howell, Scarlett L.; Kus, Barbara E.


    Executive SummaryWe surveyed for Least Bell’s Vireos (LBVI) (Vireo bellii pusillus) and Southwestern Willow Flycatchers (SWFL) (Empidonax traillii extimus) along the San Luis Rey River, between College Boulevard in Oceanside and Interstate 15 in Fallbrook, California (middle San Luis Rey River), in 2016. Surveys were done from March 30 to July 11 (LBVI) and from May 18 to July 30 (SWFL). We found 142 LBVI territories, at least 106 of which were occupied by pairs. Six additional transient LBVIs were detected. Of 20 banded LBVIs detected in the survey area, 9 had been given full color-band combinations prior to 2016, although we were unable to determine the exact color combination of 1 female LBVI. Seven other LBVIs with single (natal) federal bands were recaptured and banded in 2016. Four vireos with single dark blue federal bands indicating that they were banded as nestlings on the lower San Luis Rey River could not be recaptured for identification.Three SFWL territories were observed in the survey area in 2016. Two territories were occupied by pairs and one by a male of unknown breeding status. Both pairs attempted to nest at least once, and both pairs were successful, fledging three young each. Nesting began in early June and continued into July. Brown-Headed Cowbird (Molothrus ater) eggs were not observed in either nest. An additional 12 transient Willow Flycatchers of unknown subspecies were detected in 2016.Two of the five resident SWFLs were originally banded as nestlings on Marine Corps Base Camp Pendleton. One male and one female were banded as nestlings on Camp Pendleton in 2009 and 2011, respectively. One natal male of unknown breeding status, originally banded as a nestling on the middle San Luis Rey River in 2015, was recaptured and given a unique color combination in 2016. This male was later detected on Marine Corps Base Camp Pendleton.

  5. IBC's 23rd Annual Antibody Engineering, 10th Annual Antibody Therapeutics international conferences and the 2012 Annual Meeting of The Antibody Society: December 3-6, 2012, San Diego, CA. (United States)

    Klöhn, Peter-Christian; Wuellner, Ulrich; Zizlsperger, Nora; Zhou, Yu; Tavares, Daniel; Berger, Sven; Zettlitz, Kirstin A; Proetzel, Gabriele; Yong, May; Begent, Richard H J; Reichert, Janice M


    The 23rd Annual Antibody Engineering, 10th Annual Antibody Therapeutics international conferences, and the 2012 Annual Meeting of The Antibody Society, organized by IBC Life Sciences with contributions from The Antibody Society and two Scientific Advisory Boards, were held December 3-6, 2012 in San Diego, CA. The meeting drew over 800 participants who attended sessions on a wide variety of topics relevant to antibody research and development. As a prelude to the main events, a pre-conference workshop held on December 2, 2012 focused on intellectual property issues that impact antibody engineering. The Antibody Engineering Conference was composed of six sessions held December 3-5, 2012: (1) From Receptor Biology to Therapy; (2) Antibodies in a Complex Environment; (3) Antibody Targeted CNS Therapy: Beyond the Blood Brain Barrier; (4) Deep Sequencing in B Cell Biology and Antibody Libraries; (5) Systems Medicine in the Development of Antibody Therapies/Systematic Validation of Novel Antibody Targets; and (6) Antibody Activity and Animal Models. The Antibody Therapeutics conference comprised four sessions held December 4-5, 2012: (1) Clinical and Preclinical Updates of Antibody-Drug Conjugates; (2) Multifunctional Antibodies and Antibody Combinations: Clinical Focus; (3) Development Status of Immunomodulatory Therapeutic Antibodies; and (4) Modulating the Half-Life of Antibody Therapeutics. The Antibody Society's special session on applications for recording and sharing data based on GIATE was held on December 5, 2012, and the conferences concluded with two combined sessions on December 5-6, 2012: (1) Development Status of Early Stage Therapeutic Antibodies; and (2) Immunomodulatory Antibodies for Cancer Therapy.

  6. Drinking Status Between Ages 50 and 55 for Men From the San Diego Prospective Study Who Developed DSM-IV Alcohol Abuse or Dependence in Prior Follow-Ups. (United States)

    Gonçalves, Priscila Dib; Schuckit, Marc A; Smith, Tom L


    Although alcohol use disorders (AUDs) are prevalent among older individuals, few studies have examined the course and predictors of AUDs from their onset into the person's 50s. This study describes the AUD course from ages 50 to 55 in participants who developed AUDs according to criteria from the Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition (DSM-IV), during the San Diego Prospective Study (SDPS). Among the 397 university students in the SDPS who were followed about every 5 years from age 20 (before AUD onset), 165 developed AUDs, 156 of whom were interviewed at age 55. Age 50-55 outcomes were compared regarding age 20-50 characteristics. Variables that differed significantly across outcome groups were evaluated using binary logistic regression analyses predicting each outcome type. Between ages 50 and 55, 16% had low-risk drinking, 36% had high-risk drinking, 38% met DSM-5 AUD criteria, and 10% were abstinent. Baseline predictors of outcome at ages 50-55 included earlier low levels of response to alcohol predicting DSM-5 AUDs and abstinence, higher drinking frequency predicting DSM-5 diagnoses and lower predicting low-risk drinking, higher participation in treatment and/or self-help groups predicting abstinence and lower predicting DSM-5 AUDs, later ages of AUD onset predicting high-risk drinking, and cannabis use disorders predicting abstinent outcomes. Despite the high functioning of these men, few were abstinent or maintained low-risk drinking during the recent 5 years, and 38% met DSM-5 AUD criteria. The data may be helpful to both clinicians and researchers predicting the future course of AUDs in their older patients and research participants.

  7. IBC's 23rd Antibody Engineering and 10th Antibody Therapeutics Conferences and the Annual Meeting of The Antibody Society: December 2-6, 2012, San Diego, CA. (United States)

    Marquardt, John; Begent, Richard H J; Chester, Kerry; Huston, James S; Bradbury, Andrew; Scott, Jamie K; Thorpe, Philip E; Veldman, Trudi; Reichert, Janice M; Weiner, Louis M


    Now in its 23rd and 10th years, respectively, the Antibody Engineering and Antibody Therapeutics conferences are the Annual Meeting of The Antibody Society. The scientific program covers the full spectrum of challenges in antibody research and development from basic science through clinical development. In this preview of the conferences, the chairs provide their thoughts on sessions that will allow participants to track emerging trends in (1) the development of next-generation immunomodulatory antibodies; (2) the complexity of the environment in which antibodies must function; (3) antibody-targeted central nervous system (CNS) therapies that cross the blood brain barrier; (4) the extension of antibody half-life for improved efficacy and pharmacokinetics (PK)/pharmacodynamics (PD); and (5) the application of next generation DNA sequencing to accelerate antibody research. A pre-conference workshop on Sunday, December 2, 2012 will update participants on recent intellectual property (IP) law changes that affect antibody research, including biosimilar legislation, the America Invents Act and recent court cases. Keynote presentations will be given by Andreas Plückthun (University of Zürich), who will speak on engineering receptor ligands with powerful cellular responses; Gregory Friberg (Amgen Inc.), who will provide clinical updates of bispecific antibodies; James D. Marks (University of California, San Francisco), who will discuss a systems approach to generating tumor targeting antibodies; Dario Neri (Swiss Federal Institute of Technology Zürich), who will speak about delivering immune modulators at the sites of disease; William M. Pardridge (University of California, Los Angeles), who will discuss delivery across the blood-brain barrier; and Peter Senter (Seattle Genetics, Inc.), who will present his vision for the future of antibody-drug conjugates. For more information on these meetings or to register to attend, please visit www

  8. Summer Science Camps Program (SSC). (United States)

    National Science Foundation, Washington, DC. Directorate for Education and Human Resources.

    The Summer Science Camps (SSC) Program supports residential and commuter enrichment projects for seventh through ninth grade minority students who are underrepresented in science, engineering, and mathematics. Eligible organizations include school districts, museums, colleges, universities, and nonprofit youth-centered and/or community-based…

  9. Dicty_cDB: SSC733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC733 (Link to dictyBase) - G02125 DDB0216410 Contig-U04767-1 SSC...733E (Link to Original site) - - - - - - SSC733E 564 Show SSC733 Library SS (Link to library) Clone ID SSC...riginal site URL ...Representative seq. ID SSC733E (Link to Original site) Representative DNA sequence >SSC733 (SSC733Q) /CSM/SS/SSC7-B/SSC...niikeng*nkmeisrs*ic*kgrsqt*ktrrr*rs*rrs*rrrwck*rkwwre kescskki*ntnyiiiiiiiivihq**

  10. Dicty_cDB: SSC707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC707 (Link to dictyBase) - G23635 DDB0189725 Contig-U16533-1 SSC...707F (Link to Original site) SSC707F 721 - - - - - - Show SSC707 Library SS (Link to library) Clone ID SSC...riginal site URL ...Representative seq. ID SSC707F (Link to Original site) Representative DNA sequence >SSC707 (SSC707Q) /CSM/SS/SSC7-A/SSC... Frames) Frame A: kkkkkkkkkknlfiy*ftyi**ylliyxxiyththallvifsnniflfiiyiiyphflyi hnfqik*realhf*vysc

  11. Dicty_cDB: SSC446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC446 (Link to dictyBase) - - - Contig-U14332-1 SSC446F (Link to Original site) SSC...446F 303 - - - - - - Show SSC446 Library SS (Link to library) Clone ID SSC446 (Link Representative seq. ID SSC44...6F (Link to Original site) Representative DNA sequence >SSC446 (SSC446Q) /CSM/SS/SSC4-B/SSC446Q.Seq.d/ TAAAA...d Amino Acid sequence (All Frames) Frame A: *kh*kktivf*kiiyyiiylnknfhcqifkilk*nviqiiksiiqlfiiinefiisckfi ini

  12. Dicty_cDB: SSC336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC336 (Link to dictyBase) - - - Contig-U14396-1 SSC336E (Link... to Original site) - - - - - - SSC336E 521 Show SSC336 Library SS (Link to library) Clone ID SSC336 (Link Representative seq. ID SSC33...6E (Link to Original site) Representative DNA sequence >SSC336 (SSC336Q) /CSM/SS/SSC3-B/SSC336Q.Seq.d/*iikfkneiiisfiissfnifsigti*rslfcfknlsrq*fyfqin*frkntksqr yfvwkgn*rsscng*n*kvk*rl*skvflsy*pryshifqygh*sl*cy

  13. Dicty_cDB: SSC193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC193 (Link to dictyBase) - - - Contig-U10256-1 SSC193F (Link to Original site) SSC...193F 589 - - - - - - Show SSC193 Library SS (Link to library) Clone ID SSC193 (Link Representative seq. ID SSC19...3F (Link to Original site) Representative DNA sequence >SSC193 (SSC193Q) /CSM/SS/SSC1-D/SSC193Q.Seq.d/ GTTGT...nce (All Frames) Frame A: vvlldnlllffkflqffvlnitqt*nknglnqkkikqrriicsfr*rtsc*ikrsf*tl* *rknwfh*kgclknhl*tiwc

  14. Dicty_cDB: SSC302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC302 (Link to dictyBase) - - - Contig-U16354-1 SSC302Z (Link... to Original site) - - SSC302Z 640 - - - - Show SSC302 Library SS (Link to library) Clone ID SSC302 (Link Representative seq. ID SSC30...2Z (Link to Original site) Representative DNA sequence >SSC302 (SSC302Q) /CSM/SS/SSC3-A/SSC302Q.Seq.d/ XXXXX...lxixlfkffxk*nl*mxinnygiwnnklfivlgdfgi**rtpevhtw lrichylypih*rnfqqs*veqlhldcfylpncilhpmrsfhpyqchslsrscyrcc*lp

  15. Dicty_cDB: SSC494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC494 (Link to dictyBase) - - - Contig-U13836-1 SSC494Z (Link... to Original site) - - SSC494Z 580 - - - - Show SSC494 Library SS (Link to library) Clone ID SSC494 (Link Representative seq. ID SSC49...4Z (Link to Original site) Representative DNA sequence >SSC494 (SSC494Q) /CSM/SS/SSC4-D/SSC494Q.Seq.d/ XXXXX...SLCYLSLGRNG NALQNLPPTLETLKYYGEVQTDLNIKSIPHVKNLLIPFNNHSIIIDTIPPTVKYLAWGKL KDLEAIETLKNLPPSVNDLTFSCPPDVFDKIQRKH

  16. Dicty_cDB: SSC343 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC343 (Link to dictyBase) - - - Contig-U16259-1 SSC343Z (Link... to Original site) - - SSC343Z 671 - - - - Show SSC343 Library SS (Link to library) Clone ID SSC343 (Link Representative seq. ID SSC34...3Z (Link to Original site) Representative DNA sequence >SSC343 (SSC343Q) /CSM/SS/SSC3-B/SSC343Q.Seq.d/ XXXXX...e 1997.11.25 Translated Amino Acid sequence ---tlv*KXWLEIHSCDSLTIVDTQTLTCSAPPGSGIKNAVSFMVKDAESKLSPPLFLDY SPP

  17. Dicty_cDB: SSC388 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC388 (Link to dictyBase) - G20828 DDB0168913 Contig-U04577-1 SSC...388Z (Link to Original site) - - SSC388Z 721 - - - - Show SSC388 Library SS (Link to library) Clone ID SSC...riginal site URL ...Representative seq. ID SSC388Z (Link to Original site) Representative DNA sequence >SSC388 (SSC388Q) /CSM/SS/SSC3-D/SSC...*k*lvfqmli* cmlii*v*clvqic*rrhqilk*mqfqcwmlvik*sly*lkiiiyfmiini**lid*k** *ie Frame B: ---ixsllghskevdqlvttsc

  18. Dicty_cDB: SSC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC760 (Link to dictyBase) - - - Contig-U16310-1 SSC760Z (Link... to Original site) - - SSC760Z 608 - - - - Show SSC760 Library SS (Link to library) Clone ID SSC760 (Link Representative seq. ID SSC76...0Z (Link to Original site) Representative DNA sequence >SSC760 (SSC760Q) /CSM/SS/SSC7-C/SSC760Q.Seq.d/ XXXXX...Translated Amino Acid sequence (All Frames) Frame A: ---tikryqrisfccqri*hpi*n*rcpkyfiirslknstnlikqsc*yrscftr

  19. Dicty_cDB: SSC144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC144 (Link to dictyBase) - - - Contig-U15118-1 SSC144F (Link to Original site) SSC...144F 703 - - - - - - Show SSC144 Library SS (Link to library) Clone ID SSC144 (Link Representative seq. ID SSC14...4F (Link to Original site) Representative DNA sequence >SSC144 (SSC144Q) /CSM/SS/SSC1-B/SSC144Q.Seq.d/ ATTAG...thc*rkpnqifhw*fiiwwccwcnlitlclpirfcpys fsc*cwywfsssihwfr*lylfnlqerrfnrfipwfwcicrrylclqscflwwlryc*rn fir*kqqesfilgfmgyrtsc

  20. Dicty_cDB: SSC228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC228 (Link to dictyBase) - - - Contig-U01537-1 SSC228Z (Link... to Original site) - - SSC228Z 516 - - - - Show SSC228 Library SS (Link to library) Clone ID SSC228 (Link Representative seq. ID SSC22...8Z (Link to Original site) Representative DNA sequence >SSC228 (SSC228Q) /CSM/SS/SSC2-B/SSC228Q.Seq.d/ XXXXX...s producing significant alignments: (bits) Value SSC228 (SSC228Q) /CSM/SS/SSC2-B/SSC2

  1. Dicty_cDB: SSC819 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC819 (Link to dictyBase) - - - Contig-U12197-1 SSC819F (Link to Original site) SSC...819F 341 - - - - - - Show SSC819 Library SS (Link to library) Clone ID SSC819 (Link Representative seq. ID SSC81...9F (Link to Original site) Representative DNA sequence >SSC819 (SSC819Q) /CSM/SS/SSC8-A/SSC819Q.Seq.d/ CAAAA...g significant alignments: (bits) Value SSC819 (SSC819Q) /CSM/SS/SSC8-A/SSC819Q.Seq.d/ 331 4e-90 VHP762 (VHP7

  2. Dicty_cDB: SSC523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC523 (Link to dictyBase) - - - Contig-U11366-1 SSC523F (Link to Original site) SSC...523F 570 - - - - - - Show SSC523 Library SS (Link to library) Clone ID SSC523 (Link Representative seq. ID SSC52...3F (Link to Original site) Representative DNA sequence >SSC523 (SSC523Q) /CSM/SS/SSC5-A/SSC523Q.Seq.d/ ATTAT...*rylghnkv--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSC523 (SSC523Q) /CSM/SS/SSC

  3. Dicty_cDB: SSC317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oideum slug cDNA, clone SSC561. 971 0.0 2 ( BJ375299 ) Dictyostelium disc...SS (Link to library) SSC317 (Link to dictyBase) - - - Contig-U15332-1 SSC317P (Link to Original site) SSC...317F 554 SSC317Z 162 SSC317P 716 - - Show SSC317 Library SS (Link to library) Clone ID SSC... URL Representative seq. ID SSC...317P (Link to Original site) Representative DNA sequence >SSC317 (SSC317Q) /CSM/SS/SSC3-A/SSC3

  4. Geothermal Developments at San Diego Gas & Electric

    Energy Technology Data Exchange (ETDEWEB)

    Anastas, George; Hoaglin, Gregory J.


