Antigenicity analysis of human parvovirus B19-VP1u protein in the induction of anti-phospholipid syndrome.

Science.gov (United States)

Lin, Chun-Yu; Chiu, Chun-Ching; Cheng, Ju; Lin, Chia-Yun; Shi, Ya-Fang; Tsai, Chun-Chou; Tzang, Bor-Show; Hsu, Tsai-Ching

2018-01-01

Mounting evidence suggests a connection between human parvovirus B19 (B19) and autoimmune diseases, and especially an association between the B19-VP1 unique region (VP1u) and anti-phospholipid syndrome (APS). However, little is known about the antigenicity of B19-VP1u in the induction of APS-like syndrome. To elucidate the antigenicity of B19-VP1u in the induction of APS, N-terminal truncated B19-VP1u (tVP1u) proteins were prepared to immunize Balb/c mice to generate antibodies against B19-tVP1u proteins. The secreted phospholipase A2 (sPLA2) activities and binding specificity of mice anti-B19-tVP1u antibodies with cardiolipin (CL) and beta-2-glycoprotein I (β2GPI) were evaluated by performing immunoblot, ELISA and absorption experiments. A mice model of passively induced APS was adopted. Although sPLA2 activities were identified in all B19-tVP1u proteins, only amino acid residues 61-227 B19-tVP1u exhibited a higher sPLA2 activity. Autoantibodies against CL and β2GPI exhibited binding activities with all B19-tVP1u proteins. IgG that was purified from mice that had been immunized with amino acid residues 21-227 to 121-227 B19-tVP1u proteins exhibited significantly higher binding activity with CL. IgG that was purified from mice that had been immunized with amino acid residues 21-227, 31-227, 82-227 and 91-227 B19-tVP1u proteins exhibited significantly higher binding activity with β2GPI. Accordingly, significantly higher binding inhibition of CL was detected in the presence of amino acid residues 61-227 and 101-227 B19-tVP1u. Significantly higher binding inhibition of β2GPI was detected in the presence of amino acid residues 21-227, 31-227, 82-227 and 91-227 B19-tVP1u. The mice that received amino acid residues 31-227 or 61-227 anti-tB19-VP1u IgG revealed significant thrombocytopenia and those that received amino acid residues 21-227, 31-227, 61-227, 71-227, 82-227, 91-227, 101-227 or 114-227 anti-tB19-VP1u IgG exhibited significantly prolonged aPTT. These

Inter comparison of 90Sr and 137Cs contents in biologic samples and natural U in soil samples

International Nuclear Information System (INIS)

Liu Jianfen; Zeng Guangjian; Lu Xuequan

2001-01-01

The results of the 90 Sr and 137 Cs contents in biologic samples and the natural U in soil samples obtained in a joint effort by fourteen environmental radiation laboratories in the Chinese environmental protection system were analyzed and compared. Two kinds of biologic samples and one kind of soil samples were used for inter comparison. Of which, one kind of biologic samples (biologic powder samples) and the soil samples came from the IAEA samples were environmental and the reference values were known. The another kind of biologic samples were environmental tea-leaf that were taken from a tea garden near Hangzhou. The mean values obtained by all the joined laboratories was used as the reference. The inter comparison results were expressed in terms of the deviation from the reference value. It was found that the deviation of the 90 Sr and 137 Cs contents of biologic powder samples ranged from -15.4% to 26.5% and -15.0% to 0.4%, respectively. The deviation of the natural U content ranged from -25.5% to 7.3% for the soil samples. For the tea-leaf, the 90 Sr deviation was -22.7% to 19.1%, and the 137 Cs data had a relative large scatter with a ratio of the maximum and the minimum values being about 7. It was pointed out that the analysis results offered by different laboratories might have involved system errors

The Receptor-Binding Domain in the VP1u Region of Parvovirus B19.

Science.gov (United States)

Leisi, Remo; Di Tommaso, Chiarina; Kempf, Christoph; Ros, Carlos

2016-02-24

Parvovirus B19 (B19V) is known as the human pathogen causing the mild childhood disease erythema infectiosum. B19V shows an extraordinary narrow tissue tropism for erythroid progenitor cells in the bone marrow, which is determined by a highly restricted uptake. We have previously shown that the specific internalization is mediated by the interaction of the viral protein 1 unique region (VP1u) with a yet unknown cellular receptor. To locate the receptor-binding domain (RBD) within the VP1u, we analyzed the effect of truncations and mutations on the internalization capacity of the recombinant protein into UT7/Epo cells. Here we report that the N-terminal amino acids 5-80 of the VP1u are necessary and sufficient for cellular binding and internalization; thus, this N-terminal region represents the RBD required for B19V uptake. Using site-directed mutagenesis, we further identified a cluster of important amino acids playing a critical role in VP1u internalization. In silico predictions and experimental results suggest that the RBD is structured as a rigid fold of three α-helices. Finally, we found that dimerization of the VP1u leads to a considerably enhanced cellular binding and internalization. Taken together, we identified the RBD that mediates B19V uptake and mapped functional and structural motifs within this sequence. The findings reveal insights into the uptake process of B19V, which contribute to understand the pathogenesis of the infection and the neutralization of the virus by the immune system.

216-U-10 Pond and 216-Z-19 Ditch characterization studies

Energy Technology Data Exchange (ETDEWEB)

Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.

1994-02-01

The chemical, reprocessing of spent nuclear fuels at the US Department of Energy`s Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments.

216-U-10 Pond and 216-Z-19 Ditch characterization studies

International Nuclear Information System (INIS)

Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.

1994-02-01

The chemical, reprocessing of spent nuclear fuels at the US Department of Energy's Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments

Human parvovirus B19 VP1u Protein as inflammatory mediators induces liver injury in naïve mice.

Science.gov (United States)

Hsu, Tsai-Ching; Chiu, Chun-Ching; Chang, Shun-Chih; Chan, Hsu-Chin; Shi, Ya-Fang; Chen, Tzy-Yen; Tzang, Bor-Show

2016-01-01

Human parvovirus B19 (B19V) is a human pathogen known to be associated with many non-erythroid diseases, including hepatitis. Although B19V VP1-unique region (B19-VP1u) has crucial roles in the pathogenesis of B19V infection, the influence of B19-VP1u proteins on hepatic injury is still obscure. This study investigated the effect and possible inflammatory signaling of B19-VP1u in livers from BALB/c mice that were subcutaneously inoculated with VP1u-expressing COS-7 cells. The in vivo effects of B19-VP1u were analyzed by using live animal imaging system (IVIS), Haematoxylin-Eosin staining, gel zymography, and immunoblotting after inoculation. Markedly hepatocyte disarray and lymphocyte infiltration, enhanced matrix metalloproteinase (MMP)-9 activity and increased phosphorylation of p38, ERK, IKK-α, IκB and NF-κB (p-p65) proteins were observed in livers from BALB/c mice receiving COS-7 cells expressing B19-VP1u as well as the significantly increased CRP, IL-1β and IL-6. Notably, IFN-γ and phosphorylated STAT1, but not STAT3, were also significantly increased in the livers of BALB/c mice that were subcutaneously inoculated with VP1u-expressing COS-7 cells. These findings revealed the effects of B19-VP1u on liver injury and suggested that B19-VP1u may have a role as mediators of inflammation in B19V infection.

19 CFR 10.46 - Articles for the United States.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles for the United States. 10.46 Section 10... THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. General Provisions Articles for Institutions § 10.46 Articles for the United States. Pursuant to subheadings 9808.00.10 and 9808...

31 CFR 595.315 - United States person; U.S. person.

Science.gov (United States)

2010-07-01

... (Continued) OFFICE OF FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY TERRORISM SANCTIONS REGULATIONS General Definitions § 595.315 United States person; U.S. person. The term United States person or U.S...

Unit Stratified Sampling as a Tool for Approximation of Stochastic Optimization Problems

Czech Academy of Sciences Publication Activity Database

Šmíd, Martin

2012-01-01

Roč. 19, č. 30 (2012), s. 153-169 ISSN 1212-074X R&D Projects: GA ČR GAP402/11/0150; GA ČR GAP402/10/0956; GA ČR GA402/09/0965 Institutional research plan: CEZ:AV0Z10750506 Institutional support: RVO:67985556 Keywords : Stochastic programming * approximation * stratified sampling Subject RIV: BB - Applied Statistics, Operational Research http://library.utia.cas.cz/separaty/2013/E/smid-unit stratified sampling as a tool for approximation of stochastic optimization problems.pdf

Seroprevalence of Epstein-Barr virus infection in U.S. children ages 6-19, 2003-2010.

Directory of Open Access Journals (Sweden)

Jennifer Beam Dowd

Full Text Available BACKGROUND: Epstein-Barr virus (EBV is a common herpesvirus linked to infectious mononucleosis and multiple cancers. There are no national estimates of EBV seroprevalence in the United States. Our objective was to estimate the overall prevalence and sociodemographic predictors of EBV among U.S. children and adolescents aged 6-19. METHODS: We calculated prevalence estimates and prevalence ratios for EBV seroprevalence using data from the 2003-2010 U.S. National Health and Nutrition Examination Survey (NHANES for children aged 6-19 (n = 8417. Poisson regression was used to calculate multivariable-adjusted prevalence ratios across subgroup categories (sex, race/ethnicity, parental education, household income, household size, foreign-born, BMI, and household smoking. FINDINGS: Overall EBV seroprevalence was 66.5% (95% CI 64.3%-68.7%.. Seroprevalence increased with age, ranging from 54.1% (95% CI 50.2%-57.9% for 6-8 year olds to 82.9% (95% CI 80.0%-85.9% for 18-19 year olds. Females had slightly higher seroprevalence (68.9%, 95% CI 66.3%-71.6% compared to males (64.2%, 95% CI 61.7%-66.8%. Seroprevalence was substantially higher for Mexican-Americans (85.4%, 95% CI 83.1%-87.8% and Non-Hispanic Blacks (83.1%, 95% CI 81.1%-85.1% than Non-Hispanic Whites (56.9%, 95% CI 54.1%-59.8%. Large differences were also seen by family income, with children in the lowest income quartile having 81.0% (95% CI 77.6%-84.5% seroprevalence compared to 53.9% (95% CI 50.5%-57.3% in the highest income quartile, with similar results for parental education level. These results were not explained by household size, BMI, or parental smoking. Among those who were seropositive, EBV antibody titers were significantly higher for females, Non-Hispanic Blacks and Mexican-Americans, with no association found for socioeconomic factors. CONCLUSIONS: In the first nationally representative U.S. estimates, we found substantial socioeconomic and race/ethnic differences in the

Natural and anthropogenic {sup 236}U in environmental samples

Energy Technology Data Exchange (ETDEWEB)

Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail: peter.steier@univie.ac.at; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)

2008-05-15

The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)

RECOMMENDATIONS FOR SAMPLING OF TANK 19 IN F TANK FARM

Energy Technology Data Exchange (ETDEWEB)

Harris, S.; Shine, G.

2009-12-14

Representative sampling is required for characterization of the residual material in Tank 19 prior to operational closure. Tank 19 is a Type IV underground waste storage tank located in the F-Tank Farm. It is a cylindrical-shaped, carbon steel tank with a diameter of 85 feet, a height of 34.25 feet, and a working capacity of 1.3 million gallons. Tank 19 was placed in service in 1961 and initially received a small amount of low heat waste from Tank 17. It then served as an evaporator concentrate (saltcake) receiver from February 1962 to September 1976. Tank 19 also received the spent zeolite ion exchange media from a cesium removal column that once operated in the Northeast riser of the tank to remove cesium from the evaporator overheads. Recent mechanical cleaning of the tank removed all mounds of material. Anticipating a low level of solids in the residual waste, Huff and Thaxton [2009] developed a plan to sample the waste during the final clean-up process while it would still be resident in sufficient quantities to support analytical determinations in four quadrants of the tank. Execution of the plan produced fewer solids than expected to support analytical determinations in all four quadrants. Huff and Thaxton [2009] then restructured the plan to characterize the residual separately in the North and the South regions: two 'hemispheres.' This document provides sampling recommendations to complete the characterization of the residual material on the tank bottom following the guidance in Huff and Thaxton [2009] to split the tank floor into a North and a South hemisphere. The number of samples is determined from a modification of the formula previously published in Edwards [2001] and the sample characterization data for previous sampling of Tank 19 described by Oji [2009]. The uncertainty is quantified by an upper 95% confidence limit (UCL95%) on each analyte's mean concentration in Tank 19. The procedure computes the uncertainty in analyte

Studies of U in the blood of two population samples

International Nuclear Information System (INIS)

Segovia, N.; Olguin, M.E.; Romero, M.

1986-01-01

The present work, attempts to establish the statistical distribution of blood uranium in a population of the same community, similar in age and in living patterns. U traces were evaluated by a fission track technique both in whole blood and plasma samples. Dried samples were compressed into pellets and irradiated in a nuclear reactor using the external detector method. For U quantification, standard U samples were used. A comparative sampling of U content in blood samples from a group of radiation exposed workers and another of leukemia patients was also carried out. Results from the sampling groups are reported and discussed. (author)

19 CFR 181.62 - Commercial samples of negligible value.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Commercial samples of negligible value. 181.62... Returned After Repair or Alteration § 181.62 Commercial samples of negligible value. (a) General. Commercial samples of negligible value imported from Canada or Mexico may qualify for duty-free entry under...

19 CFR 148.33 - Articles acquired abroad.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Articles acquired abroad. 148.33 Section 148.33... Articles acquired abroad. (a) Exemption. Each returning resident is entitled to bring in free of duty and..., Harmonized Tariff Schedule of the United States (19 U.S.C. 1202), articles for his personal or household use...

Incidence and distribution of transplantable organs from donors after circulatory determination of death in U.S. intensive care units.

Science.gov (United States)

Halpern, Scott D; Hasz, Richard D; Abt, Peter L

2013-04-01

All U.S. acute care hospitals must maintain protocols for recovering organs from donors after circulatory determination of death (DCDD), but the numbers, types, and whereabouts of available organs are unknown. To assess the maximal potential supply and distribution of DCDD organs in U.S. intensive care units. We conducted a population-based cohort study among a randomly selected sample of 50 acute care hospitals in the highest-volume donor service area in the United States. We identified all potentially eligible donors dying within 90 minutes of the withdrawal of life-sustaining therapy from July 1, 2008 to June 30, 2009. Using prespecified criteria, potential donors were categorized as optimal, suboptimal, or ineligible to donate their lungs, kidneys, pancreas, or liver. If only optimal DCDD organs were used, the deceased donor supplies of these organs could increase by up to 22.7, 8.9, 7.4, and 3.3%, respectively. If optimal and suboptimal DCDD organs were used, the corresponding supply increases could be up to 50.0, 19.7, 18.5, and 10.9%. Three-quarters of DCDD organs could be recovered from the 17.2% of hospitals with the highest annual donor volumes-typically those with trauma centers and more than 20 intensive care unit beds. Universal identification and referral of DCDD could increase the supply of transplantable lungs by up to one-half, and would not increase any other organ supply by more than one-fifth. The marked clustering of DCDD among a small number of identifiable hospitals could guide targeted interventions to improve DCDD identification, referral, and management.

Human herpesvirus 6B U19 protein is a PML-regulated transcriptional activator that localizes to nuclear foci in a PML-independent manner

DEFF Research Database (Denmark)

Kofod-Olsen, Emil; Ross-Hansen, Katrine; Mikkelsen, Jacob Giehm

2008-01-01

Human herpesvirus 6B (HHV-6B) contains an IE-B domain spanning open reading frames U16/17-U19, based on homology with human cytomegalovirus. Here, the protein product, U19, of the HHV-6B U19 gene is identified as a 47 kDa transcriptional activator. HHV-6B infection or overexpression of U19...... transactivated the RANTES promoter. Mutational analysis of the promoter indicated that transactivation was not critically dependent on the promoter sites CRE, NF-kappaB, ISRE or NF-IL6. ND10 are nuclear substructures that are involved in several cellular regulatory pathways, including those controlling gene...... structure, U19 also localized to the centre of ND10. Knockdown of PML by small interfering RNA did not prevent U19 localization to ND10-like foci, but instead led to a fourfold increase in U19-induced transcription from the RANTES promoter. Generation of four truncated U19 proteins indicated that the N...

Human herpesvirus 6B U19 protein is a PML-regulated transcriptional activator that localizes to nuclear foci in a PML-independent manner

DEFF Research Database (Denmark)

Kofod-Olsen, Emil; Ross-Hansen, Katrine; Mikkelsen, Jacob Giehm

2008-01-01

Human herpesvirus 6B (HHV-6B) contains an IE-B domain spanning open reading frames U16/17-U19, based on homology with human cytomegalovirus. Here, the protein product, U19, of the HHV-6B U19 gene is identified as a 47 kDa transcriptional activator. HHV-6B infection or overexpression of U19...

Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report

International Nuclear Information System (INIS)

STEEN, F.H.

1999-01-01

This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

Unit 06 - Sampling the World

OpenAIRE

Unit 06, CC in GIS; Parson, Charles; Nyerges, Timothy

1990-01-01

This unit begins the section on data acquisition by looking at how the infinite complexity of the real world can be discretized and sampled. It considers sampling techniques and associated issues of accuracy and standards.

Determination of uranium isotopic composition and 236U content of soil samples and hot particles using inductively coupled plasma mass spectrometry.

Science.gov (United States)

Boulyga, S F; Becker, J S

2001-07-01

As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10(-4) and 10(-3) counts per atom were achieved for 238U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH+/U+ was 1.2 x 10(-4) and 1.4 x 10(-4), respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 microg L(-1) NBS U-020 standard solution was 0.11% (238U/235U) and 1.4% (236U/238U) using a MicroMist nebulizer and 0.25% (235U/238U) and 1.9% (236U/P38U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236U/238U ratio ranged from 10(-5) to 10(-3). Results obtained with ICP-MS, alpha- and gamma-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples.

Determination of uranium isotopic composition and 236U content of soil samples and hot particles using inductively coupled plasma mass spectrometry

International Nuclear Information System (INIS)

Boulyga, S.F.; Becker, J.S.

2001-01-01

As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The 236 U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10 -4 and 10 -3 counts per atom were achieved for 238 U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH + /U + was 1.2 x 10 -4 and 1.4 x 10 -4 , respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 μg L -1 NBS U-020 standard solution was 0.11% ( 238 U/ 235 U) and 1.4% ( 236 U/ 238 U) using a MicroMist nebulizer and 0.25% ( 235 U/ 238 U) and 1.9% ( 236 U/ 238 U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the 236 U/ 238 U ratio ranged from 10 -5 to 10 -3 . Results obtained with ICP-MS, α- and γ-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)

21 CFR 203.38 - Sample lot or control numbers; labeling of sample units.

Science.gov (United States)

2010-04-01

... numbers; labeling of sample units. (a) Lot or control number required on drug sample labeling and sample... identifying lot or control number that will permit the tracking of the distribution of each drug sample unit... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Sample lot or control numbers; labeling of sample...