    In 1972, the first well flow tests were conducted by NARCO and Magma Power to determine reservoir characteristics such as mass flow, temperature, stability, and mineral content of geothermal brine from the exploration wells. The results of these tests were encouraging. Brine temperatures were relatively hot, and salinity was less than previously experienced. Results were sufficient to justify further testing of the process design to determine an appropriate energy conversion cycle for a power plant. Both the flash cycle and binary cycle were considered. In the binary cycle, geothermal heat is transferred from hot brine to a secondary working fluid by means of heat exchangers. The heated secondary fluid expands to drive a turbine-generator. The flash cycle was rejected because the high measured noncondensible gas content of the brines seriously reduced the cycle efficiency. The reduced salinity was expected to result in reduced scaling characteristics. For these reasons the binary cycle was selected for initial design and field testing. In 1973, a series of field tests was conducted to support the design of the binary conversion cycle. Unfortunately, a rapid decline in heat exchanger performance resulting from scaling demonstrated a need to reevaluate the cycle design. A flash/binary process was chosen as the basis for facility design modifications and additional field testing. Design modifications were to use as much of the original design as possible in order to minimize cost. In March of 1974, SDG&E resumed field testing at Niland using reduced size models of the new flash/binary design. The 1974 test program confirmed the decision to modify the design, construction, and operation of the GLEF in a four-stage, flash/binary cycle configuration. In May of 1975, the design was completed and construction of the GLEF began. Startup operations were initiated and in June 1976 the facility was dedicated. In the fall of 1976 while debugging and initial operation was being accomplished, a test program was developed to provide additional basic information necessary for the design of a commercial flash/binary geothermal plant. The primary objective of the program was to develop binary heat exchanger heat design data under a variety of conditions.

  5. San Diego, California Coastal Digital Elevation Model (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's National Geophysical Data Center (NGDC) is building high-resolution digital elevation models (DEMs) for select U.S. coastal regions. These integrated...

  6. Hispanics of a San Diego Barrio. (United States)


    individuals though some are native born. Young men who adopt this lifestyle dress in distinct and uniform ways, speak a dialect that isa blend of...future generations of Spanish- speaking people" (Camarillo 1979, p. 78). Camarillo’s work deals primarily with the city of Santa Barbara, but he also...There, according to a former Mexicano resident of the area, they were confined to a segregated barrio in "the midst of the cruelest kind of poverty

  7. Dudleya Variegata Translocation - San Diego [ds654 (United States)

    California Department of Resources — At Mission Trails Regional Park, a translocation project of Dudleya variegata was conducted in efforts to save the population from a private property undergoing...

  8. Dicty_cDB: SSC770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ene for emp24/gp25... 307 2e-84 2 ( AU071934 ) Dictyostelium discoideum slug cDNA, clone SSC...770. 307 2e-84 2 ( AU071932 ) Dictyostelium discoideum slug cDNA, clone SSC765. 307 4e-83 2 ( AU2...SS (Link to library) SSC770 (Link to dictyBase) - - - Contig-U04772-1 SSC770F (Link to Original site) SSC...770F 195 - - - - - - Show SSC770 Library SS (Link to library) Clone ID SSC770 (Link Representative seq. ID SSC77

  9. Dicty_cDB: SSC470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C84194 ) Dictyostelium discoideum slug cDNA, clone SSC470. 930 0.0 1 ( C84184 ) Dictyostelium disc...oideum slug cDNA, clone SSC453. 930 0.0 1 ( AY171066 ) Dictyostelium discoideum extrachromo...SS (Link to library) SSC470 (Link to dictyBase) - - - Contig-U16581-1 SSC470E (Link... to Original site) - - - - - - SSC470E 523 Show SSC470 Library SS (Link to library) Clone ID SSC470 (Link Representative seq. ID SSC47

  10. Dicty_cDB: SSC290 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC290 (Link to dictyBase) ssc290 G20821 DDB0230026 Contig-U09317-1 SSC2...90P (Link to Original site) SSC290F 464 SSC290Z 194 SSC290P 658 - - Show SSC290 Library SS (Link to library) Clone ID SSC2...90 (Link to dictyBase) Atlas ID ssc290 NBRP ID G20821 dictyBase ID DDB0230026 Link t...o Contig Contig-U09317-1 Original site URL Representative seq. ID SSC290P (Link to Original site) Representative DNA sequence >SSC290 (SSC2

  11. Dicty_cDB: SSC307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC307 (Link to dictyBase) - G20822 DDB0191445 Contig-U09318-1 SSC...307P (Link to Original site) SSC307F 533 SSC307Z 179 SSC307P 712 - - Show SSC307 Library SS (Link to library) Clone ID SSC...ontig-U09318-1 Original site URL Representative seq. ID SSC307P (Link to Original site) Representative DNA sequence >SSC307 (SSC307Q) /CSM/SS/SSC...3-A/SSC307Q.Seq.d/ GGATATTCAAAAATTTTAAAAAAAGATCCACAATCATGGATGTGGATAATTGCACCATTC ATTTTATA

  12. Dicty_cDB: SSC451 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC451 (Link to dictyBase) - G00637 DDB0205938 Contig-U13400-1 SSC...451P (Link to Original site) SSC451F 480 SSC451Z 149 SSC451P 629 - - Show SSC451 Library SS (Link to library) Clone ID SSC...ontig-U13400-1 Original site URL Representative seq. ID SSC451P (Link to Original site) Representative DNA sequence >SSC451 (SSC451Q) /CSM/SS/SSC...4-C/SSC451Q.Seq.d/ CAACAAACAAAAAAAAAAAAAATTTAAATTTTTTACAAAAAAATGGCAGCATTAGAAAAT TTTTTAAT

  13. Dicty_cDB: SSC665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC665 (Link to dictyBase) - - - Contig-U16581-1 SSC665F (Link to Original site) SSC...665F 381 - - - - - - Show SSC665 Library SS (Link to library) Clone ID SSC665 (Link Representative seq. ID SSC66...5F (Link to Original site) Representative DNA sequence >SSC665 (SSC665Q) /CSM/SS/SSC6-C/SSC665Q.Seq.d/ ATATA...e-78 SSG321 (SSG321Q) /CSM/SS/SSG3-A/SSG321Q.Seq.d/ 291 4e-78 SSF109 (SSF109Q) /CSM/SS/SSF1-A/SSF109Q.Seq.d/ 291 4e-78 SSC665 (SSC

  14. Dicty_cDB: SSC166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC166 (Link to dictyBase) - - - Contig-U10142-1 SSC166P (Link to Original site) SSC...166F 609 SSC166Z 531 SSC166P 1140 - - Show SSC166 Library SS (Link to library) Clone ID SSC...e URL Representative seq. ID SSC...166P (Link to Original site) Representative DNA sequence >SSC166 (SSC166Q) /CSM/SS/SSC1-C/SSC...sf*nk*k***lvsfn*iik* ********nn*yy**kcsinnwc*tinnfk*k*ttttttttkrinys*tscksrrikksl *kg*cccslw*fsycnhciv*y---

  15. SSC 40 mm short model construction experience

    Energy Technology Data Exchange (ETDEWEB)

    Bossert, R.C.; Brandt, J.S.; Carson, J.A.; Dickey, C.E.; Gonczy, I.; Koska, W.A.; Strait, J.B.


    Several short model SSC magnets have been built and tested at Fermilab. They establish a preliminary step toward the construction of SSC long models. Many aspects of magnet design and construction are involved. Experience includes coil winding, curing and measuring, coil end part design and fabrication, ground insulation, instrumentation, collaring and yoke assembly. Fabrication techniques are explained. Design of tooling and magnet components not previously incorporated into SSC magnets are described. 14 refs., 18 figs., 2 tabs.

  16. Biophilic Design and Natural Education An Investigation on the Planning and Design of San Diego Zoo in USA%生物友好与自然教育美国圣地亚哥动物园规划设计研究

    Institute of Scientific and Technical Information of China (English)

    张天洁; 李程远; 朱瀚森


    2016年是美国圣地亚哥动物园建园100周年。该园集城市动物园、野生动物园和研究机构于一体,其动物展示与保护模式引领着世界范围动物园的发展。论文梳理评述美国圣地亚哥动物园的百年发展历程,按时间顺序和主要特征将其划分为笼舍陈列、沉浸观览、生境营造3个时期。并剖析该园当前所处生境营造时期的规划布局理念,阐释各生境的主题、特征及动植物物种配置,并揭示园内参观流线组织和互动性设计。总结圣地亚哥动物园的3个主要发展理念,即生物友好、自然教育和保护使命,以期为我国动物园的规划设计提供参考。%2016 is the 100th anniversary year of San Diego Zoo, USA. Integrating a city zoo, a wild safari and research institutes, the Zoo guides worldwide zoological development particularly in animal exhibition and conservation pattern. The paper examines the 100-year development process of the San Diego Zoo, and divides them into three periods chronological y according to main characteristics, namely the first period of cage display, the second period of immersion exhibition, and the third period of habitat organization. The research analyses the main concepts in planning and layout during the current period of habitat organization, and elucidates the individual habitat themes, characteristics and the arrangements of wildlife species. It reveals the organization of visiting lines and interactive design. The paper summarizes three main development ideas of the San Diego Zoo, i.e., biophilic, natural education and conversation mission. It intends to provide the references for the planning and design of zoos in China.

  17. Dicty_cDB: SSC771 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N ( C92009 ) Dictyostelium discoideum slug cDNA, clone SSC771. 375 0.0 3...SS (Link to library) SSC771 (Link to dictyBase) - - - Contig-U12865-1 SSC771Z (Link... to Original site) - - SSC771Z 520 - - - - Show SSC771 Library SS (Link to library) Clone ID SSC771 (Link Representative seq. ID SSC77...1Z (Link to Original site) Representative DNA sequence >SSC771 (SSC771Q) /CSM/SS/SSC7-C/SSC771Q.Seq.d/ XXXXX

  18. Dicty_cDB: SSC482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oideum slug cDNA, clone SSC482. 906 0.0 1 ( AU284498 ) Dictyostelium discoideum gamete cDNA clone:...SS (Link to library) SSC482 (Link to dictyBase) - - - Contig-U16310-1 SSC482Z (Link... to Original site) - - SSC482Z 585 - - - - Show SSC482 Library SS (Link to library) Clone ID SSC482 (Link Representative seq. ID SSC48...2Z (Link to Original site) Representative DNA sequence >SSC482 (SSC482Q) /CSM/SS/SSC4-D/SSC482Q.Seq.d/ XXXXX

  19. Dicty_cDB: SSC879 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC879 (Link to dictyBase) - G00650 DDB0231447 Contig-U04510-1 SSC...879E (Link to Original site) SSC879F 634 SSC879Z 660 SSC879P 1294 SSC879E 938 Show SSC879 Library SS (Li...nk to library) Clone ID SSC879 (Link to dictyBase) Atlas ID - NBRP ID G00650 dictyBase ID DDB0231447 Link to... Contig Contig-U04510-1 Original site URL Representative seq. ID SSC879E (Link to Original site) Representative DNA sequence >SSC879 (SSC

  20. Dicty_cDB: SSC604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC604 (Link to dictyBase) - - - Contig-U16255-1 SSC604Z (Link... to Original site) - - SSC604Z 674 - - - - Show SSC604 Library SS (Link to library) Clone ID SSC604 (Link Representative seq. ID SSC60...4Z (Link to Original site) Representative DNA sequence >SSC604 (SSC604Q) /CSM/SS/SSC6-A/SSC604Q.Seq.d/ XXXXX...klfxxxk****fnn*slssiitl*yyfnnntffnxqrlyk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSC

  1. Dicty_cDB: SSC765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( C92861 ) Dictyostelium discoideum slug cDNA, clone SSF515. 969 0.0 1 ( AU071932 ) Dictyostelium discoideum slug cDNA, clone SSC...765. 414 e-114 2 ( AU071934 ) Dictyostelium discoideum slug cDNA, clone SSC...SS (Link to library) SSC765 (Link to dictyBase) - G20269 DDB0215345 Contig-U04772-1 SSC...765F (Link to Original site) SSC765F 655 - - - - - - Show SSC765 Library SS (Link to library) Clone ID SSC...riginal site URL

  2. Dicty_cDB: SSC660 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC660 (Link to dictyBase) - - - Contig-U15495-1 SSC660E (Link... to Original site) - - - - - - SSC660E 553 Show SSC660 Library SS (Link to library) Clone ID SSC660 (Link Representative seq. ID SSC66...0E (Link to Original site) Representative DNA sequence >SSC660 (SSC660Q) /CSM/SS/SSC6-C/SSC660Q.Seq.d/ AAAAA...nwcrtfsrsnfrck*wwclg*iiry* yy*trr*wyscfiqkss*gic*gcfdwwsxiygy*g*ptkylw*kgsnwlcsc*nrpsnh cwhl***sptrisctyc*kv

  3. Wireless Power Control for Tactical MANET: Power Rate Bounds (United States)


    Allen David F. Schwartz Approved for public release. . SSC Pacific San Diego , CA 92152-5001 SB SSC Pacific San Diego ...and Naval Warfare Systems Center Pacific (SSC Pacific), San Diego , CA. Funding for this effort was provided by the SSC Pacific Naval Innovative...Delgado & Luna- Rivera ob- serve [7]: 5 “Therefore, the main challenge in distributed power control is to compensate the time-varying profiles of the

  4. Detector problems at the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Wojcicki, S.G.


    During the last couple of years there has been considerable concern expressed among the US high energy community as to whether detector limitations would prevent one from being able to fully exploit a luminosity of 10/sup 33/ cm/sup -2/ sec/sup -1/ at a hadron-hadron high energy collider. As a result of these concerns, a considerable amount of work has been done recently in trying to understand the nature of potential difficulties and the required R and D that needs to be performed. A lot of this work has been summarized in the 1984 DPF Summer Study at Snowmass. This paper attempts to review some of these results. This work is limited to the discussion of detector problems associated with the study of high energy hadron-hadron collisions. We shall start with the discussion of the desirable features of the detectors and of the SSC environment in which they will have to work. After a brief discussion of the model 4..pi.. detectors, we shall discuss specific detector aspects: lepton identification, tracking, calorimetry and computing and triggering. We shall end with some remarks about possible future course of events. 15 refs., 10 figs.

  5. Beam instability studies for the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Chou, W.


    Beam instability studies of the Superconducting Super Collider (SSC) during the period 1989--1993 are briefly reviewed in this paper. Various topics are covered: single bunch and multi-bunch, single beam and beam-beam, parasitic heating and active feedback, etc. Although the SSC will not be built, many of the results obtained from these studies remain as useful references to the accelerator community.

  6. 77 FR 34988 - Notice of Inventory Completion: San Diego State University, San Diego, CA (United States)


    ... site in Madera County, CA. This notice is published as part of the National Park Service's... individuals were removed from the Buchanan Reservoir site, SDSU-0368, MAD-117, (1972-15), located in Madera...

  7. 77 FR 46115 - Notice of Inventory Completion: San Diego Museum of Man, San Diego, CA (United States)


    ... [Federal Register Volume 77, Number 149 (Thursday, August 2, 2012)] [Notices] [Pages 46115-46116] [FR Doc No: 2012-18938] DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-NAGPRA-10772; 2200... Manager, National NAGPRA Program. [FR Doc. 2012-18938 Filed 8-1-12; 8:45 am] BILLING CODE 4312-50-P...

  8. Navigation Improvement Design Memorandum Number 1, General Design for San Diego Harbor, San Diego County, California. (United States)


    Silver Strand Beach is predominantly northward from its natural sand source at the Tijuana River to Zuniga Shoal. The natural source of sediment lost, since most of the Tijuana River drainage basin has been severed from the coast. Subsequently, the Silver Strand Beach area has been nourished...Strand Beach Park to the mouth of the Tijuana River. (3) Placing dredged material on the Silver Strand Beach would act as an immediate source of

  9. Dicty_cDB: SSC463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC463 (Link to dictyBase) - - - Contig-U04467-1 SSC463Z (Link... to Original site) - - SSC463Z 612 - - - - Show SSC463 Library SS (Link to library) Clone ID SSC463 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...IMXFXCSNNQVISSSLVSXNNCIYTVEMSGNIFCPTPTPTPTPT PTPTPNPTSNVPCKSSNGISITXSDIITCIGYGQSICTTSSGYSCEPNQTNGVLKCISPD NS...XCSNNQVISSSLVSXNNCIYTVEMSGNIFCPTPTPTPTPT PTPTPNPTSNVPCKSSNGISITXSDIITCIGYGQSICTTSSGYSCEPNQTNGVLKCISPD NSISCI

  10. Fixed target facility at the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Loken, S.C.; Morfin, J.G.


    The question of whether a facility for fixed target physics should be provided at the SSC must be answered before the final technical design of the SSC can be completed, particularly if the eventual form of extraction would influence the magnet design. To this end, an enthusiastic group of experimentalists, theoreticians and accelerator specialists have studied this point. The accelerator physics issues were addressed by a group led by E. Colton whose report is contained in these proceedings. The physics addressable by fixed target was considered by many of the Physics area working groups and in particular by the Structure Function Group. This report is the summary of the working group which considered various SSC fixed target experiments and determined which types of beams and detectors would be required. 13 references, 5 figures.

  11. SSC/BCD data acquisition system proposal

    Energy Technology Data Exchange (ETDEWEB)

    Barsotti, E.; Bowden, M.; Swoboda, C. [Fermilab, Batavia, IL (United States)


    The proposed new data acquisition system architecture takes event fragments off a detector over fiber optics and to a parallel event building switch. The parallel event building switch concept, taken from the telephone communications industry, along with expected technology improvements in fiber-optic data transmission speeds over the next few years, should allow data acquisition system rates to increase dramatically and exceed those rates needed for the SSC. This report briefly describes the switch architecture and fiber optics for a SSC data acquisition system.

  12. Marine Fouling and Thermal Dissipation of Undersea Wireless Power Transfer (United States)


    Warfare Systems Center Pacific (SSC Pacific), San Diego, CA. The Naval Innovative Science and Engineering ( NISE ) Program at SSC Pacific funded this team...Innovative Science and Engineering ( NISE ) Program (Applied Research) SSC Pacific, 53560 Hull Street, San Diego, CA 92152–5001 Approved for public

  13. Time measurment system at the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Arai, Yasuo [National Laboratory for High Energy Physics, Ibaraki (Japan)


    A proposal of time measurement system at the SSC experiment is described. An example of a possible scheme for central tracking chambers is shown. Designs of a preamp/shaper/discri chip and a time digitizer chip are described. A method to distribute system clock and power/cooling problems are also discussed.

  14. Ship to Shore Connector Amphibious Craft (SSC) (United States)


    Selected Acquisition Report (SAR) RCS: DD-A&T(Q&A)823-303 Ship to Shore Connector Amphibious Craft (SSC) As of FY 2017 President’s Budget Defense...Mission and Description 6 Executive Summary 7 Threshold Breaches 8 Schedule 9 Performance 11 Track to Budget 16 Cost and...Capability Production Document CY - Calendar Year DAB - Defense Acquisition Board DAE - Defense Acquisition Executive DAMIR - Defense Acquisition

  15. Longitudinal matching between SFC and SSC

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Q.M.; Tang, J.Y.; Wang, S.L. [Institute of Modern Physics, China Academy of Science, Lanzhou (China)


    In order to increase the beam current and to enhance the beam quality, an upgrading program of HIRFL is going on at HIRFL. As a part of this program, the longitudinal matching between injector SFC and main machine SSC will be improved. It consists of beam energy measurement, compensation of energy loss due to stripper and a new rebuncher system. In this paper, the study results are presented. (author)

  16. Dicty_cDB: SSC323 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC323 (Link to dictyBase) - - - Contig-U16278-1 SSC323E (Link... to Original site) - - - - - - SSC323E 765 Show SSC323 Library SS (Link to library) Clone ID SSC323 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16278-1 Original site URL http://dict... Amino Acid sequence xxnxitnxxnrliips*ilifsqq*FFLICTMGLAFGKLFSRFFGKKDMRILMVGLDAAG... Acid sequence (All Frames) Frame A: xxnxitnxxnrliips*ilifsqq*FFLICTMGLAFGKLFSRFF

  17. Characterizing exposure and potential impacts of contaminants on seabirds nesting at South San Diego Bay Unit of the San Diego National Wildlife Refuge (Salt Works, San Diego Bay) (United States)

    US Fish and Wildlife Service, Department of the Interior — In 2005, a two-year USFWS study (1261-1N74) was initiated to characterize contaminant exposure by seabirds that nest in colonies at the South Bay Salt Works, within...

  18. Experimental Operation of SSC RF Cavities at Higher Voltage

    Institute of Scientific and Technical Information of China (English)


    For many years,SSC RF cavities were operated at about half of its designing voltages,which are from 100 kV at 6.5 MHz to 250 kV at 14.5 MHz respectively.But,with the construction of new project HIRFL-CSR,high intensity beams are required to be extracted from SSC.Therefore,in order to achieve this aim,SSC Dee voltages must be enhanced to higher operation level.

  19. Multiple photon effects in $pp$ scattering at SSC energies

    CERN Document Server

    Delaney, D B; Shio, C; Siopsis, G; Ward, B F L


    The Monte Carlo program SSCYFS2 is used in conjunction with available parton distribution functions to calculate the effects of multiple photon radiation on pp scattering at SSC energies. Effects relevant to precision SSC physics such as Higgs discovery and exploration are illustrated.

  20. Ultra-Low Power Transmitter Test Results (United States)


    at the University of California, San Diego (UCSD) Bioengineering Department. The Naval Innovative Science and Engineering ( NISE ) Program at SSC...and Engineering ( NISE ) Program (Applied Research) SSC Pacific, 53560 Hull Street, San Diego, CA 92152–5001 Approved for public release

  1. Tijuana River Flood Control Project, San Diego County, California. (United States)


    heavier-rainfall watershed have reduced runoff, and the occurrence of a series of dryer -than-normal years which has not yet ended; and (c) the absence...bus Tumbling pigweed Ameranthus graucizans Red orache A triplex rosea Field mustard* Brassica campestris Black mustard Brassica nigra White goosefoot

  2. An android application for crime analysis in San Diego (United States)

    Gonchikara, Likhita

    Over the past few years, smartphone adoption has increased worldwide. In this era of smartphones, one of the easiest ways to make this information available to many users is through smartphone applications. Smartphone applications can provide requested information in a readable and user friendly format. Information related to data such as real estate, property, post offices, crime locations and many others can be very useful. Such information helps city planners, residents, students and commuters to identify and communicate trends and patterns about places. ESRI`s ARCGIS provides various services and tools which help visualize real-world features, discover patterns, obtain information, and communicate that information to others. When these services work in conjunction with GPS based location services in smartphones, they create new avenues for applications. This thesis implements an Android smartphone application with features to analyze location based crime data. The user of this application can view crime data in a region and filter different crime types. The application allows the user to query and analyze crimes that have occurred near his location or at a location of interest. The application includes features to measure distance between crime spots and also measure area on the map. The user can also switch the base-map from street map to NatGeo map. Powered with this information, renters and home buyers can ensure that their new home is in a safe location. Real estate agents can buy or sell property in safer locations. Commuters can find routes which avoid crime spots. Tourists can find accommodation in safer places. Students can be aware of the high crime rate areas around the school campus. This application uses ArcGIS feature service by ESRI to render all data on the map.

  3. An Organizational Analysis of Marine Corps Recruit Depot, San Diego (United States)


    generations, e.g., Gen-X and millennials . e. Process/Subsystems This design factor addresses: 1. Financial Management, Measurement and Controls...As the RTR CO says, “the beauty of this place is just basic Marine Corps leadership. MOS regardless.”70 More specifically, it’s “leadership...The fact that we can question what we are doing is beautiful .”74 He has begun a planning culture within Depot staff offices. Such thinking in

  4. Littoral Zone Sediments, San Diego, Region, October 1983-June 1984. (United States)


    corresponding foreshore samples within the five littoral segments at Lake Tahoe which show the most persistent grain-size fining trends. The value for the...terrains exposed at higher elevations as the dominant ultimate source rocks for the obtained sample set. 3.03 The Geologic Map of the Corona, Elsinore ...Austin, Texas, Hemphill’s Bookstore, 182 p. Gaynor, J. M., 1984, Sources and transport of sand in the littoral zone of Lake Tahoe, California and Nevada

  5. San Diego Coast Kelp Persistence (1967-1999) (United States)

    California Department of Resources — Giant kelp forests, with their extensive vertical structure, represent the most diverse of the marine habitats and support commercial fisheries, education, and...

  6. Conventional Anchor Test Results at San Diego and Indian Island (United States)


    34" ~~sponsor: Naval Facilities Engineering Command ’ program nos: YF59.5s6.091.01.205 C1 . CIVIL ENGINEERING LABORATORY C-> NAVAL CONSTRUCTION BATTALION CENTER...4 0 .0 P.fn STA - La qnr.F, L 1- 0 fl0PS1 FP.441 .. C1 1TtL *.- 111- 1 0, 0.n a40 -IN!JA T~~r A IPT AAFT PIN A I R CNAT AVA rrPVO n ;IT--VP . IFD F...t..4G 0191ANCF S. 8008010; &N;𔃺 4 . ’HAT% LrN6, .T. 000000 0. as . ,- TI Fvie w . 4. *NC"O*f 01801. A. nIF -77OPe .lrF 11. -lr- Tl01 r 𔄂 ivoo o

  7. San Diego Littoral Cell CRSMP Sensitive Habitat 2009 (United States)

    California Department of Resources — Specific concerns relate to the threatened snowy plover’s critical habitat, including nesting and wintering locations, as well as the endangered least tern’s...

  8. San Diego Littoral Cell CRSMP Sensitive Habitat 2009 (United States)

    California Department of Resources — Specific concerns relate to the threatened snowy plover’s critical habitat, including nesting and wintering locations, as well as the endangered least tern’s nesting...

  9. Marine Ecological Index Survey of San Diego Bay (United States)


    Tropical Environment,” Coral Reefs 26(2):279–289. Flournoy, L.E., R. P. Adams, and R. N. Pandey. 1996. “Interim and Archival Preservation of Plant...States: Assessing the Relative Importance of Habitat Destruction , Alien Species, Pollution, Overexploitation, and Disease,” BioScience 48(8): 607–15

  10. San Diego Littoral Cell CRSMP Upland Sand Source Sites 2009 (United States)

    California Department of Resources — Sediment sources of interest to this Coastal RSM Plan exist seaward of the coastal watershed drainage divide. These sources generally are more plentiful downstream...

  11. San Diego Littoral Cell CRSMP Upland Sand Source Sites 2009 (United States)

    California Department of Resources — Sediment sources of interest to this Coastal RSM Plan exist seaward of the coastal watershed drainage divide. These sources generally are more plentiful downstream...

  12. Two Chemical Spill Patterns in Tidally Dominated San Diego Bay (United States)


    wood, but currently, it is synthetically produced from carbon oxides and hydrogen. It has a faintly sweet pungent odor like that of ethyl alcohol. It...0.1586 in both air and water. Contact with ammonia could cause skin and eye burns and inhalation some burning sensation , cough, shortness of breath

  13. San Diego supercomputer center reaches data transfer milestone

    CERN Multimedia


    The SDSC's huge, updated tape storage system has illustrated its effectiveness by transferring data at 828 megabytes per second making it the fastest data archive system according to program director Phil Andrews (1/2 page).

  14. San Diego Region Nearshore Coastal Zone Seafloor Substrate (United States)

    California Department of Resources — The layer is meant to display those locations offshore where bedrock is present, as these locations may support sensitive habitats that could be adversely affected...

  15. Ports and Waterways Safety Assessment: San Diego Workshop Report (United States)


    o International conventions (SOLAS, STCW , etc.) • Recreational Vessels: o Recreational vessel safety checks by Coast Guard Auxiliary and Power...discussed. Existing Mitigations: • STCW training requirements. • ISO requirements. • Coast Guard licensing standards. • Commercial vessel in-house

  16. Superconductor procurement and R and D for SSC

    Energy Technology Data Exchange (ETDEWEB)

    Scanlan, R.; Royet, J.; Hannaford, R.; Horler, D.