Kriminal i represivni sustav u Osijeku na prijelazu iz 19. u 20. stoljeće promatran kroz elemente biopolitike i socijalne povijesti

OpenAIRE

Pejić, Luka

2015-01-01

Elementi biopolitike i disciplinskog društva kao što su statistike, izvještaji, regulacije i standardizacije obrazovnih, zdravstvenih i drugih praksi postaju krajnje važni za „nadzor i kaznu“ subjekta tijekom 19. stoljeća. S obzirom na industrijski razvoj, ove je trendove moguće promotriti i u Osijeku krajem 19. i početkom 20. stoljeća. Primajući utjecaje iz Budimpešte, Beča, Zagreba i drugih gradova, osječke gradske vlasti poduzimaju nove korake u osiguravanju produktivne radne snage te izol...

Sampling and Analysis Plan for the 221-U Facility

International Nuclear Information System (INIS)

Rugg, J.E.

1998-02-01

This sampling and analysis plan (SAP) presents the rationale and strategy for the sampling and analysis activities proposed to be conducted to support the evaluation of alternatives for the final disposition of the 221-U Facility. This SAP will describe general sample locations and the minimum number of samples required. It will also identify the specific contaminants of potential concern (COPCs) and the required analysis. This SAP does not define the exact sample locations and equipment to be used in the field due to the nature of unknowns associated with the 221-U Facility

Statistical Analysis Of Tank 19F Floor Sample Results

International Nuclear Information System (INIS)

Harris, S.

2010-01-01

Representative sampling has been completed for characterization of the residual material on the floor of Tank 19F as per the statistical sampling plan developed by Harris and Shine. Samples from eight locations have been obtained from the tank floor and two of the samples were archived as a contingency. Six samples, referred to in this report as the current scrape samples, have been submitted to and analyzed by SRNL. This report contains the statistical analysis of the floor sample analytical results to determine if further data are needed to reduce uncertainty. Included are comparisons with the prior Mantis samples results to determine if they can be pooled with the current scrape samples to estimate the upper 95% confidence limits (UCL95%) for concentration. Statistical analysis revealed that the Mantis and current scrape sample results are not compatible. Therefore, the Mantis sample results were not used to support the quantification of analytes in the residual material. Significant spatial variability among the current scrape sample results was not found. Constituent concentrations were similar between the North and South hemispheres as well as between the inner and outer regions of the tank floor. The current scrape sample results from all six samples fall within their 3-sigma limits. In view of the results from numerous statistical tests, the data were pooled from all six current scrape samples. As such, an adequate sample size was provided for quantification of the residual material on the floor of Tank 19F. The uncertainty is quantified in this report by an UCL95% on each analyte concentration. The uncertainty in analyte concentration was calculated as a function of the number of samples, the average, and the standard deviation of the analytical results. The UCL95% was based entirely on the six current scrape sample results (each averaged across three analytical determinations).

On-Site Fecal Sludge Treatment with the Anaerobic Digestion Pasteurization Latrine

OpenAIRE

Forbis-Stokes, Aaron A.; O'Meara, Patrick F.; Mugo, Wangare; Simiyu, Gelas M.; Deshusses, Marc A.

2016-01-01

Abstract The Anaerobic Digestion Pasteurization Latrine (ADPL) is a self-contained and energy neutral on-site sanitation system using anaerobic digestion of fecal sludge to generate biogas and then uses the biogas to pasteurize the digester effluent at 65?75?C to produce a safe effluent that can be reused locally as a fertilizer. Two ADPL systems were installed on residential plots with 17 and 35 residents in a peri-urban area outside of Eldoret, Kenya. Each system comprised three toilets bui...

Tank 241-U-105 push mode core sampling and analysis plan

International Nuclear Information System (INIS)

Bell, K.E.

1995-01-01

This Sampling and Analysis Plan (SAP) will identify characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples and two push mode core samples from tank 241-U-105 (U-105)

High frequency of parvovirus B19 DNA in bone marrow samples from rheumatic patients

DEFF Research Database (Denmark)

Lundqvist, Anders; Isa, Adiba; Tolfvenstam, Thomas

2005-01-01

BACKGROUND: Human parvovirus B19 (B19) polymerase chain reaction (PCR) is now a routine analysis and serves as a diagnostic marker as well as a complement or alternative to B19 serology. The clinical significance of a positive B19 DNA finding is however dependent on the type of tissue or body fluid...... analysed and of the immune status of the patient. OBJECTIVES: To analyse the clinical significance of B19 DNA positivity in bone marrow samples from rheumatic patients. STUDY DESIGN: Parvovirus B19 DNA was analysed in paired bone marrow and serum samples by nested PCR technique. Serum was also analysed...... negative group. A high frequency of parvovirus B19 DNA was thus detected in bone marrow samples in rheumatic patients. The clinical data does not support a direct association between B19 PCR positivity and rheumatic disease manifestation. Therefore, the clinical significance of B19 DNA positivity in bone...

A sample of high multiplicity pp reactions at 19 GeV/c

International Nuclear Information System (INIS)

Allan, J.; Blomqvist, G.

1976-02-01

This report describes the experimental procedure used in obtaining samples of high muliplicity pp reactions at 19 GeV/c. Various methods to improve the quality of the samples are tested. The analysis is part of the general study of pp collisions at 19 GeV/c which is performed within the Scandinavian Bubble Chamber Collaboration. (Auth.)

19 CFR 10.242 - Definitions.

Science.gov (United States)

2010-04-01

... “beneficiary country” as defined in § 10.202(a) for purposes of the ATPA which the President also has... articles under 19 U.S.C. 3203(b)(3) and which has been the subject of a determination by the President or... entered into by the United States, Canada, and Mexico on December 17, 1992. Preferential treatment...

27 CFR 31.161 - Conversion between metric and U.S. units.

Science.gov (United States)

2010-04-01

... Wholesale Dealers' Records and Reports § 31.161 Conversion between metric and U.S. units. When liters are... number of cases to be converted, as follows: (a) If the conversion from liters to U.S. units is made... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion between metric...

31 CFR 594.315 - United States person; U.S. person.

Science.gov (United States)

2010-07-01

... (Continued) OFFICE OF FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY GLOBAL TERRORISM SANCTIONS REGULATIONS General Definitions § 594.315 United States person; U.S. person. The term United States person or...

PEMBUATAN SERBUK U-6Zr DENGAN PENGKAYAAN URANIUM 19,75 % UNTUK BAHAN BAKAR REAKTOR RISET

Directory of Open Access Journals (Sweden)

Masrukan Masrukan

2016-03-01

Full Text Available ABSTRAK PEMBUATAN SERBUK PADUAN U-6Zr DENGAN PENGKAYAAN URANIUM 19,75 % UNTUK BAHAN BAKAR REAKTOR RISET. Telah dilakukan pembuatan serbuk paduan U-6Zr dengan pengkayaan 19,75 % untuk bahan bakar reaktor riset. Pembuatan bahan bakar U-6Zr ini dalam rangka mencari bahan bakar baru yang mempunyai densitas tinggi untuk mengganti bahan bakar yang sudah ada U3Si2-Al. Tujuan dari percobaan ini untuk mengetahui sifat-sifat serbuk paduan U- 6Zr yang diperoleh dari proses hydriding-dehydriding sebagai kandidat bahan bakar reaktor riset. Serbuk yang diperoleh dari proses hydriding-dehydriding dikenai pengujian, diantaranya pungujian komposisi kimia, densitas, kandungan hidrogen, fasa dan sifat termal. Hasil pengujian komposisi kimia menunjukkan beberapa unsur seperti Al, Ca, Cu, dan Ni melebihi batas yang diijinkan dimana masing-masing unsur terdapat sebesar 202,21 ppm; 214,05 ppm; 61,25 ppm dan 134,53 ppm. Pada pengujian diperolah densitas serbuk U-6Zr sebesar 13,58 g/cm3 dan pada pengujian kandungan hidrogen sisa diperoleh kandungan hidrogen sebesar 0,16 %. Untuk pengujian fasa, diperoleh fasa αU dan δU, sedangkan pada pengujian sifat termal yakni transformasi temperatur terdapat dua puncak yakni puncak pertama terjadi pada temperatur 274 hingga 311 oC dan puncak kedua terjadi pada temperatur 493 hingga 527oC. Puncak pertama terjadi reaksi endotermik dengan menyerap panas sebesar ∆H = 6,23 cal/g tetapi tidak terbentuk fasa baru, sedangkan puncak kedua terjadi reaksi eksotermik dengan mengeluarkan panas sebesar ∆H = -9.34 cal/g dan terbentuk fasa αZr. Sementara itu, dari pengujian kapasitas panas pada temperatur 34 hingga 75 oC, terjadinya penurunan nilai kapasitas panas yang disertai dengan penyerapan panas. Pada temperatur yang lebih tinggi hingga temperatur 437oC nilai kapasitas panas menjadi lebih kecil disertai pengeluaran panas. Reaksi termokimia antara Zr dengan hidrogen sisa menunjukkan terbentuknya fasa αZr yang diindikasikan oleh reaksi

75 FR 9455 - U.S. Biomedical Corp., (f/k/a United Textiles & Toys, Inc.), U.S. Environmental Solutions, Inc...

Science.gov (United States)

2010-03-02

... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] U.S. Biomedical Corp., (f/k/a United Textiles & Toys, Inc.), U.S. Environmental Solutions, Inc. (n/k/a EnviroResolutions, Inc.), USA Bridge....S. Biomedical Corp. (f/k/a United Textiles & Toys, Inc.) because it has not filed any periodic...

A Rating of training units in boys basketball by category of U14

OpenAIRE

Mašková, Veronika

2013-01-01

Title: A Rating of training units in boys basketball by category of U14. Objective: Preparation, implementation and evaluation of basketball training units starting by U14 categories. The training units focus on a drill, training game and fitness training following by blending these three components. Methods: Preparing these training units I have used the professional basketball literature. This bachelor work is based on quantitative way of research. The raiting of training units was analyzed...

Study on the leach mechanism of 90-19/U glass form in underground water of disposal site

International Nuclear Information System (INIS)

Sheng Jiawei; Luo Shanggeng; Tang Baolong

1996-01-01

The leach behavior of 90-19/U glass form in underground water (UW) of disposal site and in the deionized water (DIW) is studied. The total mass losses of glass form and the normalized element mass losses of B, Li and Si in UW are presented and compared to DIW. It is found that the ions in UW affect the leach behavior of 90-19/U glass. At the beginning of the reaction the reaction rate of the glass is smaller in UW than in DIW due to the low glass dissolution affinity in UW which is defined as (1-c/K). The rate determining step of leach reaction of 90-19/U glass in UW during the entire reaction period is the ion-exchange reaction. The apparent activation energy of glass reaction in UW is 51.6 kJ/mol

19 CFR 19.47 - Security.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Security. 19.47 Section 19.47 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Container Stations § 19.47 Security. The...

VP1u phospholipase activity is critical for infectivity of full-length parvovirus B19 genomic clones.

Science.gov (United States)

Filippone, Claudia; Zhi, Ning; Wong, Susan; Lu, Jun; Kajigaya, Sachiko; Gallinella, Giorgio; Kakkola, Laura; Söderlund-Venermo, Maria; Young, Neal S; Brown, Kevin E

2008-05-10

Three full-length genomic clones (pB19-M20, pB19-FL and pB19-HG1) of parvovirus B19 were produced in different laboratories. pB19-M20 was shown to produce infectious virus. To determine the differences in infectivity, all three plasmids were tested by transfection and infection assays. All three clones were similar in viral DNA replication, RNA transcription, and viral capsid protein production. However, only pB19-M20 and pB19-HG1 produced infectious virus. Comparison of viral sequences showed no significant differences in ITR or NS regions. In the capsid region, there was a nucleotide sequence difference conferring an amino acid substitution (E176K) in the phospholipase A2-like motif of the VP1-unique (VP1u) region. The recombinant VP1u with the E176K mutation had no catalytic activity as compared with the wild-type. When this mutation was introduced into pB19-M20, infectivity was significantly attenuated, confirming the critical role of this motif. Investigation of the original serum from which pB19-FL was cloned confirmed that the phospholipase mutation was present in the native B19 virus.

VP1u phospholipase activity is critical for infectivity of full-length parvovirus B19 genomic clones✰

Science.gov (United States)

Filippone, Claudia; Zhi, Ning; Wong, Susan; Lu, Jun; Kajigaya, Sachiko; Gallinella, Giorgio; Kakkola, Laura; Venermo, Maria S Söderlund; Young, Neal S.; Brown, Kevin E.

2008-01-01

Three full-length genomic clones (pB19-M20, pB19-FL and pB19-HG1) of parvovirus B19 were produced in different laboratories. pB19-M20 was shown to produce infectious virus. To determine the differences in infectivity, all three plasmids were tested by transfection and infection assays. All three clones were similar in viral DNA replication, RNA transcription, and viral capsid protein production. However, only pB19-M20 and pB19-HG1 produced infectious virus. Comparison of viral sequences showed no significant differences in ITR or NS regions. In the capsid region, there was a nucleotide sequence difference conferring an amino acid substitution (E176K) in the phospholipase A2-like motif of the VP1-unique (VP1u) region. The recombinant VP1u with the E176K mutation had no catalytic activity as compared with the wild-type. When this mutation was introduced into pB19-M20, infectivity was significantly attenuated, confirming the critical role of this motif. Investigation of the original serum from which pB19-FL was cloned confirmed that the phospholipase mutation was present in the native B19 virus. PMID:18252260

The U-tube sampling methodology and real-time analysis of geofluids

International Nuclear Information System (INIS)

Freifeld, Barry; Perkins, Ernie; Underschultz, James; Boreham, Chris

2009-01-01

The U-tube geochemical sampling methodology, an extension of the porous cup technique proposed by Wood (1973), provides minimally contaminated aliquots of multiphase fluids from deep reservoirs and allows for accurate determination of dissolved gas composition. The initial deployment of the U-tube during the Frio Brine Pilot CO 2 storage experiment, Liberty County, Texas, obtained representative samples of brine and supercritical CO 2 from a depth of 1.5 km. A quadrupole mass spectrometer provided real-time analysis of dissolved gas composition. Since the initial demonstration, the U-tube has been deployed for (1) sampling of fluids down gradient of the proposed Yucca Mountain High-Level Waste Repository, Armagosa Valley, Nevada (2) acquiring fluid samples beneath permafrost in Nunuvut Territory, Canada, and (3) at a CO 2 storage demonstration project within a depleted gas reservoir, Otway Basin, Victoria, Australia. The addition of in-line high-pressure pH and EC sensors allows for continuous monitoring of fluid during sample collection. Difficulties have arisen during U-tube sampling, such as blockage of sample lines from naturally occurring waxes or from freezing conditions; however, workarounds such as solvent flushing or heating have been used to address these problems. The U-tube methodology has proven to be robust, and with careful consideration of the constraints and limitations, can provide high quality geochemical samples.

Determination of uranium isotopic composition and {sup 236}U content of soil samples and hot particles using inductively coupled plasma mass spectrometry

Energy Technology Data Exchange (ETDEWEB)

Boulyga, S.F. [Radiation Physics and Chemistry Problems Inst., Minsk (Belarus); Becker, J.S. [Central Department for Analytical Chemistry, Research Centre Juelich (Germany)

2001-07-01

As a result of the accident at the Chernobyl nuclear power plant (NPP) the environment was contaminated with spent nuclear fuel. The {sup 236}U isotope was used in this study to monitor the spent uranium from nuclear fallout in soil samples collected in the vicinity of the Chernobyl NPP. Nuclear track radiography was applied for the identification and extraction of hot radioactive particles from soil samples. A rapid and sensitive analytical procedure was developed for uranium isotopic ratio measurement in environmental samples based on double-focusing inductively coupled plasma mass spectrometry (DF-ICP-MS) with a MicroMist nebulizer and a direct injection high-efficiency nebulizer (DIHEN). The performance of the DF-ICP-MS with a quartz DIHEN and plasma shielded torch was studied. Overall detection efficiencies of 4 x 10{sup -4} and 10{sup -3} counts per atom were achieved for {sup 238}U in DF-ICP-QMS with the MicroMist nebulizer and DIHEN, respectively. The rate of formation of uranium hydride ions UH{sup +}/U{sup +} was 1.2 x 10{sup -4} and 1.4 x 10{sup -4}, respectively. The precision of short-term measurements of uranium isotopic ratios (n = 5) in 1 {mu}g L{sup -1} NBS U-020 standard solution was 0.11% ({sup 238}U/{sup 235}U) and 1.4% ({sup 236}U/{sup 238}U) using a MicroMist nebulizer and 0.25% ({sup 235}U/{sup 238}U) and 1.9% ({sup 236}U/{sup 238}U) using a DIHEN. The isotopic composition of all investigated Chernobyl soil samples differed from those of natural uranium; i.e. in these samples the {sup 236}U/{sup 238}U ratio ranged from 10{sup -5} to 10{sup -3}. Results obtained with ICP-MS, {alpha}- and {gamma}-spectrometry showed differences in the migration properties of spent uranium, plutonium, and americium. The isotopic ratio of uranium was also measured in hot particles extracted from soil samples. (orig.)

The U-tube: A new paradigm in borehole fluid sampling

Energy Technology Data Exchange (ETDEWEB)

Freifeld, B. M.

2009-10-01

Fluid samples from deep boreholes can provide insights into subsurface physical, chemical, and biological conditions. Recovery of intact, minimally altered aliquots of subsurface fluids is required for analysis of aqueous chemistry, isotopic composition, and dissolved gases, and for microbial community characterization. Unfortunately, for many reasons, collecting geofluids poses a number of challenges, from formation contamination by drilling to maintaining integrity during recovery from depths. Not only are there substantial engineering issues in retrieval of a representative sample, but there is often the practical reality that fluid sampling is just one of many activities planned for deep boreholes. The U-tube geochemical sampling system presents a new paradigm for deep borehole fluid sampling. Because the system is small, its ability to integrate with other measurement systems and technologies opens up numerous possibilities for multifunctional integrated wellbore completions. To date, the U-tube has been successfully deployed at four different field sites, each with a different deployment modality, at depths from 260 m to 2 km. While the U-tube has proven to be highly versatile, these installations have resulted in data that provide additional insights for improving future U-tube deployments.

30 CFR 70.207 - Bimonthly sampling; mechanized mining units.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Bimonthly sampling; mechanized mining units. 70... MINE SAFETY AND HEALTH MANDATORY HEALTH STANDARDS-UNDERGROUND COAL MINES Sampling Procedures § 70.207 Bimonthly sampling; mechanized mining units. (a) Each operator shall take five valid respirable dust samples...

Portable field water sample filtration unit

International Nuclear Information System (INIS)

Hebert, A.J.; Young, G.G.