    We describe the results of superconductor procurements for SSC dipole model magnets. Most results will pertain to LBL procurements for the LBL-BNL collaboration; however, where appropriate to complete the SSC data base, reference will be made to material purchased by FNAL and TAC. Also, most of the results to be presented will relate to the conventional SSC conductors, i.e., with filament sizes in the range of 15 to 25 Some information on fine filament NbTi material, such as quantities and delivery schedules, will be presented here; fine filament NbTi R and D is described in another section.

  17. Employers and Families: Strategies for Mutual Benefit. San Diego Symposium (San Diego, California, April 15, 1983). [Summary]. (United States)

    Hewes, Dorothy W.; And Others

    Pros and cons of family-related benefits from both the employee's and the employer's viewpoints are first delineated in this transcription summarizing symposium presentations. Subsequent addresses focus on (1) the acceptability, availability, and affordability of employer-supported day care (in slide/cassette format); (2) reasons for and ways of…

  18. Mobile Platform Development for SSC Propulsion Test Operations Project (United States)

    National Aeronautics and Space Administration — A review of mobile applications (apps) and portable electronic tools/mobile platforms (that could be used by propulsion testing field users at SSC) was conducted....

  19. A simulation of data acquisition system for SSC experiments

    Energy Technology Data Exchange (ETDEWEB)

    Watase, Y.; Ikeda, H. [National Laboratory for High Energy Physics (KEK), Tsukuba, Ibaraki (Japan)


    A simulation on some parts of the data acquisition system was performed using a general purpose simulation language GPSS. Several results of the simulation are discussed for the data acquisition system for the SSC experiment.

  20. SSC-K code user's manual

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Y.M.; Lee, Y.B.; Chang, W.P.; Hahn, D


    The Supper System Code of KAERI (SSC-K) is a best-estimate system code for analyzing a variety of off-normal or accidents in the heat transport system of a pool type LMR design. It is being developed at Korea Atomic Energy Research Inititution (KAERI) on the basis of SSC-L, originally developed at BNL to analyze loop-type LMR transients. SSC-K can handle both designs of loop and pool type LMRs. SSC-K contains detailed mechanistic models of transient thermal, hydraulic, neutronic, and mechanical phenomena to describe the response of the reactor core, coolant, fuel elements, and structures to accident conditions. This report provides an overview of recent model developmentsvfor the SSC-K computer code, focusing on phenomenological model descriptions for new thermal, hydraulic, neutronic, and mechnaical modules. A comprehensive description of the models for pool-type reactor is given in Chapters 2 and 3; the steady-state plant characterization, prior to the initiation of transient is described in Chapter 2 and their transient counterparts are discussed in Chapter 3. In Chapter 4, a discussion on the intermediate heat exchanger (IHX) is presented. The IHX model of SSC-K is similar to that used in the SSC-L, except for some changes required for the pool-type configuration of reactor vessel. In Chapter 5, an electromagnetic (EM) pump is modeled as a component. There are two pump choices available in SSC-K; a centrifugal pump which was originally imbedded into the SSC-L, and an EM pump which was introduced for the KALIMER design. In Chapter 6, a model of passive safety decay heat removal system(PSDRS) is discussed, which removes decay heat through the reactor and containment vessel walls to the ambient air heat sink. In Chapter 7, models for various reactivity feedback effects are discussed. Reactivity effects of importance in fast reactor include the Doppler effect, effects of sodium density changes, effects of dimensional changes in core geometry. Finally in Chapter 8

  1. Diego de Urrea en Italia

    Directory of Open Access Journals (Sweden)

    Rodríguez Mediano, Fernando


    Full Text Available This paper deals with the Italian sojourn of Diego de Urrea, who spent the last years of his life in Naples. His relationship with the Italian learned milieu, especially with Prince Federico Cesi and his Accademia dei Lincei, of which Galileo Galilei was a member, sheds some light on the traits of the Italian "orientalism" at that time, and its coincidences and differences with what happened in Spain at the beginning of the 17th Century, when the affaire of the "Lead Books of the Sacromonte" was an essential factor in the way in which Arabic and the Islamic past was to be incorporated in the history of Spain.

    Este artículo trata de la estancia en Italia del traductor del árabe Diego de Urrea, que pasó los últimos años de su vida en Nápoles. Su relación con círculos eruditos italianos, como el del príncipe Federico Cesi y su Accademia dei Lincei, a la que perteneció Galileo, pone de relieve algunos de los rasgos característicos del «orientalismo» italiano de la época, y sus relaciones y diferencias con lo que ocurría en España a comienzos de s. XVII, cuando el asunto de los Plomos del Sacromonte ejerció un papel fundamental en la definición de la lengua y la historia árabes dentro de la historia de España.

  2. SSC: Gesture-based game for initial dementia examination

    Institute of Scientific and Technical Information of China (English)

    LIU Jun-fa; CHEN Yi-qiang; XIE Chen; GAO Wen


    This paper presents a novel system assisting medical dementia examination in a joyful way: the object just needs to play a popular game SSC against the computer during the examination. The SSC game's target is to detect the player's reacting capability, which is related closely with dementia. Our system reaches this target with some advantages: there are no temporal and spatial constraints at all. There is no cost, and it can even improve people's mental status. Hand talk technology and EHMM gesture recognition approach are employed to realize the human computer interface. Experiments showed that this system can evaluate people's reacting capability effectively and is helpful for initial dementia examination.

  3. The Influence of Niobium on SSC Resistance in API Steels

    Energy Technology Data Exchange (ETDEWEB)

    Malina, J.; Malina, M.; Novosel-Radovic, V. [Zagreb Univ., Faculty of Metallurgy (Croatia)


    Full text of publication follows: Oil country tubular goods are often exposed to aggressive sour environments in oil wells where H{sub 2}S promotes sulfide stress cracking, SSC. This is one of the most dangerous corrosion phenomena characterized by unpredictable and sudden cracking of steel constructions in service. SSC results in a variety of fracture features having a common relationship to the presence of hydrogen in metal and therefore it belongs to hydrogen embrittlement phenomena, HE. For the production of sulfide stress cracking resistant (SSC) tubing from steels included in Group 3 of API Specification 5CT, in this study two experimental Cr-Mo steels (without niobium and with niobium microalloyed) were tested. The influence of Nb precipitates in pipeline steels on the sensitivity to sulfide stress cracking was examined in laboratory experiments using three point bent beam tests. High mechanical properties were achieved through quenching and tempering procedures. Better corrosion resistance of Nb-containing steel is the consequence of microstructural parameters obtained through strengthening mechanism with microalloying element. Besides the usual mechanical, metallographic, SEM and TEM analyses, as complementary method the X-ray diffraction was used. It was revealed that tetragonality of crystal lattice, dislocation density and residual stresses are in good correlation with Sc-vales from corrosion tests. Nb precipitates (especially niobium carbides) have beneficial influence when producing the steels with low sensitivity to SSC. (authors)

  4. The Diego blood group system: a review. (United States)

    Figueroa, Dolores


    The Diego blood group system (DI) currently encompasses 22 antigens. Three of the antigens are of high prevalence and the other 19 are of low prevalence. The antigens of the Diego blood group system are carried on the erythroid band 3 protein anion exchanger 1 (AE1), the product of a single gene, SLC4A1 (solute carrier family 4, anion exchanger, member 1). AE1 is a member of a family of three anion exchangers or transporters expressed in a variety of tissues. This protein is involved in carbon dioxide transport from tissues to lungs. It is also found in the kidney,where it is involved in acid secretion. Antibodies to Diego system antigens with the exception of anti-Dia, -Dib, -Wra, -ELO and-DISK do not seem to be of clinical significance for transfusion or of importance in hemolytic disease of the fetus and newborn.

  5. Anti-proteinase 3 antibodies in diffuse systemic sclerosis (SSc with normotensive renal impairment: is it suggestive for an overlapping between SSc and idiopathic vasculitis?

    Directory of Open Access Journals (Sweden)

    V. Campanella


    Full Text Available Objective. To test the prevalence of anti-neutrophil cytoplasmic antibodies (ANCA in systemic sclerosis (SSc and to verify a possible association of ANCA with normotensive renal involvement in SSc. Patients and methods: 51 patients affected by SSc, 35 with diffuse scleroderma (dSSc and 16 with limited scleroderma (lSSc, were tested for ANCA by indirect immunofluorescence (IIF on human ethanol and formalin-acetone-fixed granulocytes (before and after DNase treatment, by conventional enzyme linked immuno-sorbent assay (ELISA and by capture-ELISA. Results. Six out of 51 selected SSc patients had ANCA by IIF (11.7% and five presented a perinuclear/nuclear atypical ANCA pattern. In all cases we only found anti-proteinase3 (aPR3 antibodies. All ANCA positive patients had diffuse form of SSc (17.1%, all were anti-Scl70 positive (aScl70, five patients had proteinuria, three had microscopic haematuria. All ANCA positive patients were normotensive with normal renin plasma levels, the mean erythrocyte sedimentation rate (ESR was higher in this group compared to the other SSc patients. Conclusions. Our study shows that aPR3 is not rare in dSSc. According to the clinical and serological findings and to the recent literature, we can hypothesise that when ANCA are found in SSc, an overlapping of scleroderma with systemic necrotizing vasculitis should be suspected.

  6. Finding Diego: A Bilingual Student Integrates School, Language, and Identity (United States)

    Danzak, Robin L.; Wilkinson, Louise C.


    This article presents a mixed-methods case study of Diego, a bilingual teen who completed public school in Florida. During adolescence, Diego negotiated multiple identities: successful student, Mexican American, bilingual, and typical U.S. teenager. Diego provided interviews and bilingual (English/Spanish) writing (narrative/expository) in 2008…

  7. Capture Matrices Handbook (United States)


    SSC Pacific San Diego , CA 92152-5001 SB SSC Pacific San Diego , California 92152-5001 K. J. Rothenhaus, CAPT, USN...Pacific), San Diego , CA. The Naval Innovative Science and Engineering (NISE) Program at SSC Pacific funded this effort as a Basic Research project...Barreto-Cabán, and S. P. Hernández- Rivera . 2008. “Enhanced Raman Scattering of 2,4,6-TNT Using Metallic Colloids,” IEEE Sensors Journal 8:974‒ 982. 8

  8. San Francisco District Laboratory (SAN) (United States)

    Federal Laboratory Consortium — Program Capabilities Food Analysis SAN-DO Laboratory has an expert in elemental analysis who frequently performs field inspections of materials. A recently acquired...

  9. Minisparker seismic-reflection data of field activity S-5-09-SC: San Pedro Basin, offshore southern California from 2009-07-06 to 2009-07-10 (United States)

    U.S. Geological Survey, Department of the Interior — This dataset includes raw and processed, high-resolution seismic-reflection data collected in 2009 to explore a possible connection between the San Diego Trough...

  10. Dicty_cDB: SSC537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available riginal site URL ...RAFT SEQUENCE, 26 unordered pieces. 48 0.11 1 BH238352 |BH238352.1 ATYCE41TR ATYC Arabidopsis thaliana genomic clone ATYC... 48 0.30 2 BH238452 |BH238452.1 ATYCG46TF ATYC Arabidopsis thaliana genomic clone ATYC...G46, DNA sequence. 36 0.34 2 BH239363 |BH239363.1 ATYCH35TR ATYC Arabidopsis thaliana genomic clone ATYC...H35, DNA sequence. 36 0.34 2 BH239114 |BH239114.1 ATYCK83TF ATYC Arabidopsis thaliana genomic clone ATYCK83

  11. Strain energy minimization in SSC (Superconducting Super Collider) magnet winding

    Energy Technology Data Exchange (ETDEWEB)

    Cook, J.M.


    Differential geometry provides a natural family of coordinate systems, the Frenet frame, in which to specify the geometric properties of magnet winding. By a modification of the Euler-Bernoulli thin rod model, the strain energy is defined with respect to this frame. Then it is minimized by a direct method from the calculus of variations. The mathematics, its implementation in a computer program, and some analysis of an SSC dipole by the program will be described. 16 refs.

  12. Technology and materials for the Superconducting Super Collider (SSC) project

    Energy Technology Data Exchange (ETDEWEB)

    Shintomi, Takakazu; Ishimaru, Hajime; Unno, Yoshinobu; Arai, Yasuo; Watase, Yoshiyuki; Amako, Katsuya; Kondo, Takahiko (National Lab. for High Energy Physics, Tsukuba, Ibaraki (Japan))


    The Superconducting Super Collider (SSC) is the accelerator for the research on elementary particle physics, of which the construction was already begun in Texas, USA. Two proton rings comprising about 10,000 superconducting magnets are installed in an underground tunnel with the circumferential length of 87 km, and the proton-proton collision of superhigh energy is realized. This accelerator becomes the largest machine that mankind makes. In this report, among the high-tech and materials used for the SSC, superconducting magnets, super-high vacuum beam pipes, silicon semiconductor detector, the use of VLSI and superhigh density mounting and high speed, large quantity data processing system are taken up, and the outline of those is described. The SSC was planned for the elucidation of Higg's theory. The incidence accelerator group is composed of a linear accelerator and three booster synchrotrons. The particles generated by proton-proton collision are measured, and the discovery of new particles and the study on high energy physical phenomena are carried out. The construction of the accelerator and experimental equipment is carried out by international cooperation. (K.I.).

  13. San Francisco District Laboratory (SAN) (United States)

    Federal Laboratory Consortium — Program CapabilitiesFood Analysis SAN-DO Laboratory has an expert in elemental analysis who frequently performs field inspections of materials. A recently acquired...

  14. Measurement of Infrasound from the Marine Environment (United States)


    Code 56400), Space and Naval Warfare Systems Center Pacific (SSC Pacific), San Diego, CA. The SSC Pacific Naval Innovative Science and Engineering ( NISE ...92152-5001 TR 2092 Space and Naval Warfare Systems Center Pacific Naval Innovative Science and Engineering ( NISE ) Program 53560 Hull Street San

  15. The MAGIC of SSC and how it affects LHC

    CERN Document Server

    Mavromatos, Nick E


    We discuss the phenomenology of Supercritical String Cosmology (SSC) in the context of Dark Matter constraints on supersymmetric particle physics models at LHC. We also link our results with recent findings of the MAGIC, H.E.S.S. and Fermi Telescopes on delayed arrival of highly energetic photons from the distant Galaxies and GRBs. The link is provided by a concrete model of space-time foam in (supercritical) string theory, involving space-time defects and their interaction with matter in a brane world scenario.

  16. On the Use of SSC Method in English Teaching

    Institute of Scientific and Technical Information of China (English)



    @@ Structural, Situational and Communicative (SSC) method stresses on situation. In these situations, the teacher can mix new language structures with old knowledge structures.English is a foreign language for the students of our country, most of them lack the circumstance to study and use it. The interesting and natural situations what the teacher set up just can arouse the interest of the students' studying English, so the situations can foster the students' communicative ability and make them practice the language easily and actively.