1977-01-01

A lightweight back-packable field-tested filtration unit is described. The unit is easily cleaned without cross contamination at the part-per-billion level and allows rapid filtration of boiling hot and sometimes muddy water. The filtration results in samples that are free of bacteria and particulates and which resist algae growth even after storage for months. 3 figures

Closure Report for Corrective Action Unit 110: Areas 3 RWMS U-3ax/bl Disposal Unit, Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

J. L. Smith

2001-08-01

This Closure Report (CR) has been prepared for the Area 3 Radioactive Waste Management Site (RWMS) U-3ax/bl Disposal Unit Corrective Action Unit (CAU) 110 in accordance with the reissued (November 2000) Resource Conservation and Recovery Act (RCRA) Part B operational permit NEV HW009 (Nevada Division of Environmental Protection [NDEP], 2000) and the Federal Facility and Consent Order (FFACO) (NDEP et al., 1996). CAU 110 consists of one Corrective Action Site 03-23-04, described as the U-3ax/bl Subsidence Crater. Certifications of closure are located in Appendix A. The U-3ax/bl is a historic disposal unit within the Area 3 RWMS located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit was closed under the RCRA, as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10{sup 5} cubic meters (m{sup 3}) (8.12 x 10{sup 6} cubic feet [ft{sup 3}]) of waste. NTS atmospheric nuclear device testing generated approximately 95% of the total waste volume disposed of in U-3ax/bl; 80% of the total volume was generated from the Waste Consolidation Project. Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is normally in a state of moisture deficit.

Optogalvanic measurement of isotope shifts of doubly ionized uranium (U III) made using natural-U samples

International Nuclear Information System (INIS)

Piyakis, K.N.; Gagne, J.

1989-01-01

An efficient method of identifying 235 U III (in natural-U samples), with the help of the optogalvanic effect in a hollow-cathode discharge, is presented. The use of this method enabled us to carry out the measurement of isotope shifts and the preliminary investigation of hyperfine structures of U III. The 238 U-- 235 U shifts for the 591.313-, 586.045-, and 610.497-nm U III lines are found to be 921(3), 417(6), and 392(12) mK, respectively

NCHS - U.S. and State Trends on Teen Births

Data.gov (United States)

U.S. Department of Health & Human Services — This dataset assembles all final birth data for females aged 15–19, 15–17, and 18–19 for the United States and each of the 50 states. Data are based on 100% of birth...

19 CFR Appendix B to Part 191 - Sample Formats for Applications for Specific Manufacturing Drawback Rulings

Science.gov (United States)

2010-04-01

... rulings must be submitted to and reviewed and approved by CBP Headquarters. A specific manufacturing... Ruling Under 19 U.S.C. 1313(a) and 1313(b) (Combination) COMPANY LETTERHEAD (Optional) U.S. Customs and.... Customs will not approve an application which shows an unincorporated division or company as the applicant...

Vapor and gas sampling of single-shell tank 241-U-104 using the in situ vapor sampling system

International Nuclear Information System (INIS)

Lockrem, L.L.

1997-01-01

The Vapor Issue.Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-U-104. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the July 16, 1996 sampling of SST 241-U-104. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media

Foreign direct investment in the United States and u.s. Interests.

Science.gov (United States)

Graham, E M

1991-12-20

Foreign direct investment entered the United States at unprecedented rates during the second half of the 1980s. The result has been much higher levels of foreign ownership of U.S. economic activities than those to which the nation has been accustomed. The reasons for this investment include loss of competitiveness of U.S. firms compared to international rivals as well as attractions to foreign investors of the United States itself. The economic effects of greater levels of foreign ownership are generally positive, although some problems with levels of competition could ensue. National security considerations might cause the United States to place some restrictions on this investment, but other restrictions at the present time appear to be unwarranted.

19 CFR 19.34 - Customs supervision.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Customs supervision. 19.34 Section 19.34 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Space Bonded for the Storage of Wheat § 19.34 Customs supervision. Port...

DEVELOPMENT OF ENRICHMENT VERIFICATION ASSAY BASED ON THE AGE AND 235U AND 238U ACTIVITIES OF THE SAMPLES

International Nuclear Information System (INIS)

AL-YAMAHI, H.; EL-MONGY, S.A.

2008-01-01

Development of the enrichment verification methods is the backbone of the nuclear materials safeguards skeleton. In this study, the 235U percentage of depleted , natural and very slightly enriched uranium samples were estimated based on the sample age and the measured activity of 235U and 238U. The HpGe and NaI spectrometry were used for samples assay. A developed equation was derived to correlate the sample age and 235U and 238U activities with the enrichment percentage (E%). The results of the calculated E% by the deduced equation and the target E% values were found to be similar and within 0.58 -1.75% bias in the case of HpGe measurements. The correlation between them was found to be very sharp. The activity was also calculated based on the measured sample count rate and the efficiency at the gamma energies of interest. The correlation between the E% and the 235U activity was estimated and found to be linearly sharp. The results obtained by NaI was found to be less accurate than these obtained by HpGe. The bias in the case of NaI assay was in the range from 6.398% to 22.8% for E% verification

19 CFR 210.19 - Intervention.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Intervention. 210.19 Section 210.19 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.19 Intervention. Any person desiring to intervene in an...

Conversion factors: SI metric and U.S. customary units

Science.gov (United States)

,

1977-01-01

The policy of the U.S. Geological Survey is to foster use of the International System of Units (SI) which was defined by the 11th General Conference of Weights and Measures in 1960. This modernized metric system constitutes an international "language" by means of which communications throughout the world's scientific and economic communities may be improved. This publication is designed to familiarize the reader with the SI units of measurement that correspond to the common units frequently used in programs of the Geological Survey. In the near future, SI units will be used exclusively in most publications of the Survey; the conversion factors provided herein will help readers to obtain a "feel" for each unit and to "think metric."

File list: Unc.Kid.50.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.Kid.50.AllAg.Nephrectomy_sample hg19 Unclassified Kidney Nephrectomy sample htt...p://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.Kid.50.AllAg.Nephrectomy_sample.bed ...

File list: DNS.Kid.05.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available DNS.Kid.05.AllAg.Nephrectomy_sample hg19 DNase-seq Kidney Nephrectomy sample http:/.../dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.Kid.05.AllAg.Nephrectomy_sample.bed ...

File list: Unc.Kid.10.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.Kid.10.AllAg.Nephrectomy_sample hg19 Unclassified Kidney Nephrectomy sample htt...p://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.Kid.10.AllAg.Nephrectomy_sample.bed ...

File list: DNS.Kid.50.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available DNS.Kid.50.AllAg.Nephrectomy_sample hg19 DNase-seq Kidney Nephrectomy sample http:/.../dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.Kid.50.AllAg.Nephrectomy_sample.bed ...

File list: Unc.Kid.20.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.Kid.20.AllAg.Nephrectomy_sample hg19 Unclassified Kidney Nephrectomy sample htt...p://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.Kid.20.AllAg.Nephrectomy_sample.bed ...

19 CFR 200.735-113 - Miscellaneous statutory provisions.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Miscellaneous statutory provisions. 200.735-113... Government Service.” (b) Chapter 11 of Title 18, United States Code, relating to bribery, graft, and... agent of a foreign principal registered under the Foreign Agents Registration Act (18 U.S.C. 219). [31...

77 FR 61650 - The Entire United States and U.S. Territories

Science.gov (United States)

2012-10-10

... given that as a result of Public Law 106-50, the Veterans entrepreneurship and Small Business... SMALL BUSINESS ADMINISTRATION [Disaster Declaration 13332 Disaster ZZ-00008] The Entire United States and U.S. Territories AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is...

19 CFR 19.10 - Examination packages.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 19.10 Section 19.10 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... Examination packages. Merchandise sent from a bonded warehouse to the appraiser's stores for examination shall...

Determination of the activity of the uranium isotopes U-234, U-235 and U-238 in environmental samples by alpha spectrometry

International Nuclear Information System (INIS)

Kromphorn, G.

1996-02-01

Different materials containing urandium are regularly investigated in the Laboratory for Environmental Radioactivity of the Physikalisch-Technische Bundesanstalt (PTB) with respect to the activity of the uranium isotopes ( 234 U, 235 U, and 238 U). Moreover for reasons of quality assurance, the PTB takes part in international comparisons where also uranium contents are to be determined in environmental samples and in the framework of which reference materials can be certified. Finally in national comparisons the PTB has the task to determine values of the specific activity for the different isotopes which can play the role of nominal (orientation) values. The single steps of uranium analyses are described after a compilation of the most important data of the uranium isotopes contained in natural uranium: The use of 232 U as tracer, the chemical separation analytics, the production of α-sources and the measuring methods. Analyses of a soil sample and a waste water sample with respect to their specific uranium activity have been chosen as examples of a practical application. (orig.) [de

Five Year Results of US Intergroup/RTOG 9704 With Postoperative CA 19-9 {<=}90 U/mL and Comparison to the CONKO-001 Trial

Energy Technology Data Exchange (ETDEWEB)

Berger, Adam C., E-mail: adam.berger@jefferson.edu [Thomas Jefferson University Hospital, Philadelphia, Pennsylvania (United States); Winter, Kathryn [RTOG Statistical Center, Philadelphia, Pennsylvania (United States); Hoffman, John P. [Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Regine, William F. [University of Maryland Medical Systems, Baltimore, Maryland (United States); Abrams, Ross A. [Rush University Medical Center, Chicago, Illinois (United States); Safran, Howard [Division of Hematology/Oncology, The Miriam Hospital, Providence, Rhode Island (United States); Freedman, Gary M. [Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Benson, Alan B. [Northwestern Memorial Hospital, Chicago, Illinois (United States); MacDonald, John [St. Vincent' s Comprehensive Cancer Center, New York, New York (United States); Willett, Christopher G. [Duke University Medical Center, Durham, North Carolina (United States)

2012-11-01

Purpose: Radiation Therapy Oncology Group (RTOG) trial 9704 was the largest randomized trial to use adjuvant chemoradiation therapy for patients with pancreatic cancer. This report analyzes 5-year survival by serum level of tumor marker CA 19-9 of {<=}90 vs >90 U/mL and compares results to the those of the CONKO-001 trial. Methods and Materials: CA 19-9 expression was analyzed as a dichotomized variable ({<=}90 vs >90 U/mL). Cox proportional hazard models were used to identify the impact of the CA 19-9 value on overall survival (OS). Actuarial estimates of OS were calculated using the Kaplan-Meier method. Results: Both univariate (hazard ratio [HR] = 3.2; 95% confidence interval [CI], 2.3-4.3, P<.0001) and multivariate (HR = 3.1; 95% CI, 2.2-4.2, P<.0001) analyses demonstrated a statistically significant decrease in OS for CA 19-9 serum level of {>=}90 U/mL. For patients in the gemcitabine (Gem) treatment arm with CA 19-9 <90 U/mL, median survival was 21 months. For patients with CA 19-9 {>=}90 U/mL, this number dropped to 10 months. In patients with pancreatic head tumors in the Gem treatment arm with RT quality assurance per protocol and CA 19-9 of <90 U/mL, median survival and 5-year rate were 24 months and 34%. In comparison, the median survival and 5-year OS rate for patients in the Gem arm of the CONKO trial were 22 months and 21%. Conclusions: This analysis demonstrates that patients with postresection CA 19-9 values {>=}90 U/mL had a significantly worse survival. Patients with pancreatic head tumors treated with Gem with CA 19-9 serum level of <90 U/mL and per protocol RT had favorable survival compared to that seen in the CONKO trial. CA 19-9 is a stratification factor for the current RTOG adjuvant pancreas trial (0848).

Archaeological investigations at a toolstone source area and temporary camp: Sample Unit 19-25, Nevada Test Site, Nye County, Nevada. Technical report No. 77

Energy Technology Data Exchange (ETDEWEB)

Jones, R.C.; DuBarton, A.; Edwards, S.; Pippin, L.C.; Beck, C.M.

1993-12-31

Archaeological investigations were initiated at Sample Unit 19--25 to retrieve information concerning settlement and subsistence data on the aboriginal hunter and gatherers in the area. Studies included collection and mapping of 35.4 acres at site 26NY1408 and excavation and mapping of 0.02 acres at site 26NY7847. Cultural resources include two rock and brush structures and associated caches and a large lithic toolstone source area and lithic artifact scatter. Temporally diagnostic artifacts indicate periodic use throughout the last 12,000 years; however dates associated with projectile points indicate most use was in the Middle and Late Archaic. Radiocarbon dates from the rock and brush structures at site 26NY7847 indicate a construction date of A.D. 1640 and repair between A.D. 1800 and 1950 for feature 1 and between A.D. 1330 and 1390 and repair at A.D. 1410 for feature 2. The dates associated with feature 2 place its construction significantly earlier than similar structures found elsewhere on Pahute Mesa. Activity areas appear to reflect temporary use of the area for procurement of available lithic and faunal resources and the manufacture of tools.

File list: Pol.Kid.20.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Pol.Kid.20.AllAg.Nephrectomy_sample hg19 RNA polymerase Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Kid.20.AllAg.Nephrectomy_sample.bed ...

File list: Pol.Kid.10.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Pol.Kid.10.AllAg.Nephrectomy_sample hg19 RNA polymerase Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Kid.10.AllAg.Nephrectomy_sample.bed ...

File list: Pol.Kid.05.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Pol.Kid.05.AllAg.Nephrectomy_sample hg19 RNA polymerase Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Kid.05.AllAg.Nephrectomy_sample.bed ...

File list: Oth.Kid.10.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Oth.Kid.10.AllAg.Nephrectomy_sample hg19 TFs and others Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Kid.10.AllAg.Nephrectomy_sample.bed ...

File list: Oth.Kid.50.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Oth.Kid.50.AllAg.Nephrectomy_sample hg19 TFs and others Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Kid.50.AllAg.Nephrectomy_sample.bed ...

File list: Oth.Kid.05.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Oth.Kid.05.AllAg.Nephrectomy_sample hg19 TFs and others Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Kid.05.AllAg.Nephrectomy_sample.bed ...

File list: Oth.Kid.20.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Oth.Kid.20.AllAg.Nephrectomy_sample hg19 TFs and others Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Kid.20.AllAg.Nephrectomy_sample.bed ...

19 CFR 19.38 - Supervision of exportation.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supervision of exportation. 19.38 Section 19.38 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Duty-Free Stores § 19.38 Supervision of exportation. (a) Sales...

19 CFR 12.40 - Seizure; disposition of seized articles; reports to United States attorney.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure; disposition of seized articles; reports... § 12.40 Seizure; disposition of seized articles; reports to United States attorney. (a) Any book... United States attorney for his consideration and action. (b) Upon the seizure of articles or matter...

Tank 241-U-107 vapor sampling and analysis tank characterization report

Energy Technology Data Exchange (ETDEWEB)

Huckaby, J.L.

1995-05-31

Tank 241-U-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in {open_quotes}Program Plan for the Resolution of Tank Vapor Issues.{close_quotes} Tank 241-U-107 was vapor sampled in accordance with {open_quotes}Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.{close_quotes}

Some results of processing NURE geochemical sampling in the northern Rocky Mountain area

International Nuclear Information System (INIS)

Thayer, P.A.; Cook, J.R.; Price, V. Jr.

1980-01-01

The National Uranium Resource Evaluation (NURE) program was begun in the spring of 1973 to evaluate domestic uranium resources in the continental United States and to identify areas favorable for uranium exploration. The significance of the distribution of uranium in natural waters and sediments will be assessed as an indicator of favorable areas for the discovery of uranium deposits. This paper is oriented primarily to the discussion of stream sediments. Data for the Challis 1 0 x 2 0 NTMS quadrangle will be used for specific samples of NURE data processing. A high-capacity neutron activation analysis facility at SRL is used to determine uranium and about 19 other elements in hydrogeochemical samples. Evaluation of the areal distributions of uranium ratios demonstrate that most of the high U/Hf, U/Th and U/(Th + Hf) ratios occur scattered throughout the western two-thirds of the quadrangle. Most of the higher ratio values are found in samples taken at sites underlain by granitic rocks of the Idaho batholith or Tertiary-age plutons

Effects of Childhood Adversity on Bullying and Cruelty to Animals in the United States: Findings from a National Sample

Science.gov (United States)

Vaughn, Michael G.; Fu, Qiang; Beaver, Kevin M.; DeLisi, Matt; Perron, Brian E.; Howard, Matthew O.

2011-01-01

This study examined effects of type of and cumulative burden of childhood adversities on bullying and cruelty to animals in the United States. Data were derived from Waves I and II of the National Epidemiologic Survey on Alcohol and Related Conditions, a nationally representative sample of U.S. adults. Structured psychiatric interviews were…

Closure Plan for Corrective Action Unit 110: Area 3 RWMS U-3ax/bl Disposal Unit, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

Fitzmaurice, T. M.

2000-01-01

This Closure Plan has been prepared for the Area 3 RWMS U-3ax/bl Disposal Unit Corrective Action Unit 110 in accordance with the Federal Facility and Consent Order (Nevada Division of Environmental Protection [NDEP] et al., 1996). The U-3ax/bl is a historic disposal unit within the Area 3 Radioactive Waste Management Site located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit is scheduled for permanent closure under the Resource Conservation and Recovery Act as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10 5 cubic meters (8.12 x 10 6 cubic feet) of waste. NTS nuclear device testing generated approximately 95 percent of the total volume disposed of in U-3ax/bl, the majority of which came from the Waste Consolidation Project (80 percent of the total volume) (Elletson and Johnejack, 1995). Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is continuously in a state of moisture deficit. The U-3ax/bl Disposal Unit will be closed in place by installing a Resource Conservation and Recovery Act equivalent cover. Following cover construction a fence will be installed around the cover to prevent accidental damage to the cover. Post-closure monitoring will consist of site inspections to determine the condition of the engineered cover and cover performance monitoring using Time-Domain Reflectometry arrays to monitor moisture migration in the cover. Any identified maintenance and repair

Closure Plan for Corrective Action Unit 110: Area 3 RWMS U-3ax/bl Disposal Unit, Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

T. M. Fitzmaurice

2000-08-01

This Closure Plan has been prepared for the Area 3 RWMS U-3ax/bl Disposal Unit Corrective Action Unit 110 in accordance with the Federal Facility and Consent Order (Nevada Division of Environmental Protection [NDEP] et al., 1996). The U-3ax/bl is a historic disposal unit within the Area 3 Radioactive Waste Management Site located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit is scheduled for permanent closure under the Resource Conservation and Recovery Act as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10{sup 5} cubic meters (8.12 x 10{sup 6} cubic feet) of waste. NTS nuclear device testing generated approximately 95 percent of the total volume disposed of in U-3ax/bl, the majority of which came from the Waste Consolidation Project (80 percent of the total volume) (Elletson and Johnejack, 1995). Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is continuously in a state of moisture deficit. The U-3ax/bl Disposal Unit will be closed in place by installing a Resource Conservation and Recovery Act equivalent cover. Following cover construction a fence will be installed around the cover to prevent accidental damage to the cover. Post-closure monitoring will consist of site inspections to determine the condition of the engineered cover and cover performance monitoring using Time-Domain Reflectometry arrays to monitor moisture migration in the cover. Any identified maintenance and

File list: His.Kid.10.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available His.Kid.10.AllAg.Nephrectomy_sample hg19 Histone Kidney Nephrectomy sample SRX95646...1037587,SRX1037586,SRX1037580 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Kid.10.AllAg.Nephrectomy_sample.bed ...