  17. Delta-function Approximation SSC Model in 3C 273

    Indian Academy of Sciences (India)

    S. J. Kang; Y. G. Zheng; Q. Wu


    We obtain an approximate analytical solution using approximate calculation on the traditional one-zone synchrotron self-Compton (SSC) model. In this model, we describe the electron energy distribution by a broken power-law function with a sharp cut-off, and non-thermal photons are produced by both synchrotron and inverse Compton scattering of synchrotron photons. We calculate the radiation energy spectrum of electrons by the function. We apply this model to the multi-wavelength Spectral Energy Distributions (SED) of the 3C 273 in different states, and obtain excellent fits to the observed spectra of this source.

  18. Coil end design for the SSC collider dipole magnet

    Energy Technology Data Exchange (ETDEWEB)

    Brandt, J.; Bartlett, N.; Bossert, R.; Carson, J.; Konc, J.; Lee, G. [Fermi National Accelerator Lab., Batavia, IL (United States); Cook, J. [Argonne National Lab., IL (United States); Caspi, S. [Lawrence Berkeley Lab., CA (United States); Gordon, M.; Nobrega, F. [Superconducting Super Collider Lab., Dallas, TX (United States)


    This paper describes the design of the coil end for the 50mm aperture SSC collider dipole magnets built at Fermilab. The cable paths are determined from both magnetic and mechanical considerations. The end spacers are designed using the developable surface, grouped end approach, which allows the analysis of strain energy within the conductor groups. Techniques for strain energy minimization are presented and the behavior of individual conductors within a group is analyzed. The relationship between optimization of magnetic and mechanical variables is discussed. Requirements of manufacturing and inspection of coil end parts are outlined. 7 refs.

  19. SSC (Superconducting Super Collider) dipole coil production tooling

    Energy Technology Data Exchange (ETDEWEB)

    Carson, J.A.; Barczak, E.J.; Bossert, R.C.; Brandt, J.S.; Smith, G.A.


    Superconducting Super Collider dipole coils must be produced to high precision to ensure uniform prestress and even conductor distribution within the collared coil assembly. Tooling is being prepared at Fermilab for the production of high precision 1M and 16.6M SSC dipole coils suitable for mass production. The design and construction methods builds on the Tevatron tooling and production experience. Details of the design and construction methods and measured coil uniformity of 1M coils will be presented. 4 refs., 10 figs.

  20. Object-oriented system building for the SSC

    Energy Technology Data Exchange (ETDEWEB)

    Ludgate, G.A. [TRIUMF, Vancouver (Canada)


    The concepts and terminology of object-oriented system development are presented assuming the reader is familiar with the Structured Analysis and Structured Design (SA/SD) methodology. An improvement to SA/SD, known as Object Oriented Analysis/Object Oriented Design (OOA/OOD) is described and the steps in such an undertaking explained. Object Oriented Programming (OOP) is briefly introduced before SA/SD and OOA/OOD are compared. A recommendation to the SSC Central Design Group concludes the paper.

  1. Environmental Assessment: San Antonio Creek Restoration at Vandenberg Air Force Base, California (United States)


    Potential Masticophis lateralis Chaparral whipsnake Potential Lampropeltis getula California kingsnake Observed Pituophis catenifer San Diego... introduction of exotic predators, were important factors in the decline ofthe California red-legged frog in the early to mid-1900s. Continuing threats...master’s thesis, University of California , Santa Barbara. Grant, C. 1978a. Chumash: Introduction . In California , edited by Robert F. Heizer, pp. 505

  2. Report of the task force on SSC commissioning and operations

    Energy Technology Data Exchange (ETDEWEB)



    In 1985 January a Taskforce was organized to study the impact of magnet design on the commissioning and operation of the SSC. The results of the study, in the form of this report, are intended as one of several sources of input for the Magnet Type Selection Committee. Other major input will come from the Magnet Taskforce, the Test String Taskforce, the Cost Estimating Taskforce, and other study groups. All of these efforts will culminate in a magnet type selection, after which concentrated R&D on the selected magnet can commence. The study began with a one-week workshop, held on the UC Berkeley campus in 1985 January 14--18. An interim report of the Taskforce, based on the results of the Workshop, was published on 1985 January 28 (SSC-05). With very few exceptions, the work of the Taskforce was carried out by the participants in the Workshop, both during the workshop and in the subsequent weeks. This report is the collective effort of that group, whose very substantial contribution of time, effort, and thought is gratefully acknowledged.

  3. Near Field HF Antenna Pattern Measurement Method Using an Antenna Pattern Range (United States)


    Naval Warfare Systems Center Pacific (SSC Pacific), San Diego, CA. The Naval Innovative Science and Engineering ( NISE ) Program at SSC Pacific provided...shall be subject to any penalty for failing to comply with a collection of information if it does not display a currently valid OMB control number...Pacific Naval Innovative Science and Engineering ( NISE ) Program 53560 Hull Street San Diego, CA 92152–5001 Approved for public release. This is

  4. Film Implementation of a Neutron Detector (FIND): Critical Materials Properties (United States)


    the BN film (~ 2.3), and is the wavelength of the light. Note that n < nSi ( nSi ≈ 3.9 for blue light), and so no phase shift exists at the film...Properties of Cubic Boron Nitride,” ILIR’00: SSC San Diego In-House Laboratory Independent Research 2000 Annual Report, SSC San Diego TD 3115 (May), pp

  5. San Marino. (United States)


    San Marino, an independent republic located in north central Italy, in 1983 had a population of 22,206 growing at an annual rate of .9%. The literacy rate is 97% and the infant mortality rate is 9.6/1000. The terrain is mountainous and the climate is moderate. According to local tradition, San Marino was founded by a Christian stonecutter in the 4th century A.D. as a refuge against religious persecution. Its recorded history began in the 9th century, and it has survived assaults on its independence by the papacy, the Malatesta lords of Rimini, Cesare Borgia, Napoleon, and Mussolini. An 1862 treaty with the newly formed Kingdom of Italy has been periodically renewed and amended. The present government is an alliance between the socialists and communists. San Marino has had its own statutes and governmental institutions since the 11th century. Legislative authority at present is vested in a 60-member unicameral parliament. Executive authority is exercised by the 11-member Congress of State, the members of which head the various administrative departments of the goverment. The posts are divided among the parties which form the coalition government. Judicial authority is partly exercised by Italian magistrates in civil and criminal cases. San Marino's policies are tied to Italy's and political organizations and labor unions active in Italy are also active in San Marino. Since World War II, there has been intense rivalry between 2 political coalitions, the Popular Alliance composed of the Christian Democratic Party and the Independent Social Democratic Party, and the Liberty Committee, coalition of the Communist Party and the Socialist Party. San Marino's gross domestic product was $137 million and its per capita income was $6290 in 1980. The principal economic activities are farming and livestock raising, along with some light manufacturing. Foreign transactions are dominated by tourism. The government derives most of its revenue from the sale of postage stamps to

  6. Diego Meneses Almeida, ejemplo de docente consagrado

    Directory of Open Access Journals (Sweden)

    Denia Morales Navarro

    Full Text Available Dentro de las figuras de obligatoria mención en la historia de la Cirugía Maxilofacial cubana emerge la de Diego Meneses Almeida, prestigioso cirujano y docente nato recientemente fallecido, lo cual sirvió de motivación para realizar este trabajo y reseñar sintéticamente la vida y obra de este querido Profesor. Bajo el precepto de que enseñar es un ejercicio de inmortalidad, su figura ilumina nuestro camino como docente consagrado a la enseñanza de las nuevas generaciones de profesionales en los senderos apasionantes de la cirugía.

  7. Particle-In-Cell Simulation of RFQ in SSC - Linac

    CERN Document Server

    Chen, Xiao; You-Jin, Yuan; Yong, Liu; Jia-Wen, Xia; Yuan-Rong, Lu; Batygin, Yuri


    A 52MHz Radio Frequency Quadrupole (RFQ) linear accelerator (linac) is designed to serve as an initial structure for the SSC-linac system (injector into Separated Sector Cyclotron). The designed injection and output energy are 3.5 keV/u and 143 keV/u, respectively. Beam dynamics study in RFQ was done using 3-dimensional particle-in-cell code BEAMPATH [1]. Simulation results show that this RFQ structure is characterized by stable value of beam transmission efficiency (at least 95%) for both zero-current mode and for space charge dominated regime. The beam accelerated in RFQ has good quality in both transversal and longitudinal directions, and could be easily accepted by Drift Tube Linac (DTL). Effects of vane errors and of the space charge on beam parameters are studied as well to define the engineering tolerance for RFQ vane machining and alignment.

  8. Design study of the SSC-LINAC re-buncher (United States)

    Sun, Lie-Peng; Zhao, Hong-Wei; Sun, Zhou-Ping; He, Yuan; Shi, Ai-Min; Xiao, Chen; Du, Xiao-Nan; Zhang, Cong; Zhang, Zhou-Li


    A re-buncher with spiral arms for a heavy ion linear accelerator named as SSC-LINAC at HIRFL (the heavy ion research facility of Lanzhou) has been constructed. The re-buncher, which is used for beam longitudinal modulation and matching between the RFQ and DTL, is designed to be operated in continuous wave (CW) mode at the Medium-Energy Beam-Transport (MEBT) line to maintain the beam intensity and quality. Because of the longitudinal space limitation, the re-buncher has to be very compact and will be built with four gaps. We determined the key parameters of the re-buncher cavity from the simulations using Microwave Studio software, such as the resonant frequency, the quality factor Q and the shunt impedance. The detailed design of a 53.667 MHz spiral cavity and measurement results of its prototype will be presented.

  9. Current Approaches to the Treatment of Systemic-Sclerosis-Associated Pulmonary Arterial Hypertension (SSc-PAH). (United States)

    Sobanski, Vincent; Launay, David; Hachulla, Eric; Humbert, Marc


    Pulmonary arterial hypertension (PAH) is a severe condition causing significant morbidity and mortality in patients with systemic sclerosis (SSc). Despite the use of specific treatments, SSc-PAH survival remains poorer than in idiopathic PAH (IPAH). Recent therapeutic advances in PAH show a lower magnitude of response in SSc-PAH and a higher risk of adverse events, as compared to IPAH. The multifaceted underlying mechanisms and the multisystem nature of SSc probably explain part of the worse outcomes in SSc-PAH compared to IPAH. This review describes the current management of SSc-PAH with an emphasis on the impact of the different organ involvements in the prognosis and treatment response. An earlier detection of PAH and a better characterization of the clinical phenotypes of SSc-PAH are warranted in clinical practice and future trials. Determinants of prognosis, surrogate markers of clinical improvement or worsening, and relevance of the common endpoints used in clinical trials should be evaluated in this specific population. A multidisciplinary approach in expert referral centers is mandatory for SSc-PAH management.

  10. Aloanticorpo anti-Diego (a em gestante Anti-Diego (a alloantibody in pregnant

    Directory of Open Access Journals (Sweden)

    Célia R. G. Silva


    Full Text Available O sistema de grupo sangüíneo Diego é composto principalmente por dois antígenos Diegoª (Diª e Diego b (Di b. A prevalência de Diª na população caucasóide é rara com uma freqüência de aproximadamente de 0,02%, podendo gerar anticorpos que são clinicamente significantes em medicina transfusional e neonatal. O presente estudo relata anti-Diª em gestante caucasóide detectado nos exames realizados no pré-parto por meio do teste indireto de antigamaglobulina humana. Na amostra de sangue de cordão foi realizado o teste de antigamaglobulina direto e o resultado foi negativo, o fenótipo do recém-nascido revelou Di (a - b +; portanto, a criança não desenvolveu doença hemolítica perinatal. O estudo fenotípico realizado em toda a família revelou que a sensibilização materna provavelmente ocorreu na segunda gestação gemelar onde as duas crianças demonstraram a presença de antígeno Diª adquirido por herança paterna.The Diego blood group system is composed of two principal antigens Diegoª (Diª and Diego b (Di b. In the Caucasian population the prevalence of Diª is rare with a frequency of about 0.02% and can lead to the production of antibodies that are important in newborn babies and in transfusional medicine. The present study reports on anti-Diª antibodies in a Caucasian pregnant woman, detected by indirect anti-globulin testing shortly before delivery. The direct anti-globulin test of the newborn's blood cord was negative because its phenotype was Di (a- b+. So the newborn did not develop any hemolytic diseases. A phenotyping study of the whole family was performed which revealed that probably the mother became sensitive during her second pregnancy of twins where the two children presented with the Diª antigen phenotype inherited from the father.

  11. Implosion Source Development and Diego Garcia Reflections

    Energy Technology Data Exchange (ETDEWEB)

    Harben, P E; Boro, C


    Calibration of hydroacoustic stations for nuclear explosion monitoring is important for increasing monitoring capability and confidence from newly installed stations and from existing stations. Past work at Ascension Island has shown that ship-towed airguns can be effectively used for local calibrations such as sensor location, amplitude and phase response, and T-phase coupling in the case of T-phase stations. At regional and ocean-basin distances from a station, the calibration focus is on acoustic travel time, transmission loss, bathymetric shadowing, diffraction, and reflection as recorded at a particular station. Such station calibrations will lead to an overall network calibration that seeks to maximize detection, location, and discrimination capability of events with acoustic signatures. Active-source calibration of hydroacoustic stations at regional and ocean-basin scales has not been attempted to date, but we have made significant headway addressing how such calibrations could be accomplished. We have developed an imploding sphere source that can be used instead of explosives on research and commercial vessels without restriction. The imploding sphere has been modeled using the Lawrence Livermore National Laboratory hydrodynamic code CALE and shown to agree with field data. The need for boosted energy in the monitoring band (2-100 Hz) has led us to develop a 5-sphere implosion device that was tested in the Pacific Ocean earlier this year. Boosting the energy in the monitoring band can be accomplished by a combination of increasing the implosion volume (i.e. the 5-sphere device) and imploding at shallower depths. Although active source calibrations will be necessary at particular locations and for particular objectives, the newly installed Diego Garcia station in the Indian Ocean has shown that earthquakes can be used to help understand regional blockages and the locations responsible for observed hydroacoustic reflections. We have analyzed several events

  12. Storm Water Toxicity Evaluation Conducted at Naval Station San Diego, Naval Submarine Base San Diego, Naval Amphibious Base Coronado, and Naval Air Station North Island (United States)


    MBAS includes a common group of anionic surfactants known as linear alkyl sulfonates (LAS). Surfactants were analyzed by CEL following EPA Method...P. Giro, M. Marin, P. Negrisolo and L. Tallandini. 1989. Effects of Linear Alkyl Benzene Sulphonates (LAS) on benthic organisms. Tenside...produce the dilution series test concentrations. Figure 70 shows the results. The linear regression was generated only for TUA values less than 6.2, as

  13. Outcomes of an inpatient refeeding protocol in youth with anorexia nervosa: Rady Children's Hospital San Diego/University of California, San Diego. (United States)

    Maginot, Tamara R; Kumar, Maya M; Shiels, Jacqueline; Kaye, Walter; Rhee, Kyung E


    Current guidelines for nutritional rehabilitation in hospitalized restrictive eating disorder patients recommend a cautious approach to refeeding. Several studies suggest that higher calorie diets may be safe and effective, but have traditionally excluded severely malnourished patients. The goal of this study was to evaluate the safety of a higher calorie nutritional rehabilitation protocol (NRP) in a broad sample of inpatients with restrictive eating disorders, including those who were severely malnourished. A retrospective chart review was conducted among eating disorder inpatients between January 2015 and March 2016. Patients were started on a lower calorie diet (≤1500 kcals/day) or higher calorie diet (≥1500 kcals/day). Calorie prescription on admission was based on physician clinical judgement. The sample included patients aged 8-20 years with any DSM-5 restrictive eating disorder. Those who were severely malnourished (<75% expected body weight [EBW]) or required tube feeding during admission were included. Multivariable regression models were used to determine whether level of nutritional rehabilitation was associated with hypophosphatemia, hypomagnesemia, or hypokalemia. The sample included 87 patients; mean age was 14.4 years (S.D. 32.7); 29% were <75% EBW. The majority (75.8%) was started on higher calorie diets (mean 1781 kcal/day). Controlling for rate of calorie change, initial %EBW, age, race/ethnicity, insurance, diagnosis, and NG/NJ tube placement, higher calorie diets were not associated with hypophosphatemia, hypomagnesemia, or hypokalemia on admission or within the first 72 h. Increased risk of hypophosphatemia on admission was associated with lower baseline %EBW. A higher calorie NRP was tolerated in this broad population of inpatients with restrictive eating disorders. Lower %EBW on admission was a more important predictor of hypophosphatemia than initial calorie level. Larger studies are required to demonstrate the safety of higher calorie diets in severely malnourished patients.

  14. Effect of test method on SSC performance of modified 13Cr steel

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, Mitsuo; Miyata, Yukio; Toyooka, Takaaki; Nakano, Yoshifumi; Murase, Fumio; Takojima, Kozo [Kawasaki Steel Corp., Handa, Aichi (Japan)


    Effect of test method on SSC performance of modified 13Cr martensitic stainless steel (0.025C-13Cr-Ni-Mo) are investigated. The SSC for martensitic stainless steel initiates at the pitting and propagates by hydrogen embrittlement. The pH stability of the test solution affects the test results. SSC threshold stress for modified 13Cr steel in the stable solution is higher than that in the unstable solution. This difference seems to depend on the pH value in the pitting, since a great volume of hydrogen enters into steel at low pH condition and causes SSC. The SSC susceptibility for subsize specimens is higher than that for full size specimens. The oxygen in the test solution causes pitting. The deaeration procedure affects the SSC test result. The deaerated test solution should be transferred to test vessel. The SSC performance for martensitic stainless steel should be evaluated by full size test specimens under stable pH condition.

  15. The XMM-Newton SSC survey of the Galactic Plane

    CERN Document Server

    Gomez-Moran, A Nebot; Barcons, X; Carrera, F J; Ceballos, M T; Cropper, M; Grosso, N; Guillout, P; Herent, O; Mateos, S; Michel, L; Osborne, J P; Pakull, M; Pineau, F -X; Pye, J P; Roberts, T P; Rosen, S R; Schwope, A D; Watson, M G; Webb, N


    Many different classes of X-ray sources contribute to the Galactic landscape at high energies. Although the nature of the most luminous X-ray emitters is now fairly well understood, the population of low-to-medium X-ray luminosity (Lx = 10^27-10^34 erg/s) sources remains much less studied, our knowledge being mostly based on the observation of local members. The advent of wide field and high sensitivity X-ray telescopes such as XMM-Newton now offers the opportunity to observe this low-to-medium Lx population at large distances. We report on the results of a Galactic plane survey conducted by the XMM-Newton Survey Science Centre (SSC). Beyond its astrophysical goals, this survey aims at gathering a representative sample of identified X-ray sources at low latitude that can be used later on to statistically identify the rest of the serendipitous sources discovered in the Milky Way. The survey is based on 26 XMM-Newton observations, obtained at |b| < 20 deg, distributed over a large range in Galactic longitude...

  16. Best practices: Strategic stigma change (SSC): five principles for social marketing campaigns to reduce stigma. (United States)

    Corrigan, Patrick W


    This column describes strategic stigma change (SSC), which comprises five principles and corresponding practices developed as a best practice to erase prejudice and discrimination associated with mental illness and promote affirming behaviors and social inclusion. SSC principles represent more than ten years of insights from the National Consortium on Stigma and Empowerment. The principles, which are centered on consumer contact that is targeted, local, credible, and continuous, were developed to inform the growth of large-scale social marketing campaigns supported by governments and nongovernmental organizations. Future social marketing efforts to address stigma and the need for evidence to determine SSC's penetration and impact are also discussed.

  17. Suspended sediment and sediment-associated contaminants in San Francisco Bay (United States)

    Schoellhamer, D.H.; Mumley, T.E.; Leatherbarrow, J.E.


    Water-quality managers desire information on the temporal and spatial variability of contaminant concentrations and the magnitudes of watershed and bed-sediment loads in San Francisco Bay. To help provide this information, the Regional Monitoring Program for Trace Substances in the San Francisco Estuary (RMP) takes advantage of the association of many contaminants with sediment particles by continuously measuring suspended-sediment concentration (SSC), which is an accurate, less costly, and more easily measured surrogate for several trace metals and organic contaminants. Continuous time series of SSC are collected at several sites in the Bay. Although semidiurnal and diurnal tidal fluctuations are present, most of the variability of SSC occurs at fortnightly, monthly, and semiannual tidal time scales. A seasonal cycle of sediment inflow, wind-wave resuspension, and winnowing of fine sediment also is observed. SSC and, thus, sediment-associated contaminants tend to be greater in shallower water, at the landward ends of the Bay, and in several localized estuarine turbidity maxima. Although understanding of sediment transport has improved in the first 10 years of the RMP, determining a simple mass budget of sediment or associated contaminants is confounded by uncertainties regarding sediment flux at boundaries, change in bed-sediment storage, and appropriate modeling techniques. Nevertheless, management of sediment-associated contaminants has improved greatly. Better understanding of sediment and sediment-associated contaminants in the Bay is of great interest to evaluate the value of control actions taken and the need for additional controls. ?? 2007 Elsevier Inc. All rights reserved.

  18. Increasing NASA SSC Range Safety by Developing the Framework to Monitor Airspace and Enforce Restrictions Project (United States)

    National Aeronautics and Space Administration — Engine testing at NASA SSC poses a significant risk to general aviation due to potential smoke and excessive turbulence. The airspace over Stennis has been...

  19. Development of Deformation-Semisolid-Casting (D-SSC) Process and Applications to Some Aluminum Alloys

    Institute of Scientific and Technical Information of China (English)


    Recent advances in the semisolid casting technologies are introduced for aluminum alloys. The advantages of the rheocast and thixocast methods to fabricate alloys with refined spheroidized α-Al particles are described.The deformation-semisolid-casting (D-SSC) process developed by the author's group is presented. The D-SSC process is extremely effective to produce microstructures of refined intermetallic compound particles as well as the spheroidized α-Al particles in the Al-Si based alloys containing highly concentrated Fe. In the D-SSC processed Al-Si-Cu alloy high elongation of about 20% was achieved even contained concentrated impurity of Fe. The D-SSC process is also useful to produce wrought aluminum alloys with microstructures of refined α-Al particles.

  20. Obtaining slow beam spills at the SSC collider

    Energy Technology Data Exchange (ETDEWEB)

    Ritson, D.


    There is substantial interest in providing slow-spill external proton beams in parallel with ``interaction running`` at the 20 TeV SSC collider. The proposal is to cause a flux of particles to impinge on a target consisting of a bent crystal extraction channel. Additionally, a slow spill onto a conventional internal target could be used as a source of secondary beams for physics or test purposes and might also be used for B-physics as proposed for HERA. The ``natural`` beam loss rates from elastic and diffractive beam gas scattering and IP collisions are not sufficient to provide suitably intense external proton beams. To prevent loss of luminosity, the rf excitation is non-linear and preferentially blows up the halo of the beam. The ``target`` is to be located at a region of high dispersion forcing particles at the edge of the momentum space onto the target. T. Lohse in this workshop has described a proposed internal target to be used at HERA that will not employ rf excitation but will use the finite loss rates observed at the HERA machine. The Hera losses are caused by a variety of sources in addition to beam gas scattering or IP interactions. Initially, the beam lifetime at HERA was too short to obtain satisfactory integrated luminosities. Subsequently, through careful attention to detail, the beam lifetime was increased to > 20 hours. Even with these changes, present loss rates provide the required intensity onto an internal target. The Tevatron and SPS proton anti-proton colliders have had similar experiences with their investigations of loss rates and also find that beam lifetimes may be substantially shorter than expected solely from beam gas and IP interactions. This paper proposes deliberately introducing controlled errors li

  1. Advanced thermohydraulic simulation code for pool-type LMFBRs (SSC-P code)

    Energy Technology Data Exchange (ETDEWEB)

    Madni, I.K.; Cazzoli, E.G.


    Models for components and processes that are needed for simulation of thermohydraulic transient in a pool-type liquid metal fast breeder reactor (LMFBR) plant are described in this report. A computer code, SSC-P, has been developed as a part of the Super System Code (SSC) development project. A user's manual is being prepared as a separate document. 27 refs., 26 figs., 1 tab.

  2. Development of the component models for the KALIMER safety analysis code SSC-K

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Young Min; Lee, Yong Bum; Chang, Won Pyo [Korea Atomic Energy Research Institute, Taejon (Korea)


    The SSC-K code is intended to simulate system responses to operational transients or accidents of the pool-type KALIMER (Korea Advanced Liquid Metal Reactor). As a part of the SSC-K development task, some primary component models have been developed and generalized correlations were recommended based on the technical review. Plant modules for the PSDRS, EMP were developed based on the analytical models. The IHX model of SSC-L was modified to take into account the thermo-hydraulic characteristics of pool. Correlations used for piping and in-core assemblies were reviewed and user options were provided for SSC-K. The merged version of SSC-K with PSDRE program was proved out to be valid by test run of ULOHS. The developed component models will be implemented into the SSC-K code and options will be provided for user to select proper correlations for friction factor and heat transfer coefficients. 30 refs., 31 figs., 9 tabs. (Author)

  3. Injection and extraction computer control system HIRFL-SSC The HIRFL-SSC is stated for Heavy Ion Research Facility of Lanzhou-Separated Sector Cyclotron

    CERN Document Server

    Zhang Wei; Chen Yun; Zhang Xia; Hu Jian Jun; Xu Xing Ming


    The injection and extraction computer control system of HIRFL-SSC (Heavy Ion Research Facility of Lanzhou-Separated Sector Cyclotron) have been introduced. Software is described briefly. Hardware structure is mainly presented. The computer control system realize that the adjustment of injection and extraction can done by PC and operate interface is Windows style. The system can make the adjustment convenient and veracious

  4. 76 FR 63701 - Culturally Significant Objects Imported for Exhibition Determinations: “Diego Rivera: Murals for... (United States)


    ... Imported for Exhibition Determinations: ``Diego Rivera: Murals for the Museum of Modern Art'' SUMMARY... objects to be included in the exhibition ``Diego Rivera: Murals for The Museum of Modern Art,'' imported...

  5. San Pascual (2011) Año XLIX, n. 361


    Pérez, María Dolores, O.S.C. (Directora)


    Editorial. Cuento navideño pascualino, una navidad con Fray Diego Baylón. Feria de Santa Catalina, Santa Catalina de Alejandría. Efemérides pascualinas: 24 de noviembre de 1802. Otras efemérides. Colaboraciones, San Pascual en Aragón. Los papas y San Pascual, el Papa Paulo V. Felicitación navideña. Vida en el santuario. Eucaristía y vida, la eucaristía : misterio de luz. Rincón poético y nació en belén milagro!. Museo de las campanas en Alemania. VII centenario de la fundación de la orden fra...

  6. H09112: NOS Hydrographic Survey , San Diego, California, 1970-03-25 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  7. H09113: NOS Hydrographic Survey , San Diego, California, 1970-04-07 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  8. State Education & Environment Roundtable (SEER) Seminar (9th, San Diego, California, May 21-25, 2000). (United States)

    Lieberman, Gerald A.; Hoody, Linda L.

    This document reports on the 9th seminar of the State Education and Environment Roundtable (SEER). It consists of brief overviews of the daily discussions and presentations that were made at the seminar. Topics discussed include connecting service learning and the Environment as an Integrated Context for learning (EIC), and reports from states on…

  9. 75 FR 43225 - Finding of No Significant Impact: San Diego-Tijuana Airport Cross Border Facility (United States)


    ... Tuttle, U.S.-Mexico Border Affairs Coordinator, via e-mail at ; by phone . SUPPLEMENTARY INFORMATION: The following is the text of the Finding of No...

  10. Productivity and Diversity of Phytoplankton in Relation to Copper Levels in San Diego Bay. (United States)


    X X X Rhizosolenia X X X Skeletonema X X X 7thalassiosira X X X Thalassiothrix X X X Achnanthes X - Streptotheca X -- X Thalassionema X... Achnanthes 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Streptotheca 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Thalassionema 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pleurosigma 0 0 0 0 0 0 0 0 0 0 0...0 0 10 0 0 19 4 0 Thalassiothrix 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Achnanthes 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Streptotheca 0 0 0 0 0 0 0 0 0 0 0 0 0 0

  11. Pharmacy Automation in Navy Medicine: A Study of Naval Medical Center San Diego (United States)


    places an order, the conveyor system directs each prescription through the different steps of the fill process. Manual fill stations are located to...performing all steps, including transportation, up to pharmacist verification via the conveyer belt. Manual fills are located along the conveyor facilities continue to seek ways to reduce cost and improve efficiency; the pharmacy is one of many avenues to accomplish this task. The current


    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  13. Microwave Michelson Interferometer system report of first use on a railgun, Green Farm, San Diego, CA

    Energy Technology Data Exchange (ETDEWEB)

    Hawke, R.S.; Greenwood, D.; Morrison, J.; Schildmeyer, F.


    This report summarizes the successful first attempt to use a Michelson microwave interferometer to measure the position of a projectile throughout its acceleration by a railgun. The test was performed at the DNA Green Farm facility operated by Maxwell Labs Inc. The test was performed using the ARDEC-ACB gun to accelerate a 1.1 kg polycarbonate projectile-to about 2.5 km/s. The projectile had an initial injection velocity of about 490 m/s.

  14. Munitions Executive Summit 2010 Held in San Diego, California on February 8-10, 2010 (United States)


    echnology • raining / areer g t Tooele Army Depot •Supply Depot Operations •Ammunition Peculiar Equip ele r y e t • upply epot perations • unition... mobility , force protection, and close battle systems for the Army’s Current, Stryker and Future Forces. • PM Demil • Industrial Base/EDCA • PM CCS Mission:  Provide the Warfighter world‐class close combat, force protection & assured  mobility  capabilities across full

  15. NOAA Office for Coastal Management Coastal Inundation Digital Elevation Model: San Diego (CA) WFO (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This digital elevation model (DEM) is a part of a series of DEMs produced for the National Oceanic and Atmospheric Administration Office for Coastal Management's...

  16. AERA Vocational Education Special Interest Group Proceedings (San Diego, California, April 13-17, 1998). (United States)

    Jackman, Diane H., Ed.