File list: His.Kid.05.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available His.Kid.05.AllAg.Nephrectomy_sample hg19 Histone Kidney Nephrectomy sample SRX95646...1037579,SRX1037580,SRX1037585 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Kid.05.AllAg.Nephrectomy_sample.bed ...

File list: His.Kid.20.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available His.Kid.20.AllAg.Nephrectomy_sample hg19 Histone Kidney Nephrectomy sample SRX95646...1037587,SRX1037580,SRX1037579 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Kid.20.AllAg.Nephrectomy_sample.bed ...

File list: His.Kid.50.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available His.Kid.50.AllAg.Nephrectomy_sample hg19 Histone Kidney Nephrectomy sample SRX95646...X1037580,SRX1037579,SRX956473 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Kid.50.AllAg.Nephrectomy_sample.bed ...

19 CFR 19.1 - Classes of customs warehouses.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Classes of customs warehouses. 19.1 Section 19.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN § 19.1 Classes of...

19 CFR 181.13 - Failure to comply with requirements.

Science.gov (United States)

2010-04-01

... warrant where an exporter or a producer in the United States fails to comply with any requirement of this... 19 Customs Duties 2 2010-04-01 2010-04-01 false Failure to comply with requirements. 181.13 Section 181.13 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY...

File list: NoD.Kid.10.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NoD.Kid.10.AllAg.Nephrectomy_sample hg19 No description Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.Kid.10.AllAg.Nephrectomy_sample.bed ...

File list: NoD.Kid.05.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NoD.Kid.05.AllAg.Nephrectomy_sample hg19 No description Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.Kid.05.AllAg.Nephrectomy_sample.bed ...

File list: NoD.Kid.20.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available NoD.Kid.20.AllAg.Nephrectomy_sample hg19 No description Kidney Nephrectomy sample h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.Kid.20.AllAg.Nephrectomy_sample.bed ...

Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3

Energy Technology Data Exchange (ETDEWEB)

STEEN, F.H.

1999-08-25

This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP.

19 CFR 7.2 - Insular possessions of the United States other than Puerto Rico.

Science.gov (United States)

2010-04-01

... than Puerto Rico. 7.2 Section 7.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... NAVAL STATION § 7.2 Insular possessions of the United States other than Puerto Rico. (a) Insular possessions of the United States other than Puerto Rico are also American territory but, because those insular...

Streamlined Approach for Environmental Restoration (SAFER) Plan for Corrective Action Unit 553: Areas 19, 20 Mud Pits and Cellars, Nevada Test Site, Nevada, Rev. No. 0

International Nuclear Information System (INIS)

Boehlecke, Robert F.

2006-01-01

This Streamlined Approach for Environmental Restoration (SAFER) Plan addresses the actions necessary for the closure of Corrective Action Unit (CAU) 553: Areas 19, 20 Mud Pits and Cellars, Nevada Test Site (NTS), Nevada. It has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. A SAFER may be performed when the following criteria are met: (1) Conceptual corrective actions are clearly identified (although some degree of investigation may be necessary to select a specific corrective action before completion of the Corrective Action Investigation [CAI]); (2) Uncertainty of the nature, extent, and corrective action must be limited to an acceptable level of risk; (3) The SAFER Plan includes decision points and criteria for making data quality objective (DQO) decisions. The purpose of the investigation will be to document and verify the adequacy of existing information; to affirm the decision for clean closure, closure in place, or no further action; and to provide sufficient data to implement the corrective action. The actual corrective action selected will be based on characterization activities implemented under this SAFER Plan. This SAFER Plan identifies decision points developed in cooperation with the Nevada Department of Environmental Protection (NDEP), where the DOE, National Nuclear Security Administration Nevada Site Office (NNSA/NSO) will reach consensus with the NDEP before beginning the next phase of work. Corrective Action Unit 553 is located in Areas 19 and 20 of the NTS, approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 553 is comprised of the four Corrective Action Sites (CASs) shown on Figure 1-1 and listed below: 19-99-01, Mud Spill; 19-99-11, Mud Spill; 20-09-09, Mud Spill; and 20-99-03, Mud Spill. There is sufficient information and process

238 U, 232 Th and 40 K in wheat flour samples of Iraq markets

Directory of Open Access Journals (Sweden)

Ali Abid Abojassim

2015-05-01

Full Text Available Introduction. Wheat flour is a nutritious type of food that is widely consumed by various age groups in Iraq. This study investigates the presence of long-lived gamma emitters in different type of wheat flour in Iraqi market. Materials and methods. Uranium (238 U, Thorium (232 Th and Potassium (40 K specific activity in (Bq/kg were measured in (12 different types of wheat flours that are available in Iraqi markets. The gamma spectrometry method with a NaI(Tl detector has been used for radiometric measurements. Also in this study we have calculated the internal hazard index, radium equivalent and absorbed dose rate in all samples. Results and discussion. It is found that the specific activity in wheat flour samples were varied from (1.086±0.0866 Bq/kg to (12.532±2.026 Bq/kg with an average (6.6025 Bq/kg for 238 U, For 232 Th From (0.126±0.066 Bq/kg to (4.298±0.388 Bq/kg with an average (1.9465Bq/kg and for 40 K from (41.842±5.875 Bq/kg to (264.729±3.843 Bq/kg with an average (133.097 Bq/kg. Also, it is found that the radium equivalent and the internal hazard index in wheat flour samples ranged from (3.4031 Bq/kg to (35.1523 Bq/kg with an average (19.6346 Bq/kg and from (0.0091 to (0.1219 with an average (0.0708 respectively. Conclusion. This study prove that the natural radioactivity and radiation hazard indices were lower than the safe.

75 FR 11559 - Certain Combed Cotton Yarns: Effect of Modification of U.S.-Bahrain FTA Rules of Origin

Science.gov (United States)

2010-03-11

... INTERNATIONAL TRADE COMMISSION [Investigation No. Bahrain-FTA-103-025] Certain Combed Cotton Yarns: Effect of Modification of U.S.- Bahrain FTA Rules of Origin AGENCY: United States International Trade... to section 104 of the United States-Bahrain Free Trade Agreement (FTA) Implementation Act (19 U.S.C...

File list: InP.Kid.10.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available InP.Kid.10.AllAg.Nephrectomy_sample hg19 Input control Kidney Nephrectomy sample SR...90,SRX1037589,SRX1037588,SRX1037582 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Kid.10.AllAg.Nephrectomy_sample.bed ...

File list: InP.Kid.50.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available InP.Kid.50.AllAg.Nephrectomy_sample hg19 Input control Kidney Nephrectomy sample SR...84,SRX1037589,SRX1037590,SRX1037583 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Kid.50.AllAg.Nephrectomy_sample.bed ...

File list: InP.Kid.05.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available InP.Kid.05.AllAg.Nephrectomy_sample hg19 Input control Kidney Nephrectomy sample SR...84,SRX1037590,SRX1037588,SRX1037589 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Kid.05.AllAg.Nephrectomy_sample.bed ...

File list: InP.Kid.20.AllAg.Nephrectomy_sample [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available InP.Kid.20.AllAg.Nephrectomy_sample hg19 Input control Kidney Nephrectomy sample SR...83,SRX1037590,SRX1037588,SRX1037582 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Kid.20.AllAg.Nephrectomy_sample.bed ...

40 CFR Table 19 to Subpart Uuu of... - Initial Compliance With Organic HAP Emission Limits for Catalytic Reforming Units

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 12 2010-07-01 2010-07-01 true Initial Compliance With Organic HAP Emission Limits for Catalytic Reforming Units 19 Table 19 to Subpart UUU of Part 63 Protection of... HAP Emission Limits for Catalytic Reforming Units As stated in § 63.1566(b)(7), you shall meet each...

Sampling design and procedures for fixed surface-water sites in the Georgia-Florida coastal plain study unit, 1993

Science.gov (United States)

Hatzell, H.H.; Oaksford, E.T.; Asbury, C.E.

1995-01-01

The implementation of design guidelines for the National Water-Quality Assessment (NAWQA) Program has resulted in the development of new sampling procedures and the modification of existing procedures commonly used in the Water Resources Division of the U.S. Geological Survey. The Georgia-Florida Coastal Plain (GAFL) study unit began the intensive data collection phase of the program in October 1992. This report documents the implementation of the NAWQA guidelines by describing the sampling design and procedures for collecting surface-water samples in the GAFL study unit in 1993. This documentation is provided for agencies that use water-quality data and for future study units that will be entering the intensive phase of data collection. The sampling design is intended to account for large- and small-scale spatial variations, and temporal variations in water quality for the study area. Nine fixed sites were selected in drainage basins of different sizes and different land-use characteristics located in different land-resource provinces. Each of the nine fixed sites was sampled regularly for a combination of six constituent groups composed of physical and chemical constituents: field measurements, major ions and metals, nutrients, organic carbon, pesticides, and suspended sediments. Some sites were also sampled during high-flow conditions and storm events. Discussion of the sampling procedure is divided into three phases: sample collection, sample splitting, and sample processing. A cone splitter was used to split water samples for the analysis of the sampling constituent groups except organic carbon from approximately nine liters of stream water collected at four fixed sites that were sampled intensively. An example of the sample splitting schemes designed to provide the sample volumes required for each sample constituent group is described in detail. Information about onsite sample processing has been organized into a flowchart that describes a pathway for each of

Comparing simulated and theoretical sampling distributions of the U3 person-fit statistic

NARCIS (Netherlands)

Emons, W.H.M.; Meijer, R.R.; Sijtsma, K.

2002-01-01

The accuracy with which the theoretical sampling distribution of van der Flier's person-.t statistic U3 approaches the empirical U3 sampling distribution is affected by the item discrimination. A simulation study showed that for tests with a moderate or a strong mean item discrimination, the Type I

Artificial sweetener sucralose in U.S. drinking water systems.

Science.gov (United States)

Mawhinney, Douglas B; Young, Robert B; Vanderford, Brett J; Borch, Thomas; Snyder, Shane A

2011-10-15

The artificial sweetener sucralose has recently been shown to be a widespread of contaminant of wastewater, surface water, and groundwater. In order to understand its occurrence in drinking water systems, water samples from 19 United States (U.S.) drinking water treatment plants (DWTPs) serving more than 28 million people were analyzed for sucralose using liquid chromatography tandem mass spectrometry (LC-MS/MS). Sucralose was found to be present in source water of 15 out of 19 DWTPs (47-2900 ng/L), finished water of 13 out of 17 DWTPs (49-2400 ng/L) and distribution system water of 8 out of the 12 DWTPs (48-2400 ng/L) tested. Sucralose was only found to be present in source waters with known wastewater influence and/or recreational usage, and displayed low removal (12% average) in the DWTPs where finished water was sampled. Further, in the subset of DWTPs with distribution system water sampled, the compound was found to persist regardless of the presence of residual chlorine or chloramines. In order to understand intra-DWTP consistency, sucralose was monitored at one drinking water treatment plant over an 11 month period from March 2010 through January 2011, and averaged 440 ng/L in the source water and 350 ng/L in the finished water. The results of this study confirm that sucralose will function well as an indicator compound for anthropogenic influence on source, finished drinking and distribution system (i.e., tap) water, as well as an indicator compound for the presence of other recalcitrant compounds in finished drinking water in the U.S.

Assay of Uranium Isotopic Ratios 234U/238U, 235U/238U in Bottom Sediment Samples Using Destructive and Non Destructive Techniques (Nasser Lake)

International Nuclear Information System (INIS)

Agha, A.R.; El-Mongy, S.A.; Kandel, A.E.

2011-01-01

Nasser Lake is the greatest man-made lake in the World. It is considered as the main source of water where the Nile water is impounded behind the Aswan high dam.. Uranium has three naturally occurring isotopes 234 U, 235 U and 238 U with isotopic abundance 0.00548, 0.7200 and 99.2745 atom percent. Dissolved uranium in the lake is primary due to weathering process. Monitoring of the isotopic ratios of uranium is used as a good indicator to trace and evaluate the origin and activities associated with any variation of uranium in the lake environment. The main objective of the present study is to clarify any potential variation of natural uranium 234 U/ 238 U, 235 U/ 238 U ratios in sediment samples of Nasser Lake by using destructive alpha and non destructive gamma- techniques. The results show that the uranium isotopic activity ratios are very close to the natural values. This study can also be used for radiological protection and safety evaluation purposes.

Comparing simulated and theoretical sampling distributions of the U3 person-fit statistic

NARCIS (Netherlands)

Emons, Wilco H.M.; Meijer, R.R.; Sijtsma, Klaas

2002-01-01

The accuracy with which the theoretical sampling distribution of van der Flier’s person-fit statistic U3 approaches the empirical U3 sampling distribution is affected by the item discrimination. A simulation study showed that for tests with a moderate or a strong mean item discrimination, the Type I

Comparing Simulated and Theoretical Sampling Distributions of the U3 Person-Fit Statistic.

Science.gov (United States)

Emons, Wilco H. M.; Meijer, Rob R.; Sijtsma, Klaas

2002-01-01

Studied whether the theoretical sampling distribution of the U3 person-fit statistic is in agreement with the simulated sampling distribution under different item response theory models and varying item and test characteristics. Simulation results suggest that the use of standard normal deviates for the standardized version of the U3 statistic may…

Use of alpha spectrometry for analysis of U-isotopes in some granite samples

International Nuclear Information System (INIS)

El-Galy, M.M.; Desouky, O.A.; Khattab, M.R.; Issa, F.A.

2011-01-01

The present study aims to use the α-spectrometry, at NMA. A radiochemical technique for analysis of U-isotopes was carried out for some granite samples from Gabal Gattar and El Missikat localities and also for some reference soil samples of IAEA. Several steps of sample preparation, radiochemical separation, and source preparation were performed before analysis. The concerned sample was leached by HNO 3 , HF and H 2 O 2 acids after ashing. The ashed sample was spiked with uranium tracer ( 232 U) for chemical yield and activity calculation. Then uranium was extracted from the matrix elements with trioctylphosphine oxide (TOPO) and stripped with 1 M NH 4 F/0.1 M HCl solution. The uranium fraction was purified by co-precipitation with LaF 3 to ensure complete removal of thorium and traces of resolution degrading elements. This was followed by a final clean-up step using an anion exchange. The pure uranium fraction was electrodeposited on a stainless steel disc from HCl/oxalate solution. The obtained results from the soil reference samples indicate general similarities between the techniques of α-spectrometers of NMA, EAEA and IAEA for analysis of U-isotopes. The U-isotopes in the granite samples of high radioactivity levels need more attempts after dilution process to be in the limit detection of α-spectrometry. (author)

Closure Plan for Corrective Action Unit 109: U-2bu Subsidence Crater Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

Shannon Parsons

1999-03-01

The U-2bu subsidence crater, Corrective Action Unit 109, will be closed in accordance with the Resource Conservation and Recovery Act, the Nevada Division of Environmental Protection operational permit, and the Federal Facilities Agreement and Consent Order. The U-2bu subsidence crater is located in Area 2 of the Nevada Test Site. It was created in 1971 by an underground nuclear test with the name Miniata. The crater has a diameter of 288 meters (944 feet) and an approximate depth of 35 meters (115 feet). The subsidence crater was used as a land disposal unit for radioactive and hazardous waste from 1973 to 1988. Site disposal history is supported by memorandums, letters, and personnel who worked at the Nevada Test Site at the time of active disposal. Closure activities will include the excavation and disposal of impacted soil form the tip of the crater. Upon completion of excavation, verification samples will be collected to show that lead has been removed to concentrations be low regulatory action level. The area will then be backfilled and a soil flood diversion berm will be constructed, and certified by an independent professional engineer as to having followed the approved Closure Plan.

77 FR 70874 - Notification of the Next Meetings of the U.S.-Chile FTA Environmental Affairs Council and ECA...

Science.gov (United States)

2012-11-27

... DEPARTMENT OF STATE [Public Notice: 8095] Notification of the Next Meetings of the U.S.-Chile FTA... Commission pursuant to Chapter 19 (Environment) of the United States-Chile Free Trade Agreement (``FTA'') and...: Article 19.3 of the United States-Chile FTA establishes an Environment Affairs Council, which shall meet...

19 CFR 151.54 - Testing by Customs laboratory.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Testing by Customs laboratory. 151.54 Section 151.54 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Other Metal-Bearing Materials § 151.54 Testing by Customs laboratory. Samples taken in accordance with...

Teen Birth Rates for Age Group 15-19 in the United States by County

Data.gov (United States)

U.S. Department of Health & Human Services — This data set contains mean teen birth rates by year for each county and state in the United States. Hierarchical Bayesian space-time models were used to generate...

Physical and physiological demands of U-19 basketball refereeing: Aerobic and anaerobic demands.

Science.gov (United States)

Nabli, Mohamed Ali; Ben Abdelkrim, Nidhal; Castagna, Carlo; Jabri, Imed; Batikh, Tahar; Chamari, Karim

2016-01-01

This study aimed to examine the physical and physiological demands of basketball refereeing. 16 elite-level basketball referees were studied during U-19 basketball games (n=8) for time-motion analyses, exercise heart rates (HR) and blood lactate concentration [La]. Game activities were considered as time spent and distance covered in five locomotors activities (standing, walking, jogging, running and sprinting). Referees spent more time (pbasketball refereeing is a moderate intensity activity where referees spent 81% of total game time at low-intensity with bouts of high-intensity activities throughout the game.

Groundwater-quality data in 12 GAMA study units: Results from the 2006–10 initial sampling period and the 2008–13 trend sampling period, California GAMA Priority Basin Project

Science.gov (United States)

Mathany, Timothy M.

2017-03-09

The Priority Basin Project (PBP) of the Groundwater Ambient Monitoring and Assessment (GAMA) program was developed in response to the Groundwater Quality Monitoring Act of 2001 and is being conducted by the U.S. Geological Survey in cooperation with the California State Water Resources Control Board. From 2004 through 2012, the GAMA-PBP collected samples and assessed the quality of groundwater resources that supply public drinking water in 35 study units across the State. Selected sites in each study unit were sampled again approximately 3 years after initial sampling as part of an assessment of temporal trends in water quality by the GAMA-PBP. Twelve of the study units, initially sampled during 2006–11 (initial sampling period) and sampled a second time during 2008–13 (trend sampling period) to assess temporal trends, are the subject of this report.The initial sampling was designed to provide a spatially unbiased assessment of the quality of untreated groundwater used for public water supplies in the 12 study units. In these study units, 550 sampling sites were selected by using a spatially distributed, randomized, grid-based method to provide spatially unbiased representation of the areas assessed (grid sites, also called “status sites”). After the initial sampling period, 76 of the previously sampled status sites (approximately 10 percent in each study unit) were randomly selected for trend sampling (“trend sites”). The 12 study units sampled both during the initial sampling and during the trend sampling period were distributed among 6 hydrogeologic provinces: Coastal (Northern and Southern), Transverse Ranges and Selected Peninsular Ranges, Klamath, Modoc Plateau and Cascades, and Sierra Nevada Hydrogeologic Provinces. For the purposes of this trend report, the six hydrogeologic provinces were grouped into two hydrogeologic regions based on location: Coastal and Mountain.The groundwater samples were analyzed for a number of synthetic organic

National and state vaccination coverage among children aged 19-35 months--United States, 2010.