    This document contains six research papers: "Articulation Practices among Secondary and Postsecondary Vocational-Technical Education Programs" (Bob R. Stewart, Sandra Eckert-Stewart); "What Message Are We Sending to Counselors about Their Role in Tech Prep?" (Paula Puckett); "From School-to-Work: Secretaries' and Machinists' Representations of…

  17. A Marriage of Minds: James R. Jacobs & Shinjoung Yeo Univ. of California-San Diego (United States)

    Library Journal, 2005


    Their personalities and backgrounds are very different, but James R. Jacobs and Shinjoung Yeo are passionate about the same causes: librarianship, open government, and empowerment through information. They balance each other. Yeo is focused, realistic, critical, and an excellent researcher. Her superhero alter ego is Wet Blanket Woman, able to…

  18. Delft3D-Modelling of Hydrodynamic and Water Quality Processes in San Diego Bight (United States)


    Terrill (SIO Scripps), Dr. Lyle Hibler ( PNL ) and Mark Moline (CalPoly) who are funded separately. LONG-TERM GOALS The long-term goal of this effort is...October 3, 2002. RELATED PROJECTS This work is a cooperation with Dr. Eric Terrill (SIO Scripps), Dr. Lyle Hibler ( PNL ) and Mark Moline (CalPoly) who are funded separately. 5

  19. Preliminary Image Map of the 2007 Harris Fire Perimeter, Morena Reservoir Quadrangle, San Diego County, California (United States)

    Clark, Perry S.; Scratch, Wendy S.; Bias, Gaylord W.; Stander, Gregory B.; Sexton, Jenne L.; Krawczak, Bridgette J.


    In the fall of 2007, wildfires burned out of control in southern California. The extent of these fires encompassed large geographic areas that included a variety of landscapes from urban to wilderness. The U.S. Geological Survey National Geospatial Technical Operations Center (NGTOC) is currently (2008) developing a quadrangle-based 1:24,000-scale image map product. One of the concepts behind the image map product is to provide an updated map in electronic format to assist with emergency response. This image map is one of 55 preliminary image map quadrangles covering the areas burned by the southern California wildfires. Each map is a layered, geo-registered Portable Document Format (.pdf) file. For more information about the layered geo-registered .pdf, see the readme file ( To view the areas affected and the quadrangles mapped in this preliminary project, see the map index ( provided with this report.

  20. Two-Bin Kanban: Ordering Impact at Navy Medical Center San Diego (United States)


    degree in Supply Chain Management . Lieutenant Hill’s personal awards include the Defense Meritorious Service Medal, Navy and Marine care include poor management support, poorly aligned incentives, poor data analytics, lack of supply chain education, and weak purchasing...expenditures are attributed to the supply chain (McKone-Sweet, Hamilton, & Willis, 2005). Lean management practices began to emerge in hospitals between

  1. 78 FR 66269 - Safety Zone, Sea World Fireworks; Mission Bay, San Diego, CA (United States)


    ... establishing a temporary safety zone on the navigable waters of Mission Bay, south of Fiesta Island, for a... Bay, south of Fiesta Island. Persons and vessels are prohibited from entering into, transiting through...

  2. Quantitative Analysis for Installation Access Planning at Naval Base San Diego (United States)


    VPH in one processing lane, then we can assume that if the SECO were to open another sentry processing lane, the total throughput of both lanes 600 VPH . Similarly, if two sentries in tandem can produce a throughput of 500 VPH , then having two lanes with two sentries in tandem each will...produce a total throughput of 1000 VPH . We assume throughout that there is no server idleness and so there is essentially an infinite backlog of

  3. F00590: NOS Hydrographic Survey , Enterance to San Diego Bay, California, 2010-10-25 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  4. Two-Bin Kanban: Ordering Impact at Navy Medical Center San Diego (United States)


    home health nurses , or staff at nursing homes” (Johnson, 2002, p. 175). c. Complexity Patients, Provider Expertise, and Quality of Care Certain...populations of patients require a higher level of expertise of care ; RVUs do not accurately measure complex patient encounters. For example, a...cost into a monthly sum. This monthly sum is the basis for analysis. A similar approach is conducted for the efficiency measure . In the efficiency

  5. Game-Review: Red Dead Redemption - von Rockstar San Diego/Take 2 Interactive

    Directory of Open Access Journals (Sweden)

    Karl H. Stingeder


    Full Text Available Das Wilde im Westen befindet sich bereits in den letzten Atemzügen, am Vorabend zur industriellen Revolution. Red Dead Redemption lässt die Spieler in eine von Gewalt erfüllte Welt des ausklingenden Wilden Westens eintauchen.

  6. Stigma experienced by people using mental health services in San Diego County. (United States)

    Sarkin, Andrew; Lale, Rachel; Sklar, Marisa; Center, Kimberly C; Gilmer, Todd; Fowler, Chris; Heller, Richard; Ojeda, Victoria D


    This paper describes how individuals struggling with severe mental illness experience stigma along multiple dimensions including their experiences of discrimination by others, their unwillingness to disclose information about their mental health, and their internalization or rejection of the negative and positive aspects of having mental health problems. This cross-sectional study employs descriptive analyses and linear regression to assess the relationship between demographics, mental health diagnoses and self-reported stigma among people receiving mental health services in a large and ethnically diverse county public mental health system (n = 1,237) in 2009. We used the King Stigma Scale to measure three factors related to stigma: discrimination, disclosure, and positive aspects of mental illness. Most people (89.7 %) reported experiencing some discrimination from having mental health problems. Regression analyses revealed that younger people in treatment experienced more stigma related to mental health problems. Women reported experiencing more stigma than men, but men were less likely to endorse the potentially positive aspects of facing mental health challenges than women. Although people with mood disorders reported more discomfort with disclosing mental illness than people with schizophrenia, they did not report experiencing more discrimination than people with schizophrenia. Study findings suggest that the multidimensional experiences of stigma differ as a function of age, gender, and diagnosis. Importantly, these findings should inform anti-stigma efforts by describing different potential treatment barriers due to experiences of stigma among people using mental health services, especially among younger people and women who may be more susceptible to stigma.


    Arsenic exposure has been correlated with the development of several human cancers including those found in the skin, lung, liver, kidney and urinary bladder. Humans are generally exposed to inorganic forms of arsenic, which may be inhaled or ingested. Arsenic forms mono- and di-...

  8. Geologic map of the Morena Reservoir 7.5-minute quadrangle, San Diego County, California (United States)

    Todd, Victoria R.


    IntroductionMapping in the Morena Reservoir 7.5-minute quadrangle began in 1980, when the Hauser Wilderness Area, which straddles the Morena Reservoir and Barrett Lake quadrangles, was mapped for the U.S. Forest Service. Mapping was completed in 1993–1994. The Morena Reservoir quadrangle contains part of a regional-scale Late Jurassic(?) to Early Cretaceous tectonic suture that coincides with the western limit of Jurassic metagranites in this part of the Peninsular Ranges batholith (PRB). This suture, and a nearly coincident map unit consisting of metamorphosed Cretaceous and Jurassic back-arc basinal volcanic and sedimentary rocks (unit KJvs), mark the boundary between western, predominantly metavolcanic rocks, and eastern, mainly metasedimentary, rocks. The suture is intruded and truncated by the western margin of middle to Late Cretaceous Granite Mountain and La Posta plutons of the eastern zone of the batholith.

  9. 75 FR 19632 - San Diego County Water Authority; Notice of Preliminary Permit Application Accepted for Filing... (United States)


    ... alternatives as an upper reservoir: the Iron Mountain Alternative, the Foster Canyon Alternative, and the East... below. Iron Mountain Alternative (1) A proposed 235-foot-high, 1,250-foot-long upper dam located 3 miles...

  10. Final Report: DOE Award Number: DE-SC0006398, University of CA, San Diego

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Jennifer [Univ. of California, San Diego, CA (United States)


    The focus of the proposed research is to direct the assembly of single or binary nanoparticles into meso- or macroscale three-dimensional crystals of any desired configuration and crystallographic orientation without using prohibitively expensive lithographic processes. The epitaxial nucleation of defect-free, surface-bound bulk single crystals will revolutionize technologies for energy to generate new types of solar cells that yield maximum conversion efficiencies. It has been proposed that having a nanostructured bulk hetero-interface will enable efficient charge-carrier separations, similar to organic based heterojunction cells but with potential improvements, including thermal and long-term stability, tunability of energy levels, large adsorption coefficients and carrier multiplication. However, engineering such devices requires nanoscale control and ordering in both 2- and 3-dimensions over macroscopic areas and this has yet to be achieved. In Nature, bulk organic and inorganic materials are arranged into precise and ordered programmed assemblies through the sequestration of raw materials into confined spaces and association through highly specific non-covalent interactions between biomolecules. Using similar strategies, the proposed research will focus on confining metal and semiconductor nanocrystals to pre-determined surface patterns and controlling their arrangement through tunable, orthogonal biomolecular binding. Once a perfect two-dimensional seed layer has been constructed, successive layers of single nanocrystals will be nucleated epitaxially with long-range order and tunable crystallographic orientations. The proposed research exploits the ability of biomolecules to bind specific targets in a tunable, orthogonal, multivalent, and reversible manner to the arrangements of DNA-nanoparticle conjugates on chemically defined surfaces. Through careful balance of the attractive and repulsive forces between the particles, the array, and the outside surface, it is envisioned that single or mixed nanoparticles can be packed to adopt uniform crystal orientation in two and three dimensions from simple mixing and annealing of biomolecule-nanoparticle conjugates with biomolecule-stamped surfaces. To control the crystallographic alignment of each particle with its neighbors, the nanoparticles will be assembled using a mixture of non-covalent biomolecular interactions. To create solar cells in which layers of donor and acceptor nanocrystals that are not only oriented normal to the top and bottom electrodes but are also arranged in a checkerboard pattern, multicomponent nanocrystals (e.g. CdSe, CdTe) will be conjugated with biochemical linkers such that only interactions between the CdTe and CdSe promote particle packing within the array. The proposed research will: (1) elucidate the role of single and binary cooperative particle-DNA interactions in influencing nanoparticle crystallographic orientation in two and three dimensions; (2) understand how confinement of nanoparticles on patterned arrays of biomolecules and modification of the surrounding substrate can nucleate long-range order over macroscopic areas via predefined grain boundaries; and (3) synthesize and characterize DNA conjugated semiconductor nanocrystals and assemble them into 2- and 3-D binary superlattice arrays for photovoltaics.

  11. 76 FR 4283 - Foreign-Trade Zone 153-San Diego, CA; Application for Manufacturing Authority; Abbott... (United States)


    ..., stent components, plastic packaging, plastic clips, nickel tubing and tantalum tubing (duty rate ranges... anticipates that some 50 percent of the plants' shipments will be exported. On its domestic sales, Abbott...

  12. Preliminary Image Map of the 2007 Witch Fire Perimeter, Santa Ysabel Quadrangle, San Diego County, California (United States)

    Clark, Perry S.; Scratch, Wendy S.; Bias, Gaylord W.; Stander, Gregory B.; Sexton, Jenne L.; Krawczak, Bridgette J.


    In the fall of 2007, wildfires burned out of control in southern California. The extent of these fires encompassed large geographic areas that included a variety of landscapes from urban to wilderness. The U.S. Geological Survey National Geospatial Technical Operations Center (NGTOC) is currently (2008) developing a quadrangle-based 1:24,000-scale image map product. One of the concepts behind the image map product is to provide an updated map in electronic format to assist with emergency response. This image map is one of 55 preliminary image map quadrangles covering the areas burned by the southern California wildfires. Each map is a layered, geo-registered Portable Document Format (.pdf) file. For more information about the layered geo-registered .pdf, see the readme file ( To view the areas affected and the quadrangles mapped in this preliminary project, see the map index ( provided with this report.

  13. Preliminary Image Map of the 2007 Witch Fire Perimeter, Warners Ranch Quadrangle, San Diego County, California (United States)

    Clark, Perry S.; Scratch, Wendy S.; Bias, Gaylord W.; Stander, Gregory B.; Sexton, Jenne L.; Krawczak, Bridgette J.


    In the fall of 2007, wildfires burned out of control in southern California. The extent of these fires encompassed large geographic areas that included a variety of landscapes from urban to wilderness. The U.S. Geological Survey National Geospatial Technical Operations Center (NGTOC) is currently (2008) developing a quadrangle-based 1:24,000-scale image map product. One of the concepts behind the image map product is to provide an updated map in electronic format to assist with emergency response. This image map is one of 55 preliminary image map quadrangles covering the areas burned by the southern California wildfires. Each map is a layered, geo-registered Portable Document Format (.pdf) file. For more information about the layered geo-registered .pdf, see the readme file ( To view the areas affected and the quadrangles mapped in this preliminary project, see the map index ( provided with this report.

  14. San Diego Declaration on Climate Change and Fire Management: Ramifications for fuels management (United States)

    Brian P. Oswald


    Climate plays a central role in shaping fire regimes over long time scales and in generating short-term weather that drives fire events. Recent research suggests that the increasing numbers of large and severe wildfires, lengthened wildfire seasons, and increased area burned are, in part, related to shifts in climate. The historical fire regimes in many ecosystems have...

  15. Strategies to Make Immunization Status Visible During Patient Encounters at Naval Medical Center San Diego (United States)


    urology, general practice dentistry , oral and maxillofacial surgery, nurse anesthesia , and hospital pharmacy. Additionally, the hospital offers...sectors of medicine (as relevant to their constituencies), including the US Department of Health and Human Services, the American Academy of Pediatrics ...patients, pediatric , adolescents and non-active duty adult patients. Unlike NMCSD where various satellite areas within the main hospital (in addition to the

  16. Determining the Optimal Inventory Management Policy for Naval Medical Center San Diego’s Pharmacy (United States)


    price , utilization, mix, and innovation (American Society for Health-System Pharmacists [ASHP], 2008). (1) Price Price is the cost ... costs (s). The combined order cost (S*) is S plus the item specific cost of every item in the group. For example in a pharmacy walking the shelves to...model. Managing the order is a common cost because this cost is fixed. For the EOQ model, S is the cost of managing the order plus building the

  17. Diego de León Pinedo, universitario de Salamanca y de San Marcos de Lima

    Directory of Open Access Journals (Sweden)



    Full Text Available RESUMEN: La Universidad de Salamanca fue el modelo institucional de las Universidades hispanoamericanas, apoyado en no pocas pruebas documentales1. La descubrimos presente a lo largo de la trayectoria histórica de estas universidades hijas, desde la primera piedra del trasplante del régimen universitario español al Nuevo Mundo, la Universidad de Santo Domingo, en la Isla Española, hasta la última del período hispánico, fundada por las Cortes de Cádiz en León de Nicaragua, en 1812. Desde su gestación y a lo largo de todo su desarrollo histórico no dejan de mirar a Salamanca, para inspirarse continuamente en ella. Al menos el ochenta y cinco por ciento de la legislación universitaria hispanoamericana, hunde sus raíces en el viejo tronco salmantino.

  18. F00473C: NOS Hydrographic Survey , San Diego Bay, California, 2001-04-13 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  19. Biblioteca de la Universidad Central de San Diego - California (EE. UU.

    Directory of Open Access Journals (Sweden)

    William L. Pereira y Asociados, Arquitectos


    Full Text Available This building, which is an original and daring design, consists of five floors and is sphere shaped. It is in the central square of the campus with magnificent views in all directions. It is anticipated that there will be room for 700,000 volumes and about 1,250 students. And in the near future, with easy extensions, these figures will be tripled. The central nucleus and the concrete columns constitute the vertical structure, from which the beams which support the floors extend. The majority of these elements have been left exposed.El edificio, de original y atrevido diseño, consta de cinco plantas y presenta forma esférica, estando emplazado en la plaza central del «campus», con magníficas vistas hacia todas las direcciones. La capacidad prevista es de 700.000 volúmenes, que pueden ser consultados por unos 1.250 estudiantes. En un futuro previsible, y con auxilio de fáciles ampliaciones, pueden llegarse a triplicar las cifras citadas. El núcleo central y los pilares de hormigón constituyen la estructura vertical, desde la que se extienden las vigas que soportan las plantas. La mayor parte de estos elementos se han dejado vistos.

  20. Proceedings of Damping 󈨟, Held in San Diego, California on 13 - 15 February 1991. Volume 3 (United States)


    and Fluids The Vibration Damping Effect of an Electrorheological Fluid GAB Stephen A. Austin Modelling of Nonlinear Dilatation Response of Fluids...Control of a Flexible Planar Truss Using A Reaction Mass GBC Actuator Capt. Steven G. Webb and LL David R. Lee SESSION GC - Damping Indentification A

  1. Proceedings of Damping 󈨟, Held in San Diego, California on 13 - 15 February 1991. Volume 1 (United States)


    Rheological Fluids and Fluids The Vibration Damping Effect of an Electrorheological Fluid GAB Stephen A. Austin Mod,!!ing of Nonlinear Dilatation Response of...W. Vos Passive Control of a Flexible Planar Truss Using A Reaction Mass GBC Actuator Capt. Steven G. Webb and Lt. David R. Lee SESSION GC - Damping...Procedure to the PACOSS Multi- Actuator Control Experiment To show the applicability of the procedure to the solution of realistic dynamics and control

  2. Infrared technology X; Proceedings of the Meeting, San Diego, CA, August 23, 24, 1984 (United States)

    Spiro, I. J.; Mollicone, R. A.

    The present conference covers devices for the measurement of MTFs in the IR, an experimental quantification of the effect of clutter on target selection, the calculated detectivity of Schottky barrier detectors, multidetector thermal imagers' development history, a transmittance model for atmospheric methane, photovoltaic CdHgTe-Si hybrid focal planes, and focal plane architectures applicable to advanced imaging seekers. Also discussed are IR flight simulation using computer-generated imagery, proposed molecular transmission band models for the LOWTRAN code, Ge aspheric single lenses for earth sensing applications, the use of IR spectroscopy in industrial flare performance monitoring, and novel NDT IR thermographic methods for the assessment of flaw delaminations in flight hardware.

  3. Spatial patterns of fishing effort off San Diego: implications for zonal management and ecosystem function. (United States)

    Parnell, P Ed; Dayton, Paul K; Fisher, Rachelle A; Loarie, Cina C; Darrow, Ryan D


    The essence of ecosystem-based management is managing human practices to conserve the ecosystem. Ecologists focus on understanding the ecosystem, but there are fundamental information gaps including patterns of human exploitation. In particular, the spatial distribution of fishing effort must be known at the scales needed for ecologically relevant management. Fishing is a primary impact on coastal ecosystems, yet catch distribution at scales relevant to habitats and processes are not well known for many fisheries. Here we utilized photographic time series, logbook records, and angler surveys to estimate the intensity and spatial pattern of commercial and recreational fishing. Effort was clearly aggregated for most types of fishing, the motivating factors for effort distribution varied among areas, and effort was coupled or uncoupled to habitat depending on the area and type of fishing. We estimated that approximately 60% and approximately 74% of private recreational and recreational charter vessel fishing effort, respectively, were concentrated into two small areas that also included approximately 78% of commercial sea urchin effort. Exploitation and effort were considerably greater in one kelp forest, which has important implications for patterns of kelp persistence, productivity, and ecosystem function. Areas subject to the greatest recreational fishing pressure appeared to have lower diversity. Our results indicate that fine-scale patterns of fishing effort and exploitation have profound consequences for ecosystem functioning and biodiversity. 'Ecosystem-based management of nearshore ecosystems depends on an understanding of the fine-scale patterns of exploitation.

  4. Physics of Nonmagnetic Relativistic Thermal Plasmas. Ph.D. Thesis - Calif. Univ., San Diego (United States)

    Dermer, C. D.


    A detailed treatment of the kinematics of relativistic systems of particles and photons is presented. In the case of a relativistic Maxwell-Boltzmann distribution of particles, the reaction rate and luminosity are written as single integrals over the invariant cross section, and the production spectrum is written as a double integral over the cross section differential in the energy of the produced particles (or photons) in the center-of-momentum system of two colliding particles. The results are applied to the calculation of the annihilation spectrum of a thermal electron-positron plasma, confirming previous numerical and analytic results. Relativistic thermal electron-ion and electron-electron bremsstrahlung are calculated exactly to lowest order, and relativistic thermal electron-positron bremsstrahlung is calculated in an approximate fashion. An approximate treatment of relativistic Comptonization is developed. The question of thermalization of a relativistic plasma is considered. A formula for the energy loss or exchange rate from the interaction of two relativistic Maxwell-Boltzmann plasmas at different temperatures is derived. Application to a stable, uniform, nonmagnetic relativistic thermal plasma is made. Comparison is made with other studies.

  5. Persistent Bacillus cereus Bacteremia in 3 Persons Who Inject Drugs, San Diego, California, USA. (United States)

    Schaefer, Gabrielle; Campbell, Wesley; Jenks, Jeffrey; Beesley, Cari; Katsivas, Theodoros; Hoffmaster, Alex; Mehta, Sanjay R; Reed, Sharon


    Bacillus cereus is typically considered a blood culture contaminant; however, its presence in blood cultures can indicate true bacteremia. We report 4 episodes of B. cereus bacteremia in 3 persons who inject drugs. Multilocus sequence typing showed that the temporally associated infections were caused by unrelated clones.

  6. Persistent Bacillus cereus Bacteremia in 3 Persons Who Inject Drugs, San Diego, California, USA


    Schaefer, Gabrielle; Campbell, Wesley; Jenks, Jeffrey; Beesley, Cari; Katsivas, Theodoros; Hoffmaster, Alex; Mehta, Sanjay R.; Reed, Sharon


    Bacillus cereus is typically considered a blood culture contaminant; however, its presence in blood cultures can indicate true bacteremia. We report 4 episodes of B. cereus bacteremia in 3 persons who inject drugs. Multilocus sequence typing showed that the temporally associated infections were caused by unrelated clones.

  7. Smart Parking Pilot on the Coaster Commuter Rail Line in San Diego, California


    Blake, Tagan; Rodier, Caroline J.; Shaheen, Susan


    Increasingly, public transit authorities are harnessing advances in sensor, payment, and enforcement technologies to operate parking facilities more efficiently. In the short term, these innovations promise to enhance customer parking experiences, increase the effective supply of existing parking with minimal investment, and increase ridership and overall revenue. Over the longer term, these systems could further expand ridership by generating revenue to add parking capacity and improve acces...

  8. 76 FR 6491 - San Diego County Water Authority Subregional Natural Community Conservation Program/Habitat... (United States)


    ... species, take authorization would become effective concurrent with listing, should the species be listed... navarretia (Navarretia fossalis; threatened), thread-leaved brodiaea (Brodiaea filifolia; threatened), and...

  9. 75 FR 9921 - San Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation... (United States)


    ... authorization would become effective concurrent with listing, should the species be listed under the Act during...; threatened), spreading navarretia (Navarretia fossalis; threatened), thread-leaved brodiaea (Brodiaea...

  10. FlySanDiego: a web-aware 3D interactive regional information system (United States)

    Lukas, David S.; Bailey, Michael J.


    Communication of regional geographic information to the population as a whole should be a municipal priority, but sadly it is not. From traffic patterns to weather information to emergency information to proposed highways, a city or county has, in electronic form, all of this useful information and more. With the ubiquity of web browsers and the arrival of online 3D graphics technologies such as VRML and Java 3D,this information could and should be made available. By using Java andJava3D, the rendering power of an OpenGL-type application can be combined with multithreading, allowing a program to invisibly access data sets from Internet sites with dedicated threads while processing user interaction with another. Any type of relevant data can be transformed into a three-dimensional interpretation and mapped over the terrain that the user is analyzing. This prototype is designed to be extremely extensible and expandable in order to accommodate future revisions and/or portability. This paper discusses the issues surrounding the creation of such a model, along with challenges, problems, and solutions.

  11. Downscaling climate change models to local site conditions: San Diego National Wildlife Refuge Complex (United States)

    US Fish and Wildlife Service, Department of the Interior — Executive Summary Southern California tidal marshes have been affected by coastal development and urbanization.Over the past 150 years, dredging and filling...

  12. Proceedings of Damping 󈨟, Held in San Diego, California on 13 - 15 February 1991. Volume 2 (United States)


    further damp vertical bending of the solar array masts, while tuned mass dampers suppress solar array blanket modes. SIDA . hos~d bya Sn-3 orksatin...County, July 21, 1952 (iv) Llolleo, Chile , March 3, 1985 (v) La Union, Michoacan, September 19, 1985 (vi) Zacatula, Michoacan, September 19, 1985

  13. H09111: NOS Hydrographic Survey , San Diego, California, 1970-03-13 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  14. 2013 NOAA Ortho-rectified Color Mosaic of California: Port of San Diego (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  15. 75 FR 56889 - Revisions to the California State Implementation Plan, San Diego County Air Pollution Control... (United States)


    ... consider your comment. Electronic files should avoid the use of special characters, any form of encryption... it without proposing it in advance. However, in the Proposed Rules section of this Federal Register..., part D of the Clean Air Act do not create any new requirements but simply approve requirements that the...

  16. 78 FR 37130 - Revisions to the California State Implementation Plan, San Diego Air Pollution Control District (United States)


    ... files should avoid the use of special characters, any form of encryption, and be free of any defects or.... SDAPCD Rule 67.0 adds several new coating categories and lowers existing VOC limits. EPA's technical... proposing it in advance. However, in the Proposed Rules section of this Federal Register, we are...

  17. Advanced thermohydraulic simulation code for transients in LMFBRs (SSC-L code)

    Energy Technology Data Exchange (ETDEWEB)

    Agrawal, A.K.


    Physical models for various processes that are encountered in preaccident and transient simulation of thermohydraulic transients in the entire liquid metal fast breeder reactor (LMFBR) plant are described in this report. A computer code, SSC-L, was written as a part of the Super System Code (SSC) development project for the ''loop''-type designs of LMFBRs. This code has the self-starting capability, i.e., preaccident or steady-state calculations are performed internally. These results then serve as the starting point for the transient simulation.

  18. From mobile ADCP to high-resolution SSC: a cross-section calibration tool (United States)

    Boldt, Justin A.


    Sediment is a major cause of stream impairment, and improved sediment monitoring is a crucial need. Point samples of suspended-sediment concentration (SSC) are often not enough to provide an understanding to answer critical questions in a changing environment. As technology has improved, there now exists the opportunity to obtain discrete measurements of SSC and flux while providing a spatial scale unmatched by any other device. Acoustic instruments are ubiquitous in the U.S. Geological Survey (USGS) for making streamflow measurements but when calibrated with physical sediment samples, they may be used for sediment measurements as well. The acoustic backscatter measured by an acoustic Doppler current profiler (ADCP) has long been known to correlate well with suspended sediment, but until recently, it has mainly been qualitative in nature. This new method using acoustic surrogates has great potential to leverage the routine data collection to provide calibrated, quantitative measures of SSC which hold promise to be more accurate, complete, and cost efficient than other methods. This extended abstract presents a method for the measurement of high spatial and temporal resolution SSC using a down-looking, mobile ADCP from discrete cross-sections. The high-resolution scales of sediment data are a primary advantage and a vast improvement over other discrete methods for measuring SSC. Although acoustic surrogate technology using continuous, fixed-deployment ADCPs (side-looking) is proven, the same methods cannot be used with down-looking ADCPs due to the fact that the SSC and particle-size distribution variation in the vertical profile violates theory and complicates assumptions. A software tool was developed to assist in using acoustic backscatter from a down-looking, mobile ADCP as a surrogate for SSC. This tool has a simple graphical user interface that loads the data, assists in the calibration procedure, and provides data visualization and output options. This tool

  19. Central and Eastern United States (CEUS) Seismic Source Characterization (SSC) for Nuclear Facilities Project

    Energy Technology Data Exchange (ETDEWEB)

    Kevin J. Coppersmith; Lawrence A. Salomone; Chris W. Fuller; Laura L. Glaser; Kathryn L. Hanson; Ross D. Hartleb; William R. Lettis; Scott C. Lindvall; Stephen M. McDuffie; Robin K. McGuire; Gerry L. Stirewalt; Gabriel R. Toro; Robert R. Youngs; David L. Slayter; Serkan B. Bozkurt; Randolph J. Cumbest; Valentina Montaldo Falero; Roseanne C. Perman' Allison M. Shumway; Frank H. Syms; Martitia (Tish) P. Tuttle


    This report describes a new seismic source characterization (SSC) model for the Central and Eastern United States (CEUS). It will replace the Seismic Hazard Methodology for the Central and Eastern United States, EPRI Report NP-4726 (July 1986) and the Seismic Hazard Characterization of 69 Nuclear Plant Sites East of the Rocky Mountains, Lawrence Livermore National Laboratory Model, (Bernreuter et al., 1989). The objective of the CEUS SSC Project is to develop a new seismic source model for the CEUS using a Senior Seismic Hazard Analysis Committee (SSHAC) Level 3 assessment process. The goal of the SSHAC process is to represent the center, body, and range of technically defensible interpretations of the available data, models, and methods. Input to a probabilistic seismic hazard analysis (PSHA) consists of both seismic source characterization and ground motion characterization. These two components are used to calculate probabilistic hazard results (or seismic hazard curves) at a particular site. This report provides a new seismic source model. Results and Findings The product of this report is a regional CEUS SSC model. This model includes consideration of an updated database, full assessment and incorporation of uncertainties, and the range of diverse technical interpretations from the larger technical community. The SSC model will be widely applicable to the entire CEUS, so this project uses a ground motion model that includes generic variations to allow for a range of representative site conditions (deep soil, shallow soil, hard rock). Hazard and sensitivity calculations were conducted at seven test sites representative of different CEUS hazard environments. Challenges and Objectives The regional CEUS SSC model will be of value to readers who are involved in PSHA work, and who wish to use an updated SSC model. This model is based on a comprehensive and traceable process, in accordance with SSHAC guidelines in NUREG/CR-6372, Recommendations for Probabilistic

  20. Minisparker seismic-reflection data of field activity S-5-09-SC: San Pedro Basin, offshore southern California from 2009-07-06 to 2009-07-10 (United States)

    Sliter, Ray W.; Conrad, James E.; Ryan, Holly F; Triezenberg, Peter


    This dataset includes raw and processed, high-resolution seismic-reflection data collected in 2009 to explore a possible connection between the San Diego Trough Fault and the San Pedro Basin Fault. The survey is in the San Pedro Basin between Santa Catalina Island and San Pedro, California. The data were collected aboard the U.S. Geological Survey R/V Parke Snavely. The seismic-reflection data were acquired using a SIG 2mille minisparker. Subbottom acoustic penetration spanned tens to several hundreds of meters, variable by location.