Science.gov (United States)

2011-09-02

The National Immunization Survey (NIS) monitors vaccination coverage among children aged 19-35 months using a random-digit-dialed sample of telephone numbers of households to evaluate childhood immunization programs in the United States. This report describes the 2010 NIS coverage estimates for children born during January 2007-July 2009. Nationally, vaccination coverage increased in 2010 compared with 2009 for ≥ 1 dose of measles, mumps, and rubella vaccine (MMR), from 90.0% to 91.5%; ≥ 4 doses of pneumococcal conjugate vaccine (PCV), from 80.4% to 83.3%; the birth dose of hepatitis B vaccine (HepB), from 60.8% to 64.1%; ≥ 2 doses of hepatitis A vaccine (HepA), from 46.6% to 49.7%; rotavirus vaccine, from 43.9% to 59.2%; and the full series of Haemophilus influenzae type b (Hib) vaccine, from 54.8% to 66.8%. Coverage for poliovirus vaccine (93.3%), MMR (91.5%), ≥ 3 doses HepB (91.8%), and varicella vaccine (90.4%) continued to be at or above the national health objective targets of 90% for these vaccines.* The percentage of children who had not received any vaccinations remained low (poverty status still exist. Maintaining high vaccination coverage levels is important to reduce the burden of vaccine-preventable diseases and prevent a resurgence of these diseases in the United States, particularly in undervaccinated populations.

Groundwater quality data in 15 GAMA study units: results from the 2006–10 Initial sampling and the 2009–13 resampling of wells, California GAMA Priority Basin Project

Science.gov (United States)

Kent, Robert

2015-08-31

The Priority Basin Project (PBP) of the Groundwater Ambient Monitoring and Assessment (GAMA) program was developed in response to the Groundwater Quality Monitoring Act of 2001 and is being conducted by the U.S. Geological Survey (USGS) in cooperation with the California State Water Resources Control Board (SWRCB). From May 2004 to March 2012, the GAMA-PBP collected samples from more than 2,300 wells in 35 study units across the State. Selected wells in each study unit were sampled again approximately 3 years after initial sampling as part of an assessment of temporal trends in water quality by the GAMA-PBP. This triennial (every 3 years) trend sampling of GAMA-PBP study units concluded in December 2013. Fifteen of the study units, initially sampled between January 2006 and June 2010 and sampled a second time between April 2009 and April 2013 to assess temporal trends, are the subject of this report.

19 CFR 19.41 - Movement of containerized cargo to a container station.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Movement of containerized cargo to a container station. 19.41 Section 19.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... THEREIN Container Stations § 19.41 Movement of containerized cargo to a container station. Containerized...

Impact of a hybrid TGfU-Sport Education unit on student motivation in physical education.

Science.gov (United States)

Gil-Arias, Alexander; Harvey, Stephen; Cárceles, Adrián; Práxedes, Alba; Del Villar, Fernando

2017-01-01

The Teaching Games for Understanding (TGfU) and Sport Education (SE) pedagogical models share several objectives and pedagogical processes. Despite this seemingly uncanny relationship, few studies have examined the efficacy of a hybrid TGfU/SE pedagogical model, particularly how a teacher's utilization of such a model impacts on student motivation. The purpose of the current study was to investigate the effect a hybrid TGfU/SE unit, in comparison to direct instruction, on students' perceptions of various aspects of their motivation to engage in physical education (autonomous motivation, basic psychological needs, enjoyment and intention to be physically active). A crossover design was utilized, using the technique of counterbalancing. One group experienced a hybrid SE/TGfU unit first, followed by a unit of direct instruction. A second group experienced the units in the opposite order. Participants were 55 students. The intervention was conducted over a total of 16 lessons. The hybrid unit was designed according to the characteristics of SE by using seasons, roles, persistent teams, etc. Learning tasks set by the teacher during individual lessons, however, were designed according to the pedagogical principles of TGfU. Student motivation data was generated using validated questionnaires. Results showed that regardless of the order of intervention, the two groups showed significant improvements in autonomy, competence and enjoyment when they were taught using the hybrid model. Instead, in the variables autonomous motivation, relatedness and intention to be physically active there were no significant improvements in one group. These results demonstrate that it is possible to design varied learning situations in which affiliation, leadership and trust are fostered, while tasks are adapted to the characteristics of the students. All this can cause greater autonomous motivation, and consequently, perceived competence in the student, a positive image of the sport to

Impact of a hybrid TGfU-Sport Education unit on student motivation in physical education.

Directory of Open Access Journals (Sweden)

Alexander Gil-Arias

Full Text Available The Teaching Games for Understanding (TGfU and Sport Education (SE pedagogical models share several objectives and pedagogical processes. Despite this seemingly uncanny relationship, few studies have examined the efficacy of a hybrid TGfU/SE pedagogical model, particularly how a teacher's utilization of such a model impacts on student motivation. The purpose of the current study was to investigate the effect a hybrid TGfU/SE unit, in comparison to direct instruction, on students' perceptions of various aspects of their motivation to engage in physical education (autonomous motivation, basic psychological needs, enjoyment and intention to be physically active. A crossover design was utilized, using the technique of counterbalancing. One group experienced a hybrid SE/TGfU unit first, followed by a unit of direct instruction. A second group experienced the units in the opposite order. Participants were 55 students. The intervention was conducted over a total of 16 lessons. The hybrid unit was designed according to the characteristics of SE by using seasons, roles, persistent teams, etc. Learning tasks set by the teacher during individual lessons, however, were designed according to the pedagogical principles of TGfU. Student motivation data was generated using validated questionnaires. Results showed that regardless of the order of intervention, the two groups showed significant improvements in autonomy, competence and enjoyment when they were taught using the hybrid model. Instead, in the variables autonomous motivation, relatedness and intention to be physically active there were no significant improvements in one group. These results demonstrate that it is possible to design varied learning situations in which affiliation, leadership and trust are fostered, while tasks are adapted to the characteristics of the students. All this can cause greater autonomous motivation, and consequently, perceived competence in the student, a positive image of

Impact of a hybrid TGfU-Sport Education unit on student motivation in physical education

Science.gov (United States)

Gil-Arias, Alexander; Harvey, Stephen; Cárceles, Adrián; Práxedes, Alba; Del Villar, Fernando

2017-01-01

The Teaching Games for Understanding (TGfU) and Sport Education (SE) pedagogical models share several objectives and pedagogical processes. Despite this seemingly uncanny relationship, few studies have examined the efficacy of a hybrid TGfU/SE pedagogical model, particularly how a teacher’s utilization of such a model impacts on student motivation. The purpose of the current study was to investigate the effect a hybrid TGfU/SE unit, in comparison to direct instruction, on students’ perceptions of various aspects of their motivation to engage in physical education (autonomous motivation, basic psychological needs, enjoyment and intention to be physically active). A crossover design was utilized, using the technique of counterbalancing. One group experienced a hybrid SE/TGfU unit first, followed by a unit of direct instruction. A second group experienced the units in the opposite order. Participants were 55 students. The intervention was conducted over a total of 16 lessons. The hybrid unit was designed according to the characteristics of SE by using seasons, roles, persistent teams, etc. Learning tasks set by the teacher during individual lessons, however, were designed according to the pedagogical principles of TGfU. Student motivation data was generated using validated questionnaires. Results showed that regardless of the order of intervention, the two groups showed significant improvements in autonomy, competence and enjoyment when they were taught using the hybrid model. Instead, in the variables autonomous motivation, relatedness and intention to be physically active there were no significant improvements in one group. These results demonstrate that it is possible to design varied learning situations in which affiliation, leadership and trust are fostered, while tasks are adapted to the characteristics of the students. All this can cause greater autonomous motivation, and consequently, perceived competence in the student, a positive image of the sport to

Closure plan for Corrective Action Unit 109: U-2bu subsidence crater, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

1999-03-01

The U-2bu subsidence crater, Corrective Action Unit 109, will be closed in accordance with the Resource Conservation and Recovery Act, the Nevada Division of Environmental Protection operational permit, and the Federal Facility Agreement and Consent Order. The U-2bu subsidence crater is located in Area 2 of the Nevada Test Site. It was created in 1971 by an underground nuclear test with the name Miniata. The crater has a diameter of 288 meters (944 feet) and an approximate depth of 35 meters (115 feet). Based on the results of the analyses reported in the site characterization report, the only constituents of concern in the U-2bu subsidence crater include leachable lead and total petroleum hydrocarbons. Closure activities will include the excavation and disposal of impacted soil from the top of the crater. Upon completion of excavation, verification samples will be collected to show that the leachable lead has been removed to concentrations below the regulatory action level. After sample results show that the lead has been removed, the excavated area will be backfilled and a soil flood diversion berm will be constructed as a best management practice. An independent registered professional engineer will certify the site was closed following the approved Closure Plan. Post-closure care is not warranted for this site because closure activities will involve removal of the Resource Conservation and Recovery Act constituents of concern

Closure plan for Corrective Action Unit 109: U-2bu subsidence crater, Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-03-01

The U-2bu subsidence crater, Corrective Action Unit 109, will be closed in accordance with the Resource Conservation and Recovery Act, the Nevada Division of Environmental Protection operational permit, and the Federal Facility Agreement and Consent Order. The U-2bu subsidence crater is located in Area 2 of the Nevada Test Site. It was created in 1971 by an underground nuclear test with the name Miniata. The crater has a diameter of 288 meters (944 feet) and an approximate depth of 35 meters (115 feet). Based on the results of the analyses reported in the site characterization report, the only constituents of concern in the U-2bu subsidence crater include leachable lead and total petroleum hydrocarbons. Closure activities will include the excavation and disposal of impacted soil from the top of the crater. Upon completion of excavation, verification samples will be collected to show that the leachable lead has been removed to concentrations below the regulatory action level. After sample results show that the lead has been removed, the excavated area will be backfilled and a soil flood diversion berm will be constructed as a best management practice. An independent registered professional engineer will certify the site was closed following the approved Closure Plan. Post-closure care is not warranted for this site because closure activities will involve removal of the Resource Conservation and Recovery Act constituents of concern.

Preliminary peak stage and streamflow data at selected U.S. Geological Survey streamgages for flooding in the central and southeastern United States during December 2015 and January 2016

Science.gov (United States)

Holmes, Robert R.; Watson, Kara M.; Harris, Thomas E.

2016-06-16

Flooding occurred in the central and southeastern United States during December 2015 and January 2016. The flooding was the result of more than 20 inches of rain falling in a 19 day period from December 12 to December 31, 2015. U.S. Geological Survey streamgages recorded 23 peaks of record during the subsequent flooding, with a total of 172 streamgages recording peaks that ranked in the top 5 all time for the period of record.

Closure Report for Corrective Action Unit 537: Waste Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

NSTec Environmental Restoration

2007-01-01

Corrective Action Unit (CAU) 537 is identified in the ''Federal Facility Agreement and Consent Order'' (FFACO) of 1996 as Waste Sites. CAU 537 is located in Areas 3 and 19 of the Nevada Test Site, approximately 65 miles northwest of Las Vegas, Nevada, and consists of the following two Corrective Action Sites (CASs): CAS 03-23-06, Bucket; Yellow Tagged Bags; and CAS 19-19-01, Trash Pit. CAU 537 closure activities were conducted in April 2007 according to the FFACO and Revision 3 of the Sectored Clean-up Work Plan for Housekeeping Category Waste Sites (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2003). At CAS 03-23-06, closure activities included removal and disposal of a 15-foot (ft) by 15-ft by 8-ft tall wooden shed containing wood and metal debris and a 5-gallon plastic bucket containing deteriorated plastic bags with yellow radioactive contamination tape. The debris was transported to the Area 9 U10c Landfill for disposal after being screened for radiological contamination according to the ''NV/YMP Radiological Control Manual'' (NNSA/NSO, 2004). At CAS 19-19-01, closure activities included segregation, removal, and disposal of non-friable, non-regulated asbestos-containing material (ACM) and construction debris. The ACM was determined to be non-friable by waste characterization samples collected prior to closure activities. The ACM was removed and double-bagged by licensed, trained asbestos workers and transported to the Area 9 U10c Landfill for disposal. Construction debris was transported in end-dump trucks to the Area 9 U10c Landfill for disposal. Closure activities generated sanitary waste/construction debris and ACM. Waste generated during closure activities was appropriately managed and disposed. Waste characterization sample results are included as Appendix A of this report, and waste disposition documentation is included as Appendix B of this report. Copies of the Sectored Housekeeping Site Closure

Analysis of Product Sampling for New Product Diffusion Incorporating Multiple-Unit Ownership

Directory of Open Access Journals (Sweden)

Zhineng Hu

2014-01-01

Full Text Available Multiple-unit ownership of nondurable products is an important component of sales in many product categories. Based on the Bass model, this paper develops a new model considering the multiple-unit adoptions as a diffusion process under the influence of product sampling. Though the analysis aims to determine the optimal dynamic sampling effort for a firm and the results demonstrate that experience sampling can accelerate the diffusion process, the best time to send free samples is just before the product being launched. Multiple-unit purchasing behavior can increase sales to make more profit for a firm, and it needs more samples to make the product known much better. The local sensitivity analysis shows that the increase of both external coefficients and internal coefficients has a negative influence on the sampling level, but the internal influence on the subsequent multiple-unit adoptions has little significant influence on the sampling. Using the logistic regression along with linear regression, the global sensitivity analysis gives a whole analysis of the interaction of all factors, which manifests the external influence and multiunit purchase rate are two most important factors to influence the sampling level and net present value of the new product, and presents a two-stage method to determine the sampling level.

Quantification of Parvovirus B19 DNA Using COBAS AmpliPrep Automated Sample Preparation and LightCycler Real-Time PCR

Science.gov (United States)

Schorling, Stefan; Schalasta, Gunnar; Enders, Gisela; Zauke, Michael

2004-01-01

The COBAS AmpliPrep instrument (Roche Diagnostics GmbH, D-68305 Mannheim, Germany) automates the entire sample preparation process of nucleic acid isolation from serum or plasma for polymerase chain reaction analysis. We report the analytical performance of the LightCycler Parvovirus B19 Quantification Kit (Roche Diagnostics) using nucleic acids isolated with the COBAS AmpliPrep instrument. Nucleic acids were extracted using the Total Nucleic Acid Isolation Kit (Roche Diagnostics) and amplified with the LightCycler Parvovirus B19 Quantification Kit. The kit combination processes 72 samples per 8-hour shift. The lower detection limit is 234 IU/ml at a 95% hit-rate, linear range approximately 104-1010 IU/ml, and overall precision 16 to 40%. Relative sensitivity and specificity in routine samples from pregnant women are 100% and 93%, respectively. Identification of a persistent parvovirus B19-infected individual by the polymerase chain reaction among 51 anti-parvovirus B19 IgM-negative samples underlines the importance of additional nucleic acid testing in pregnancy and its superiority to serology in identifying the risk of parvovirus B19 transmission via blood or blood products. Combination of the Total Nucleic Acid Isolation Kit on the COBAS AmpliPrep instrument with the LightCycler Parvovirus B19 Quantification Kit provides a reliable and time-saving tool for sensitive and accurate detection of parvovirus B19 DNA. PMID:14736825

Soil Sampling to Demonstrate Compliance with Department of Energy Radiological Clearance Requirements for the ALE Unit of the Hanford Reach National Monument

Energy Technology Data Exchange (ETDEWEB)

Fritz, Brad G.; Dirkes, Roger L.; Napier, Bruce A.

2007-04-01

The Hanford Reach National Monument consists of several units, one of which is the Fitzner/Eberhardt Arid Lands Ecology Reserve (ALE) Unit. This unit is approximately 311 km2 of shrub-steppe habitat located to the south and west of Highway 240. To fulfill internal U. S. Department of Energy (DOE) requirements prior to any radiological clearance of land, DOE must evaluate the potential for residual radioactive contamination on this land and determine compliance with the requirements of DOE Order 5400.5. Historical soil monitoring conducted on ALE indicated soil concentrations of radionuclides were well below the Authorized Limits. However, the historical sampling was done at a limited number of sampling locations. Therefore, additional soil sampling was conducted to determine if the concentrations of radionuclides in soil on the ALE Unit were below the Authorized Limits. This report contains the results of 50 additional soil samples. The 50 soil samples collected from the ALE Unit all had concentrations of radionuclides far below the Authorized Limits. The average concentrations for all detectable radionuclides were less than the estimated Hanford Site background. Furthermore, the maximum observed soil concentrations for the radionuclides included in the Authorized Limits would result in a potential annual dose of 0.14 mrem assuming the most probable use scenario, a recreational visitor. This potential dose is well below the DOE 100-mrem per year dose limit for a member of the public. Spatial analysis of the results indicated no observable statistically significant differences between radionuclide concentrations across the ALE Unit. Furthermore, the results of the biota dose assessment screen, which used the ResRad Biota code, indicated that the concentrations of radionuclides in ALE Unit soil pose no significant health risk to biota.

The U.S. Geological Survey Geologic Collections Management System (GCMS)—A master catalog and collections management plan for U.S. Geological Survey geologic samples and sample collections

Science.gov (United States)

,

2015-01-01

The U.S. Geological Survey (USGS) is widely recognized in the earth science community as possessing extensive collections of earth materials collected by research personnel over the course of its history. In 2006, a Geologic Collections Inventory was conducted within the USGS Geology Discipline to determine the extent and nature of its sample collections, and in 2008, a working group was convened by the USGS National Geologic and Geophysical Data Preservation Program to examine ways in which these collections could be coordinated, cataloged, and made available to researchers both inside and outside the USGS. The charge to this working group was to evaluate the proposition of creating a Geologic Collections Management System (GCMS), a centralized database that would (1) identify all existing USGS geologic collections, regardless of size, (2) create a virtual link among the collections, and (3) provide a way for scientists and other researchers to obtain access to the samples and data in which they are interested. Additionally, the group was instructed to develop criteria for evaluating current collections and to establish an operating plan and set of standard practices for handling, identifying, and managing future sample collections. Policies and procedures promoted by the GCMS would be based on extant best practices established by the National Science Foundation and the Smithsonian Institution. The resulting report—USGS Circular 1410, “The U.S. Geological Survey Geologic Collections Management System (GCMS): A Master Catalog and Collections Management Plan for U.S. Geological Survey Geologic Samples and Sample Collections”—has been developed for sample repositories to be a guide to establishing common practices in the collection, retention, and disposal of geologic research materials throughout the USGS.

Attitudes toward Bisexual Men and Women among a Nationally Representative Probability Sample of Adults in the United States.

Science.gov (United States)

Dodge, Brian; Herbenick, Debby; Friedman, M Reuel; Schick, Vanessa; Fu, Tsung-Chieh Jane; Bostwick, Wendy; Bartelt, Elizabeth; Muñoz-Laboy, Miguel; Pletta, David; Reece, Michael; Sandfort, Theo G M

2016-01-01

As bisexual individuals in the United States (U.S.) face significant health disparities, researchers have posited that these differences may be fueled, at least in part, by negative attitudes, prejudice, stigma, and discrimination toward bisexual individuals from heterosexual and gay/lesbian individuals. Previous studies of individual and social attitudes toward bisexual men and women have been conducted almost exclusively with convenience samples, with limited generalizability to the broader U.S. Our study provides an assessment of attitudes toward bisexual men and women among a nationally representative probability sample of heterosexual, gay, lesbian, and other-identified adults in the U.S. Data were collected from the 2015 National Survey of Sexual Health and Behavior (NSSHB), via an online questionnaire with a probability sample of adults (18 years and over) from throughout the U.S. We included two modified 5-item versions of the Bisexualities: Indiana Attitudes Scale (BIAS), validated sub-scales that were developed to measure attitudes toward bisexual men and women. Data were analyzed using descriptive statistics, gamma regression, and paired t-tests. Gender, sexual identity, age, race/ethnicity, income, and educational attainment were all significantly associated with participants' attitudes toward bisexual individuals. In terms of responses to individual scale items, participants were most likely to "neither agree nor disagree" with all attitudinal statements. Across sexual identities, self-identified other participants reported the most positive attitudes, while heterosexual male participants reported the least positive attitudes. As in previous research on convenience samples, we found a wide range of demographic characteristics were related with attitudes toward bisexual individuals in our nationally-representative study of heterosexual, gay/lesbian, and other-identified adults in the U.S. In particular, gender emerged as a significant characteristic

Tank 241-U-106 vapor sampling and analysis tank characterization report

International Nuclear Information System (INIS)

Huckaby, J.L.

1995-01-01

This report presents the details of the Hanford waste tank characterization study for tank 241-U-106. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedures that were presented in other reports. The vapor and headspace gas samples were collected to determine the potential risks to tank farm workers due to fugitive emissions from the tank

Making United States Integrated Ocean Observing System (U.S. IOOS) inclusive of marine biological resources

Science.gov (United States)

Moustahfid, H.; Potemra, J.; Goldstein, P.; Mendelssohn, R.; Desrochers, A.

2011-01-01

An important Data Management and Communication (DMAC) goal is to enable a multi-disciplinary view of the ocean environment by facilitating discovery and integration of data from various sources, projects and scientific domains. United States Integrated Ocean Observing System (U.S. IOOS) DMAC functional requirements are based upon guidelines for standardized data access services, data formats, metadata, controlled vocabularies, and other conventions. So far, the data integration effort has focused on geophysical U.S. IOOS core variables such as temperature, salinity, ocean currents, etc. The IOOS Biological Observations Project is addressing the DMAC requirements that pertain to biological observations standards and interoperability applicable to U.S. IOOS and to various observing systems. Biological observations are highly heterogeneous and the variety of formats, logical structures, and sampling methods create significant challenges. Here we describe an informatics framework for biological observing data (e.g. species presence/absence and abundance data) that will expand information content and reconcile standards for the representation and integration of these biological observations for users to maximize the value of these observing data. We further propose that the approach described can be applied to other datasets generated in scientific observing surveys and will provide a vehicle for wider dissemination of biological observing data. We propose to employ data definition conventions that are well understood in U.S. IOOS and to combine these with ratified terminologies, policies and guidelines. ?? 2011 MTS.

Iran: Politics, Gulf Security, and U.S. Policy

Science.gov (United States)

2016-03-30

U.S. Policy Congressional Research Service Contents Political History ...Research Service 1 Political History Iran is a country of nearly 80 million people, located in the heart of the Persian Gulf region. The United...Iran government figure was 27), including a 19-year-old woman , Neda Soltani, who subsequently became an emblem of the uprising. The opposition

Radioisotope dilution analyses of geological samples using 236U and 229Th

International Nuclear Information System (INIS)

Rosholt, J.N.

1984-01-01

The use of 236 U and 229 Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: 1) these isotopes do not occur in terrestrial rocks, 2) they have negligible decay losses because of their long half lives, 3) they cause minimal recoil contamination to surface-barrier detectors, 4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and 5) they allow for simple and constant corrections for spectral interferences, 0.5% of the 238 U activity is subtracted for the contribution of 235 U in the 236 U peak and 1% of the 229 Th activity is subtracted from the 230 Th activity. Disadvantages in using 236 U and 229 Th are: 1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, 2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and 3) separate calibrations of the 236 U and 229 Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. (orig.)

Radioisotope dilution analyses of geological samples using 236U and 229Th

Science.gov (United States)

Rosholt, J.N.

1984-01-01

The use of 236U and 229Th in alpha spectrometric measurements has some advantages over the use of other tracers and measurement techniques in isotope dilution analyses of most geological samples. The advantages are: (1) these isotopes do not occur in terrestrial rocks, (2) they have negligible decay losses because of their long half lives, (3) they cause minimal recoil contamination to surface-barrier detectors, (4) they allow for simultaneous determination of the concentration and isotopic composition of uranium and thorium in a variety of sample types, and (5) they allow for simple and constant corrections for spectral inferences, 0.5% of the 238U activity is subtracted for the contribution of 235U in the 236U peak and 1% of the 229Th activity is subtracted from the 230Th activity. Disadvantages in using 236U and 229Th are: (1) individual separates of uranium and thorium must be prepared as very thin sources for alpha spectrometry, (2) good resolution in the spectrometer system is required for thorium isotopic measurements where measurement times may extend to 300 h, and (3) separate calibrations of the 236U and 229Th spike solution with both uranium and thorium standards are required. The use of these tracers in applications of uranium-series disequilibrium studies has simplified the measurements required for the determination of the isotopic composition of uranium and thorium because of the minimal corrections needed for alpha spectral interferences. ?? 1984.

Ground water contamination with (238)U, (234)U, (235)U, (226)Ra and (210)Pb from past uranium mining: cove wash, Arizona.

Science.gov (United States)

Dias da Cunha, Kenya Moore; Henderson, Helenes; Thomson, Bruce M; Hecht, Adam A

2014-06-01

The objectives of the study are to present a critical review of the (238)U, (234)U, (235)U, (226)Ra and (210)Pb levels in water samples from the EPA studies (U.S. EPA in Abandoned uranium mines and the Navajo Nation: Red Valley chapter screening assessment report. Region 9 Superfund Program, San Francisco, 2004, Abandoned uranium mines and the Navajo Nation: Northern aum region screening assessment report. Region 9 Superfund Program, San Francisco, 2006, Health and environmental impacts of uranium contamination, 5-year plan. Region 9 Superfund Program, San Franciso, 2008) and the dose assessment for the population due to ingestion of water containing (238)U and (234)U. The water quality data were taken from Sect. "Data analysis" of the published report, titled Abandoned Uranium Mines Project Arizona, New Mexico, Utah-Navajo Lands 1994-2000, Project Atlas. Total uranium concentration was above the maximum concentration level for drinking water (7.410-1 Bq/L) in 19 % of the water samples, while (238)U and (234)U concentrations were above in 14 and 17 % of the water samples, respectively. (226)Ra and (210)Pb concentrations in water samples were in the range of 3.7 × 10(-1) to 5.55 × 102 Bq/L and 1.11 to 4.33 × 102 Bq/L, respectively. For only two samples, the (226)Ra concentrations exceeded the MCL for total Ra for drinking water (0.185 Bq/L). However, the (210)Pb/(226)Ra ratios varied from 0.11 to 47.00, and ratios above 1.00 were observed in 71 % of the samples. Secular equilibrium of the natural uranium series was not observed in the data record for most of the water samples. Moreover, the (235)U/(total)U mass ratios ranged from 0.06 to 5.9 %, and the natural mass ratio of (235)U to (total)U (0.72 %) was observed in only 16 % of the water samples, ratios above or below the natural ratio could not be explained based on data reported by U.S. EPA. In addition, statistical evaluations showed no correlations among the distribution of the radionuclide concentrations

Sexual Activity, Contraceptive Use, and Childbearing of Teenagers Aged 15-19 in the United States. NCHS Data Brief. Number 209

Science.gov (United States)

Martinez, Gladys M.; Abma, Joyce C.

2015-01-01

Monitoring sexual activity and contraceptive use among U.S. adolescents is important for understanding differences in their risk of pregnancy. In 2013, the U.S. birth rate for teenagers aged 15-19 dropped 57% from its peak in 1991, paralleling a decline in the teen "pregnancy" rate. But these rates are still higher than those in other…

[U.S.-Mexico cross-border cooperation in research on diabetes mellitus type 2].

Science.gov (United States)

Canela-Soler, Jaume; Frontini, María; Cerqueira, Maria Teresa; Ruiz-Holguín, Rosalba; Díaz-Apodaca, Beatriz A

2010-09-01

To describe and analyze, utilizing a case study approach, the U.S.- Mexico Border Diabetes Prevention and Control Project, a health research cooperation initiative incorporating the participation of federal, state, and local institutions of both countries. A model of equal representation, participation, consensus, and shared leadership was used, with the participation of more than 130 institutions. A sample of 4 020 people over 18 years of age was obtained by a random, multistage, stratified, clustered design. A questionnaire about diabetes mellitus type 2 (DM2) and health was applied. The statistical analysis took into account the design effect. The prevalence of diagnosed DM2 was 14.9% (95% confidence interval [95% CI]: 12.5-17.6) and the prevalence of diagnosed DM2 adjusted by age was 19.5% (95% CI: 16.8-22.6) on the Mexican side of the border and 16.1% (IC95%: 13.5-19.2) on the U.S. border side. There were differences between the DM2 prevalence and risk factors along the border. The U.S.-Mexico Border Diabetes Prevention and Control Project allowed the border zone between the two countries to be considered, for the first time ever, as a unit for epidemiological research. A shared understanding among all participating institutions and entities of sociopolitical structures and procedures is required for effective border health cooperation initiatives.

Coexistence of Epstein-Barr virus and Parvovirus B19 in tonsillar tissue samples: quantitative measurement by real-time PCR.

Science.gov (United States)

Sahiner, Fatih; Gümral, Ramazan; Yildizoğlu, Üzeyir; Babayiğit, Mustafa Alparslan; Durmaz, Abdullah; Yiğit, Nuri; Saraçli, Mehmet Ali; Kubar, Ayhan

2014-08-01

In this study, we aimed to investigate the presence and copy number of six different viruses in tonsillar tissue samples removed surgically because of chronic recurrent tonsillitis or chronic obstructive tonsillar hypertrophy. In total, 56 tissue samples (tonsillar core) collected from 44 children and 12 adults were included in this study. The presence of viruses was investigated using a new TaqMan-based quantitative real-time PCR assay. Of the 56 tissue samples, 67.9% (38/56) were positive for at least one of the six viruses. Epstein-Barr virus was the most frequently detected virus, being found in 53.6% (30/56), followed by human Parvovirus B19 21.4% (12/56), human adenovirus 12.5% (7/56), human Cytomegalovirus 5.4% (3/56), BK polyomavirus 1.8% (1/56), and Herpes simplex virus 1.8% (1/56). Precancerous or cancerous changes were not detected in the tonsillar tissue samples by pathologic examination, whereas lymphoid hyperplasia was observed in 24 patients. In contrast to other viruses, B19 virus was present in high copy number in tonsillar tissues. The rates of EBV and B19 virus with high copy number (>500.000 copies/ml) were higher in children than in adults, and a positive relationship was also found between the presence of EBV and the presence of B19 virus with high copy number (P=0.037). It is previously reported that some viral agents are associated with different chronic tonsillar pathologies. In the present study, the presence of B19 virus in tonsillar core samples was investigated quantitatively for the first time, and our data suggests that EBV infections could be associated with B19 virus infections or could facilitate B19 virus replication. However, further detailed studies are needed to clarify this observation. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3 analytical results for the final report

International Nuclear Information System (INIS)

STEEN, F.H.

1999-01-01

This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal Year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

Physical and Temporal Characteristics of Under 19, Under 21 and Senior Male Beach Volleyball Players

Directory of Open Access Journals (Sweden)

Alexandre Medeiros, Rui Marcelino, Isabel Mesquita, José Manuel Palao

2014-09-01

Full Text Available This study aimed to assess the effects of age groups and players’ role (blocker vs. defender specialist in beach volleyball in relation to physical and temporal variables, considering quality of opposition. 1101 rallies from Under 19 (U19, 933 rallies from Under 21 (U21, and 1480 rallies from senior (senior (Men’s Swatch World Championships, 2010-2011 were observed using video match analysis. Cluster analysis was used to set teams’ competitive levels and establish quality of opposition as “balanced”, “moderate balanced” and “unbalanced” games. The analyzed variables were: temporal (duration of set, total rest time, total work time, duration of rallies, rest time between rallies and physical (number of jumps and number of hits done by defenders and blockers characteristics. A one-way ANOVA, independent samples t-test and multinomial logistic regression were performed to analyze the variables studied. The analysis of temporal and physical characteristics showed differences considering age group, player’s role and quality of opposition. The duration of set, total rest time, and number of jumps done by defenders significantly increased from the U19 to senior category. Multinomial logistic regression showed that in: a balanced games, rest time between rallies was higher in seniors than in U19 or U21; number of jumps done by defenders was higher in seniors than in U19 and U21; b moderate balanced games, number of jumps done by defenders was higher in seniors than in U21 and number of jumps done by blockers was smaller in U19 than U21 or seniors; c unbalanced games, no significant findings were shown. This study suggests differences in players’ performances according to age group and players’ role in different qualities of opposition. The article provides reference values that can be useful to guide training and create scenarios that resemble a competition, taking into account physical and temporal characteristics.

Criticality safety validation: Simple geometry, single unit 233U systems

International Nuclear Information System (INIS)

Putman, V.L.

1997-06-01

Typically used LMITCO criticality safety computational methods are evaluated for suitability when applied to INEEL 233 U systems which reasonably can be modeled as simple-geometry, single-unit systems. Sixty-seven critical experiments of uranium highly enriched in 233 U, including 57 aqueous solution, thermal-energy systems and 10 metal, fast-energy systems, were modeled. These experiments include 41 cylindrical and 26 spherical cores, and 41 reflected and 26 unreflected systems. No experiments were found for intermediate-neutron-energy ranges, or with interstitial non-hydrogenous materials typical of waste systems, mixed 233 U and plutonium, or reflectors such as steel, lead, or concrete. No simple geometry experiments were found with cubic or annular cores, or approximating infinite sea systems. Calculations were performed with various tools and methodologies. Nine cross-section libraries, based on ENDF/B-IV, -V, or -VI.2, or on Hansen-Roach source data, were used with cross-section processing methods of MCNP or SCALE. The k eff calculations were performed with neutral-particle transport and Monte Carlo methods of criticality codes DANT, MCNP 4A, and KENO Va

Determination of uranium concentrations and "2"3"4U/"2"3"8U activity ratio in some granitic rock samples by alpha spectrometry: application of a radiochemical procedure

International Nuclear Information System (INIS)

Khattab, Mahmoud R.

2016-01-01

The present study is an application of a radiochemical procedure using alpha spectrometry technique for determination of uranium isotopes "2"3"8U, "2"3"4U and "2"3"5U on 13 granitic samples. These samples were collected from Gabal Gattar area, Northeastern Desert, Egypt. The collected samples were digested using microwave technique with aqua regia and spiked with "2"3"2U for chemical yield and activity calculation. Separation of uranium isotopes from the samples was done by Dowex 1 x 4 (50-100 mesh) resin followed by source preparation using microprecipitation technique. The concentrations of "2"3"8U were ranged between 28.9±0.9 and 134.8±1.8 Bq/g, and the "2"3"4U concentrations were between 24±0.6 and 147.7±2.2 Bq/g. For the "2"3"5U, the activity concentrations were between 1.3±0.2 and 6.7±1.2 Bq/g. The activity ratio of "2"3"4U/"2"3"8U was calculated and varied from 0.80 to 1.30. (author)

A Decision Support Tool for Planning the Sampling of Tank 19

International Nuclear Information System (INIS)

Edwards, T.B.

2002-01-01

The Statistical Consulting Section (SCS) of the Savannah River Technology Center (SRTC) was asked to develop a decision support system (DSS) to aid in the planning of the process to characterize the heel of Tank 19. This characterization is to be based on samples of the tank heel, and the DSS is to be used to help determine the number of samples that might be needed to provide a meaningful characterization based upon assumptions for relevant variations and volumes. The objective of this report is to describe the framework used to develop the DSS and to document its calculations. The DSS was developed as a Microsoft Excel spreadsheet. Detailed input and output for two test cases are provided in the appendix as part of the documentation of this spreadsheet

Attitudes toward Bisexual Men and Women among a Nationally Representative Probability Sample of Adults in the United States

Science.gov (United States)

Herbenick, Debby; Friedman, M. Reuel; Schick, Vanessa; Fu, Tsung-Chieh (Jane); Bostwick, Wendy; Bartelt, Elizabeth; Muñoz-Laboy, Miguel; Pletta, David; Reece, Michael; Sandfort, Theo G. M.

2016-01-01

As bisexual individuals in the United States (U.S.) face significant health disparities, researchers have posited that these differences may be fueled, at least in part, by negative attitudes, prejudice, stigma, and discrimination toward bisexual individuals from heterosexual and gay/lesbian individuals. Previous studies of individual and social attitudes toward bisexual men and women have been conducted almost exclusively with convenience samples, with limited generalizability to the broader U.S. population. Our study provides an assessment of attitudes toward bisexual men and women among a nationally representative probability sample of heterosexual, gay, lesbian, and other-identified adults in the U.S. Data were collected from the 2015 National Survey of Sexual Health and Behavior (NSSHB), via an online questionnaire with a probability sample of adults (18 years and over) from throughout the U.S. We included two modified 5-item versions of the Bisexualities: Indiana Attitudes Scale (BIAS), validated sub-scales that were developed to measure attitudes toward bisexual men and women. Data were analyzed using descriptive statistics, gamma regression, and paired t-tests. Gender, sexual identity, age, race/ethnicity, income, and educational attainment were all significantly associated with participants' attitudes toward bisexual individuals. In terms of responses to individual scale items, participants were most likely to “neither agree nor disagree” with all attitudinal statements. Across sexual identities, self-identified other participants reported the most positive attitudes, while heterosexual male participants reported the least positive attitudes. As in previous research on convenience samples, we found a wide range of demographic characteristics were related with attitudes toward bisexual individuals in our nationally-representative study of heterosexual, gay/lesbian, and other-identified adults in the U.S. In particular, gender emerged as a significant

78 FR 11140 - BE-605: Quarterly Survey of Foreign Direct Investment in the United States-Transactions of U.S...

Science.gov (United States)

2013-02-15

... BE-605: Quarterly Survey of Foreign Direct Investment in the United States--Transactions of U.S... conducting the mandatory survey titled BE-605, Quarterly Survey of Foreign Direct Investment in the United... quarterly Form BE-605 is required from each U.S. business enterprise in which a foreign entity has a direct...

10 CFR Appendix A to Subpart U of... - Sampling Plan for Enforcement Testing of Electric Motors

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Sampling Plan for Enforcement Testing of Electric Motors A Appendix A to Subpart U of Part 431 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY EFFICIENCY... to Subpart U of Part 431—Sampling Plan for Enforcement Testing of Electric Motors Step 1. The first...

Apparatus for surface treatment of U-Pu carbide fuel samples

International Nuclear Information System (INIS)

Fukushima, Susumu; Arai, Yasuo; Handa, Muneo; Ohmichi, Toshihiko; Shiozawa, Ken-ichi.

1979-05-01

Apparatus has been constructed for treating the surface of U-Pu carbide fuel samples for EPMA. The treatment is to clean off oxide layer on the surface, then coat with an electric-conductive material. The apparatus, safe in handling plutonium, operates as follows. (1) To avoid oxidation of the analyzing surface by oxygen and water in the air, series of cleaning and coating, i.e. ion-etching and ion-coating or ion-etching and vacuum-evaporation is done at the same time in an inert gas atmosphere. (2) Ion-etching is possible on samples embedded in non-electric-conductive and low heat-conductive resin. (3) Since the temperature rise in (2) is negligible, there is no deterioration of the samples. (author)

Accounting for Diversity in Suicide Research: Sampling and Sample Reporting Practices in the United States.

Science.gov (United States)

Cha, Christine B; Tezanos, Katherine M; Peros, Olivia M; Ng, Mei Yi; Ribeiro, Jessica D; Nock, Matthew K; Franklin, Joseph C

2018-04-01

Research on suicidal thoughts and behaviors (STB) has identified many risk factors, but whether these findings generalize to diverse populations remains unclear. We review longitudinal studies on STB risk factors over the past 50 years in the United States and evaluate the methodological practices of sampling and reporting sample characteristics. We found that articles frequently reported participant age and sex, less frequently reported participant race and ethnicity, and rarely reported participant veteran status or lesbian, gay, bisexual, and transgender status. Sample reporting practices modestly and inconsistently improved over time. Finally, articles predominantly featured White, non-Hispanic, young adult samples. © 2017 The American Association of Suicidology.

Rebaudiosides T and U, minor C-19 xylopyranosyl and arabinopyranosyl steviol glycoside derivatives from Stevia rebaudiana (Bertoni) Bertoni.

Science.gov (United States)

Perera, Wilmer H; Ghiviriga, Ion; Rodenburg, Douglas L; Alves, Kamilla; Bowling, John J; Avula, Bharathi; Khan, Ikhlas A; McChesney, James D

2017-03-01

Two diterpene glycosides were isolated from a commercial Stevia rebaudiana leaf extract. One was found to be 13-[(2-O-β-d-glucopyranosyl-3-O-β-d-glucopyranosyl-β-d-glucopyranosyl)oxy]ent-kaur-16-en-19-oic acid-(2-O-β-d-xylopyranosyl-3-O-β-d-glucopyranosyl- β-d-glucopyranosyl) ester (rebaudioside T), whereas the other was determined to be 13-[(2-O-β-d-glucopyranosyl-3-O-β-d-glucopyranosyl-β-d-glucopyranosyl)oxy]ent-kaur-16-en-19-oic acid-(6-O-α-l-arabinopyranosyl-β-d-glucopyranosyl) ester (rebaudioside U). In addition, five C-19 sugar free derivatives were prepared and identified as follows: 13-[(2-O-α-l-rhamnopyranosyl-β-d-glucopyranosyl)]oxy]kaur-16-en-19-oic acid (dulcoside A 1 ); 13-[(2-O-β-d-xylopyranosy-3-O-β-d-glucopyranosyl-β-d-glucopyranosyl)oxy]kaur-16-en-19-oic acid; 13-[(2-O-β-d-xylopyranosyl-β-d-glucopyranosyl-)oxy]kaur-16-en-19-oic acid; 13-[(2-O-β-d-glucopyranosyl-3-O-β-d-glucopyranosyl-β-d-xylopyranosyl-)oxy]kaur-16-en-19-oic acid (rebaudioside R 1 ) and 13-[(2-O-6-deoxy-β-d-glucopyranosyl-3-O-β-d-glucopyranosyl-β-d-glucopyranosyl)oxy]kaur-16-en-19-oic acid, respectively. Chemical structures were determined by NMR experiments. HPLC analyses were also useful to differentiate different steviol-C13 sugar substituent patterns by elution position. Copyright © 2016 Elsevier Ltd. All rights reserved.

Definition of sampling units begets conclusions in ecology: the case of habitats for plant communities

OpenAIRE

M?rsdorf, Martin A.; Ravolainen, Virve T.; St?vern, Leif Einar; Yoccoz, Nigel G.; J?nsd?ttir, Ingibj?rg Svala; Br?then, Kari Anne

2015-01-01

In ecology, expert knowledge on habitat characteristics is often used to define sampling units such as study sites. Ecologists are especially prone to such approaches when prior sampling frames are not accessible. Here we ask to what extent can different approaches to the definition of sampling units influence the conclusions that are drawn from an ecological study? We do this by comparing a formal versus a subjective definition of sampling units within a study design which is ...

The inflow of 234U and 238U from the River Odra drainage basin to the Baltic Sea

Directory of Open Access Journals (Sweden)

Bogdan Skwarzec

2010-12-01

Full Text Available In this study the activity of uranium isotopes 234U and 238U in Odra river water samples, collected from October 2003 to July2004, was measured using alpha spectrometry. The uranium concentrations were different in each of the seasons analysed; the lowest values were recorded in summer. In all seasons, uranium concentrations were the highest in Bystrzyca river waters (from 27.81 ± 0.29Bq m-3 of 234U and 17.82 ± 0.23 Bq m-3 of 238U in spring to 194.76 ± 3.43 Bq m-3 of 234U and 134.88 ± 2.85 Bq m-3 of 238U in summer. The lowest concentrations were noted in the Mała Panew (from 1.33 ± 0.02 Bq m-3 of 234U and 1.06 ± 0.02 Bq m-3 of 238U in spring to 3.52 ± 0.05 Bq m-3 of 234U and 2.59± 0.04 Bq m-3 of 238U in autumn. The uranium radionuclides 234U and 238U in the water samples were not in radioactive equilibrium. The 234U / 238U activity ratios were the highest in Odra water samples collected at Głogów (1.84 in autumn, and the lowest in water from the Noteć (1.03 in winter and spring. The 234U / 238U activity ratio decreases along the main stream of the Odra, owing to changes in the salinity of the river's waters. Annually, 8.19 tons of uranium (126.29 G Bq of 234U and 100.80 G Bq of 238U flow into the Szczecin Lagoon with Odra river waters.

Application of bias correction methods to improve U3Si2 sample preparation for quantitative analysis by WDXRF

International Nuclear Information System (INIS)

Scapin, Marcos A.; Guilhen, Sabine N.; Azevedo, Luciana C. de; Cotrim, Marycel E.B.; Pires, Maria Ap. F.

2017-01-01

The determination of silicon (Si), total uranium (U) and impurities in uranium-silicide (U 3 Si 2 ) samples by wavelength dispersion X-ray fluorescence technique (WDXRF) has been already validated and is currently implemented at IPEN's X-Ray Fluorescence Laboratory (IPEN-CNEN/SP) in São Paulo, Brazil. Sample preparation requires the use of approximately 3 g of H 3 BO 3 as sample holder and 1.8 g of U 3 Si 2 . However, because boron is a neutron absorber, this procedure precludes U 3 Si 2 sample's recovery, which, in time, considering routinely analysis, may account for significant unusable uranium waste. An estimated average of 15 samples per month are expected to be analyzed by WDXRF, resulting in approx. 320 g of U 3 Si 2 that would not return to the nuclear fuel cycle. This not only impacts in production losses, but generates another problem: radioactive waste management. The purpose of this paper is to present the mathematical models that may be applied for the correction of systematic errors when H 3 BO 3 sample holder is substituted by cellulose-acetate {[C 6 H 7 O 2 (OH) 3-m (OOCCH 3 )m], m = 0∼3}, thus enabling U 3 Si 2 sample’s recovery. The results demonstrate that the adopted mathematical model is statistically satisfactory, allowing the optimization of the procedure. (author)

The Struggle To Survive: Work for Racial Ethnic Women in the 18th- and 19th-Century United States.

Science.gov (United States)

Higginbotham, Elizabeth

The work situations of Black, Mexican American, and Chinese immigrant women in 18th- and 19th-century United States are explored. Generally, when engaged in agricultural work, all ethnic people were considered units of labor. However, because the slave owner needed to perpetuate his property, Black women were allowed lower rates of production when…

Acrolein and asthma attack prevalence in a representative sample of the United States adult population 2000-2009.

Science.gov (United States)

deCastro, B Rey

2014-01-01

Acrolein is an air toxic and highly potent respiratory irritant. There is little epidemiology available, but US EPA estimates that outdoor acrolein is responsible for about 75 percent of non-cancer respiratory health effects attributable to air toxics in the United States, based on the Agency's 2005 NATA (National-Scale Air Toxics Assessment) and acrolein's comparatively potent inhalation reference concentration of 0.02 µg/m3. Assess the association between estimated outdoor acrolein exposure and asthma attack reported by a representative cross-sectional sample of the adult United States population. NATA 2005 chronic outdoor acrolein exposure estimates at the census tract were linked with residences oif adults (≥18 years old) in the NHIS (National Health Interview Survey) 2000-2009 (n = 271,348 subjects). A sample-weighted logistic regression model characterized the association between the prevalence of reporting at least one asthma attack in the 12 months prior to survey interview and quintiles of exposure to outdoor acrolein, controlling for potential confounders. In the highest quintile of outdoor acrolein exposure (0.05-0.46 µg/m3), there was a marginally significant increase in the asthma attack pOR (prevalence-odds ratio [95% CI]  = 1.08 [0.98∶1.19]) relative to the lowest quintile. The highest quintile was also associated with a marginally significant increase in prevalence-odds (1.13 [0.98∶1.29]) in a model limited to never smokers (n = 153,820). Chronic exposure to outdoor acrolein of 0.05-0.46 µg/m3 appears to increase the prevalence-odds of having at least one asthma attack in the previous year by 8 percent in a representative cross-sectional sample of the adult United States population.

Acrolein and asthma attack prevalence in a representative sample of the United States adult population 2000-2009.

Directory of Open Access Journals (Sweden)

B Rey deCastro

Full Text Available BACKGROUND: Acrolein is an air toxic and highly potent respiratory irritant. There is little epidemiology available, but US EPA estimates that outdoor acrolein is responsible for about 75 percent of non-cancer respiratory health effects attributable to air toxics in the United States, based on the Agency's 2005 NATA (National-Scale Air Toxics Assessment and acrolein's comparatively potent inhalation reference concentration of 0.02 µg/m3. OBJECTIVES: Assess the association between estimated outdoor acrolein exposure and asthma attack reported by a representative cross-sectional sample of the adult United States population. METHODS: NATA 2005 chronic outdoor acrolein exposure estimates at the census tract were linked with residences oif adults (≥18 years old in the NHIS (National Health Interview Survey 2000-2009 (n = 271,348 subjects. A sample-weighted logistic regression model characterized the association between the prevalence of reporting at least one asthma attack in the 12 months prior to survey interview and quintiles of exposure to outdoor acrolein, controlling for potential confounders. RESULTS: In the highest quintile of outdoor acrolein exposure (0.05-0.46 µg/m3, there was a marginally significant increase in the asthma attack pOR (prevalence-odds ratio [95% CI]  = 1.08 [0.98∶1.19] relative to the lowest quintile. The highest quintile was also associated with a marginally significant increase in prevalence-odds (1.13 [0.98∶1.29] in a model limited to never smokers (n = 153,820. CONCLUSIONS: Chronic exposure to outdoor acrolein of 0.05-0.46 µg/m3 appears to increase the prevalence-odds of having at least one asthma attack in the previous year by 8 percent in a representative cross-sectional sample of the adult United States population.

Recombinative generalization of subword units using matching to sample.

LENUS (Irish Health Repository)

Mahon, Catherine

2010-01-01

The purpose of the current study was to develop and test a computerized matching-to-sample (MTS) protocol to facilitate recombinative generalization of subword units (onsets and rimes) and recognition of novel onset-rime and onset-rime-rime words. In addition, we sought to isolate the key training components necessary for recombinative generalization. Twenty-five literate adults participated. Conditional discrimination training emerged as a crucial training component. These findings support the effectiveness of MTS in facilitating recombinative generalization, particularly when conditional discrimination training with subword units is used.

Human Genetic Variation and Yellow Fever Mortality during 19th Century U.S. Epidemics

Science.gov (United States)

2014-01-01

ABSTRACT We calculated the incidence, mortality, and case fatality rates for Caucasians and non-Caucasians during 19th century yellow fever (YF) epidemics in the United States and determined statistical significance for differences in the rates in different populations. We evaluated nongenetic host factors, including socioeconomic, environmental, cultural, demographic, and acquired immunity status that could have influenced these differences. While differences in incidence rates were not significant between Caucasians and non-Caucasians, differences in mortality and case fatality rates were statistically significant for all epidemics tested (P < 0.01). Caucasians diagnosed with YF were 6.8 times more likely to succumb than non-Caucasians with the disease. No other major causes of death during the 19th century demonstrated a similar mortality skew toward Caucasians. Nongenetic host factors were examined and could not explain these large differences. We propose that the remarkably lower case mortality rates for individuals of non-Caucasian ancestry is the result of human genetic variation in loci encoding innate immune mediators. PMID:24895309

76 FR 63984 - Disaster Declaration #12871; Disaster #ZZ-00007; The Entire United States and U.S. Territories

Science.gov (United States)

2011-10-14

... given that as a result of Public Law 106-50, the Veterans Entrepreneurship and Small Business... SMALL BUSINESS ADMINISTRATION Disaster Declaration 12871; Disaster ZZ-00007; The Entire United States and U.S. Territories AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is...

37 CFR 7.31 - Requirements for transformation of an extension of protection to the United States into a U.S...

Science.gov (United States)

2010-07-01

... transformation of an extension of protection to the United States into a U.S. application. 7.31 Section 7.31... transformation of an extension of protection to the United States into a U.S. application. If the International... transformation within three months of the date of cancellation of the international registration and include: (1...

Operable Unit 3-13, Group 3, Other Surface Soils (Phase II) Field Sampling Plan

Energy Technology Data Exchange (ETDEWEB)

G. L. Schwendiman

2006-07-27

This Field Sampling Plan describes the Operable Unit 3-13, Group 3, Other Surface Soils, Phase II remediation field sampling activities to be performed at the Idaho Nuclear Technology and Engineering Center located within the Idaho National Laboratory Site. Sampling activities described in this plan support characterization sampling of new sites, real-time soil spectroscopy during excavation, and confirmation sampling that verifies that the remedial action objectives and remediation goals presented in the Final Record of Decision for Idaho Nuclear Technology and Engineering Center, Operable Unit 3-13 have been met.

Support for Restorative Justice in a Sample of U.S. University Students.

Science.gov (United States)

Ahlin, Eileen M; Gibbs, Jennifer C; Kavanaugh, Philip R; Lee, Joongyeup

2017-02-01

Theories of restorative justice suggest that the practice works best when offenders are enmeshed in multiple interdependencies or attachments to others and belong to a culture that facilitates communitarianism instead of individualism. Restorative justice principles and practices are thus believed to be incongruent with the individualistic culture and legal system of the United States, especially compared with that of nations like Australia and Japan. Using a nonprobability convenience sample of students enrolled in a large public university in the United States, our study examines attitudes toward restorative justice as a fair and just process for reintegrating offenders and meeting the needs of victims. Results indicate that our sample holds less punitive attitudes than citizens in either Australia or Japan. Our findings are discussed in light of recent policy shifts in the United States that suggest a concerted move toward decarceration following the 2008 recession.

New zircon (U-Th)/He and U/Pb eruption age for the Rockland tephra, western USA

Science.gov (United States)

Coble, Matthew A.; Burgess, Seth D.; Klemetti, Erik W.

2017-09-01

Eruption ages of a number of prominent Quaternary volcanic deposits remain inaccurately and/or imprecisely constrained, despite their importance as regional stratigraphic markers in paleo-environment reconstruction and as evidence of climate-altering eruptions. Accurately dating volcanic deposits presents challenging analytical considerations, including poor radiogenic yield, scarcity of datable minerals, and contamination of crystal populations by magma, eruption, and transport processes. One prominent example is the Rockland tephra, which erupted from the Lassen Volcanic Center in the southern Cascade arc. Despite a range in published eruption ages from 0.40 to 0.63 Ma, the Rockland tephra is extensively used as a marker bed across the western United States. To more accurately and precisely constrain the age of the Rockland tephra-producing eruption, we report U/Pb crystallization dates from the outermost ∼2 μm of zircon crystal faces (surfaces) using secondary ion mass spectrometry (SIMS). Our new weighted mean 238U/206Pb age for Rockland tephra zircon surfaces is 0.598 ± 0.013 Ma (2σ) and MSWD = 1.11 (mean square weighted deviation). As an independent test of the accuracy of this age, we obtained new (U-Th)/He dates from individual zircon grains from the Rockland tephra, which yielded a weighted mean age of 0.599 ± 0.012 Ma (2σ, MSWD = 5.13). We also obtained a (U-Th)/He age of 0.628 ± 0.014 Ma (MSWD = 1.19) for the Lava Creek Tuff member B, which was analyzed as a secondary standard to test the accuracy of the (U-Th)/He technique for Quaternary tephras, and to evaluate assumptions made in the model-age calculation. Concordance of new U/Pb and (U-Th)/He zircon ages reinforces the accuracy of our preferred Rockland tephra eruption age, and confirms that zircon surface dates sample zircon growth up to the time of eruption. We demonstrate the broad applicability of coupled U/Pb zircon-surface and single-grain zircon (U-Th)/He geochronology to accurate

27 CFR 19.21 - Tax.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Tax. 19.21 Section 19.21 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Taxes Gallonage Taxes § 19.21 Tax. (a) A tax is imposed by 26 U.S...

Acrolein and Asthma Attack Prevalence in a Representative Sample of the United States Adult Population 2000 – 2009

Science.gov (United States)

deCastro, B. Rey

2014-01-01

Background Acrolein is an air toxic and highly potent respiratory irritant. There is little epidemiology available, but US EPA estimates that outdoor acrolein is responsible for about 75 percent of non-cancer respiratory health effects attributable to air toxics in the United States, based on the Agency's 2005 NATA (National-Scale Air Toxics Assessment) and acrolein's comparatively potent inhalation reference concentration of 0.02 µg/m3. Objectives Assess the association between estimated outdoor acrolein exposure and asthma attack reported by a representative cross-sectional sample of the adult United States population. Methods NATA 2005 chronic outdoor acrolein exposure estimates at the census tract were linked with residences oif adults (≥18 years old) in the NHIS (National Health Interview Survey) 2000 – 2009 (n = 271,348 subjects). A sample-weighted logistic regression model characterized the association between the prevalence of reporting at least one asthma attack in the 12 months prior to survey interview and quintiles of exposure to outdoor acrolein, controlling for potential confounders. Results In the highest quintile of outdoor acrolein exposure (0.05 – 0.46 µg/m3), there was a marginally significant increase in the asthma attack pOR (prevalence-odds ratio [95% CI]  = 1.08 [0.98∶1.19]) relative to the lowest quintile. The highest quintile was also associated with a marginally significant increase in prevalence-odds (1.13 [0.98∶1.29]) in a model limited to never smokers (n = 153,820). Conclusions Chronic exposure to outdoor acrolein of 0.05 – 0.46 µg/m3 appears to increase the prevalence-odds of having at least one asthma attack in the previous year by 8 percent in a representative cross-sectional sample of the adult United States population. PMID:24816802

19 CFR 19.18 - Smelting and refining; allowance for wastage; withdrawal for consumption.

Science.gov (United States)

2010-04-01

...; withdrawal for consumption. 19.18 Section 19.18 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT... wastage; withdrawal for consumption. (a) Except where absolute deductions have been allowed in the... entered for consumption or for warehouse, during a 12-month period beginning on the first day of the month...

50 CFR 19.2 - Scope of regulations.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Scope of regulations. 19.2 Section 19.2... PLANTS (CONTINUED) AIRBORNE HUNTING Introduction § 19.2 Scope of regulations. The regulations contained... United States citizens whether within the territorial jurisdiction of the United States or on the high...

U.K. nuclear data progress report January-December 1986

International Nuclear Information System (INIS)

Sene, M.R.; Cookson, J.A.

1987-06-01

The paper is the United Kingdom Nuclear Data (UKND) progress report, and summarises nuclear data research in the UK between January and December 1986. The contents of the report contains nuclear data work presented by:- UKAEA Harwell, UKAEA Winfrith, National Physical Laboratory, and the Universities of Birmingham, Edinburgh and Oxford. Included in these contributions are collaborative studies involving institutions in Holland, Italy, West Germany and the United States. The report also contains contributions on Chemical Nuclear Data, as well as the summaries of three invited lectures presented at the 19th UK Nuclear Data Form, Harwell Laboratory, 1986. (U.K.)

19 CFR 24.13 - Car, compartment, and package seals; kind, procurement.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Car, compartment, and package seals; kind... SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.13 Car, compartment.... Customs] [Can. Transit] for use on railroad cars, and “United States-Canada Customs” for use on samples...

Physical and temporal characteristics of under 19, under 21 and senior male beach volleyball players.

Science.gov (United States)

Medeiros, Alexandre; Marcelino, Rui; Mesquita, Isabel; Palao, José Manuel

2014-09-01

This study aimed to assess the effects of age groups and players' role (blocker vs. defender specialist) in beach volleyball in relation to physical and temporal variables, considering quality of opposition. 1101 rallies from Under 19 (U19), 933 rallies from Under 21 (U21), and 1480 rallies from senior (senior) (Men's Swatch World Championships, 2010-2011) were observed using video match analysis. Cluster analysis was used to set teams' competitive levels and establish quality of opposition as "balanced", "moderate balanced" and "unbalanced" games. The analyzed variables were: temporal (duration of set, total rest time, total work time, duration of rallies, rest time between rallies) and physical (number of jumps and number of hits done by defenders and blockers) characteristics. A one-way ANOVA, independent samples t-test and multinomial logistic regression were performed to analyze the variables studied. The analysis of temporal and physical characteristics showed differences considering age group, player's role and quality of opposition. The duration of set, total rest time, and number of jumps done by defenders significantly increased from the U19 to senior category. Multinomial logistic regression showed that in: a) balanced games, rest time between rallies was higher in seniors than in U19 or U21; number of jumps done by defenders was higher in seniors than in U19) and U21; b) moderate balanced games, number of jumps done by defenders was higher in seniors than in U21 and number of jumps done by blockers was smaller in U19 than U21 or seniors; c) unbalanced games, no significant findings were shown. This study suggests differences in players' performances according to age group and players' role in different qualities of opposition. The article provides reference values that can be useful to guide training and create scenarios that resemble a competition, taking into account physical and temporal characteristics. Key PointsPlayer roles, quality of opposition

Criticality safety validation: Simple geometry, single unit {sup 233}U systems

Energy Technology Data Exchange (ETDEWEB)

Putman, V.L.

1997-06-01

Typically used LMITCO criticality safety computational methods are evaluated for suitability when applied to INEEL {sup 233}U systems which reasonably can be modeled as simple-geometry, single-unit systems. Sixty-seven critical experiments of uranium highly enriched in {sup 233}U, including 57 aqueous solution, thermal-energy systems and 10 metal, fast-energy systems, were modeled. These experiments include 41 cylindrical and 26 spherical cores, and 41 reflected and 26 unreflected systems. No experiments were found for intermediate-neutron-energy ranges, or with interstitial non-hydrogenous materials typical of waste systems, mixed {sup 233}U and plutonium, or reflectors such as steel, lead, or concrete. No simple geometry experiments were found with cubic or annular cores, or approximating infinite sea systems. Calculations were performed with various tools and methodologies. Nine cross-section libraries, based on ENDF/B-IV, -V, or -VI.2, or on Hansen-Roach source data, were used with cross-section processing methods of MCNP or SCALE. The k{sub eff} calculations were performed with neutral-particle transport and Monte Carlo methods of criticality codes DANT, MCNP 4A, and KENO Va.

Definition of sampling units begets conclusions in ecology: the case of habitats for plant communities

Directory of Open Access Journals (Sweden)

Martin A. Mörsdorf

2015-03-01

Full Text Available In ecology, expert knowledge on habitat characteristics is often used to define sampling units such as study sites. Ecologists are especially prone to such approaches when prior sampling frames are not accessible. Here we ask to what extent can different approaches to the definition of sampling units influence the conclusions that are drawn from an ecological study? We do this by comparing a formal versus a subjective definition of sampling units within a study design which is based on well-articulated objectives and proper methodology. Both approaches are applied to tundra plant communities in mesic and snowbed habitats. For the formal approach, sampling units were first defined for each habitat in concave terrain of suitable slope using GIS. In the field, these units were only accepted as the targeted habitats if additional criteria for vegetation cover were fulfilled. For the subjective approach, sampling units were defined visually in the field, based on typical plant communities of mesic and snowbed habitats. For each approach, we collected information about plant community characteristics within a total of 11 mesic and seven snowbed units distributed between two herding districts of contrasting reindeer density. Results from the two approaches differed significantly in several plant community characteristics in both mesic and snowbed habitats. Furthermore, differences between the two approaches were not consistent because their magnitude and direction differed both between the two habitats and the two reindeer herding districts. Consequently, we could draw different conclusions on how plant diversity and relative abundance of functional groups are differentiated between the two habitats depending on the approach used. We therefore challenge ecologists to formalize the expert knowledge applied to define sampling units through a set of well-articulated rules, rather than applying it subjectively. We see this as instrumental for progress in

Definition of sampling units begets conclusions in ecology: the case of habitats for plant communities.

Science.gov (United States)

Mörsdorf, Martin A; Ravolainen, Virve T; Støvern, Leif Einar; Yoccoz, Nigel G; Jónsdóttir, Ingibjörg Svala; Bråthen, Kari Anne

2015-01-01

In ecology, expert knowledge on habitat characteristics is often used to define sampling units such as study sites. Ecologists are especially prone to such approaches when prior sampling frames are not accessible. Here we ask to what extent can different approaches to the definition of sampling units influence the conclusions that are drawn from an ecological study? We do this by comparing a formal versus a subjective definition of sampling units within a study design which is based on well-articulated objectives and proper methodology. Both approaches are applied to tundra plant communities in mesic and snowbed habitats. For the formal approach, sampling units were first defined for each habitat in concave terrain of suitable slope using GIS. In the field, these units were only accepted as the targeted habitats if additional criteria for vegetation cover were fulfilled. For the subjective approach, sampling units were defined visually in the field, based on typical plant communities of mesic and snowbed habitats. For each approach, we collected information about plant community characteristics within a total of 11 mesic and seven snowbed units distributed between two herding districts of contrasting reindeer density. Results from the two approaches differed significantly in several plant community characteristics in both mesic and snowbed habitats. Furthermore, differences between the two approaches were not consistent because their magnitude and direction differed both between the two habitats and the two reindeer herding districts. Consequently, we could draw different conclusions on how plant diversity and relative abundance of functional groups are differentiated between the two habitats depending on the approach used. We therefore challenge ecologists to formalize the expert knowledge applied to define sampling units through a set of well-articulated rules, rather than applying it subjectively. We see this as instrumental for progress in ecology as only rules

Determination of {sup 236}U in environmental samples by single extraction chromatography coupled to triple-quadrupole inductively coupled plasma-mass spectrometry

Energy Technology Data Exchange (ETDEWEB)

Yang, Guosheng [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Division of Nuclear Technology and Applications, Institute of High Energy Physics, Chinese Academy of Sciences (China); Beijing Engineering Research Center of Radiographic Techniques and Equipment, Beijing, 100049 (China); Tazoe, Hirofumi [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan); Yamada, Masatoshi, E-mail: myamada@hirosaki-u.ac.jp [Department of Radiation Chemistry, Institute of Radiation Emergency Medicine, Hirosaki University, 66-1 Hon-cho, Hirosaki, Aomori, 036-8564 (Japan)

2016-11-09

In order to measure trace {sup 236}U and {sup 236}U/{sup 238}U in environmental samples with a high matrix effect, a novel and simple method was developed that makes the digestion and purification procedures compatible with advanced triple-quadrupole inductively coupled plasma-mass spectrometry. A total dissolution of sample with HF + HNO{sub 3} + HClO{sub 4} was followed by chromatographic separation with a single resin column containing normal type DGA resin (N,N,N′,N’-tetra-n-octyldiglycolamide) as the extractant system. The analytical accuracy and precision of {sup 236}U/{sup 238}U ratios, measured as {sup 236}U{sup 16}O{sup +}/{sup 238}U{sup 16}O{sup +}, were examined by using the reference materials IAEA-135, IAEA-385, IAEA-447, and JSAC 0471. The low method detection limit (3.50 × 10{sup −6} Bq kg{sup −1}) makes it possible to perform routine monitoring of environmental {sup 236}U due to global fallout combined with the Fukushima Daiichi Nuclear Power Plant accident fallout (>10{sup −5} Bq kg{sup −1}). Finally, the developed method was successfully applied to measure {sup 236}U/{sup 238}U ratios and {sup 236}U activities in soil samples contaminated by the accident. The low {sup 236}U/{sup 238}U atom ratios ((1.50–13.5) × 10{sup −8}) and {sup 236}U activities ((2.25–14.1) × 10{sup −2} mBq kg{sup −1}) indicate {sup 236}U contamination was mainly derived from global fallout in the examined samples. - Highlights: • A simple {sup 236}U/{sup 238}U analytical method has been developed. • The separation required just one DGA column chromatography. • {sup 236}U/{sup 238}U atom ratios in soil were measured by ICP-MS/MS. • {sup 236}U/{sup 238}U atom ratios of (1.50–13.5) × 10{sup −8} were observed in Japanese samples. • {sup 236}U activities of (2.25–14.1) × 10{sup −2} mBq kg{sup −1} were found in Japanese samples.

U.S. Census Annual Estimates of the Resident Population for Selected Age Groups by Sex for the United States

Data.gov (United States)

U.S. Department of Health & Human Services — 2010-2015. U.S. Census Annual Estimates of the Resident Population for Selected Age Groups by Sex for the United States. The estimates are based on the 2010 Census...

Alternative Site Technology Deployment-Monitoring System for the U-3ax/bl Disposal Unit at the Nevada Test Site

International Nuclear Information System (INIS)

Dixon, J.M.; Levitt, D.G.; Rawlinson, S.E.

2001-01-01

In December 2000, a performance monitoring facility was constructed adjacent to the U-3ax/bl mixed waste disposal unit at the Nevada Test Site (NTS). Recent studies conducted in the arid southwestern United States suggest that a vegetated monolayer evapotranspiration (ET) closure cover may be more effective at isolating waste than traditional Resource Conservation and Recovery Act (RCRA) multi-layered designs. The monitoring system deployed next to the U-3ax/bl disposal unit consists of eight drainage lysimeters with three surface treatments: two are left bare; two are revegetated with native species; two are being allowed to revegetate with invader species; and two are reserved for future studies. Soil used in each lysimeter is native alluvium taken from the same location as the soil used for the cover material on U-3ax/bl. The lysimeters were constructed so that any drainage to the bottom can be collected and measured. To provide a detailed evaluation of the cover performance, an ar ray of 16 sensors was installed in each lysimeter to measure soil water content, soil water potential, and soil temperature. Revegetation of the U-3ax/bl closure cover establishes a stable plant community that maximizes water loss through transpiration while at the same time, reduces water and wind erosion and ultimately restores the disposal unit to its surrounding Great Basin Desert environment

Prevalence of parvovirus B19 and parvovirus V9 DNA and antibodies in paired bone marrow and serum samples from healthy individuals.

Science.gov (United States)

Heegaard, Erik D; Petersen, Bodil Laub; Heilmann, Carsten J; Hornsleth, Allan

2002-03-01

Parvovirus B19 (hereafter referred to as B19) exhibits a marked tropism to human bone marrow (BM), and infection may lead to erythema infectiosum, arthropathy, hydrops fetalis, and various hematologic disorders. Recently, a distinct parvovirus isolate termed V9 with an unknown clinical spectrum was discovered. In contrast to the many studies of B19 serology and viremia, valid information on the frequency of B19 or V9 DNA in the BM of healthy individuals is limited. To develop a reference value, paired BM and serum samples from healthy subjects were tested for the presence of B19 and V9 DNA and specific antibodies. Immunoglobulin M (IgM) was not found in any of the serum samples. The prevalence of IgG showed a gradual and steady increase from 37% in children aged 1 to 5 years to 87% in people aged >50 years. When 190 well-characterized subjects were examined, B19 DNA was detected in the BM of 4 individuals (2.1%; 95% confidence interval, 0.58 to 5.3%) while none of the paired serum samples showed evidence of circulating viral DNA. V9 DNA was not found in any of the BM or serum samples. The finding of B19 DNA probably indicated a primary infection in one 7-year-old individual and reinfection or reactivation of persistent infection in the remaining three persons, aged 47 to 58 years. Serving as a benchmark for future studies, these findings are useful when interpreting epidemiologic data, performing BM transplantation, or considering clinical implications of parvovirus infection.

12 CFR 561.19 - Financial institution.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Financial institution. 561.19 Section 561.19... AFFECTING ALL SAVINGS ASSOCIATIONS § 561.19 Financial institution. The term financial institution has the same meaning as the term depository institution set forth in 12 U.S.C. 1813(c)(1). ...

Sampling and Control Circuit Board for an Inertial Measurement Unit

Science.gov (United States)

Chelmins, David T (Inventor); Powis, Richard T., Jr. (Inventor); Sands, Obed (Inventor)

2016-01-01

A circuit board that serves as a control and sampling interface to an inertial measurement unit ("IMU") is provided. The circuit board is also configured to interface with a local oscillator and an external trigger pulse. The circuit board is further configured to receive the external trigger pulse from an external source that time aligns the local oscillator and initiates sampling of the inertial measurement device for data at precise time intervals based on pulses from the local oscillator. The sampled data may be synchronized by the circuit board with other sensors of a navigation system via the trigger pulse.

Standardization of thermal and epithermal INAA methods for simultaneous determination of U and Th in mixed oxide samples

International Nuclear Information System (INIS)

Acharya, R.; Pujari, P.K.; Chandra, Ruma

2010-01-01

Full text: Uranium and thorium are important fuel materials for nuclear power program. In recent years utilization of thoria based fuel has assumed significance due to higher energy requirements. Thorium based mixed oxide is the proposed fuel for Advanced Heavy Water Reactors (AHWR). In this respect, studies are carried out through preparation of natural U and Th mixed oxides by powder metallurgical route, wherein composition of U and Th is specific and requires strict control in terms their contents and homogeneity in the mixture. Stringent chemical quality control necessitates compositional characterization of the fuel material i.e. accurate and precise determination of U and Th. A suitable method which does not need any chemical dissolution and yields high precision results with minima sample handling is desirable. Instrumental neutron activation analysis (INAA) using reactor neutron is the technique of choice. In view of this, INAA methods namely thermal lNAA (TNAA) (utilizing whole reactor neutrons) and epithermal INAA (ENAA) (utilizing epicadmium neutrons) were standardized for the determination of U and Th in presence of each other in mixed oxide samples. In the present work pneumatic carrier facility (PCF) of Dhruva reactor and self-serve facility of CIRUS reactor were used for TNAA and ENAA respectively. Standards, synthetic samples and mixed oxide samples prepared in cellulose matrix, were irradiated for 1 minute at PCF of Dhruva reactor and for 1 hour at CIRUS reactor under cadmium cover (0.5 mm). Radioactive assay was carried out using 40% relative efficiency HPGe detector. Peak areas under the full energy peaks were evaluated by peak fit method using the PHAST software. Both activation and daughter products of U ( 239 U, 74.6 keV and 239 Np, 277 keV) and Th ( 233 Th, 86 keV and 233 Pa, 312 keV) were used for their concentration determination. The method was validated by analyzing synthetic mixed oxide samples (6-48%U-Th mixed oxide). The % deviations

Financial management skills are associated with food insecurity in a sample of households with children in the United States.

Science.gov (United States)

Gundersen, Craig G; Garasky, Steven B

2012-10-01

Food insecurity is one of the leading public health challenges facing children in the United States today. Reducing food insecurity and its attendant consequences requires an understanding of the determinants of food insecurity. Although previous work has greatly advanced our understanding of these determinants, the role of one of the oft-speculated important determinants of food insecurity, household financial management skills, has not been considered. To address this research lacuna, we use a recently conducted survey, the Survey of Household Finances and Childhood Obesity, that has information on specific financial management practices, impressions of financial management skills, and households' food insecurity. The sample included 904 households with children. Within this sample, 19.3% were food insecure and, for our central financial management skill variable, the mean value was 3.55 on a 5-point scale. Probit regression models estimated the probability of a household being food insecure as conditional on financial management skills and other covariates. We found a large and significant inverse relationship between a respondent's use of specific financial management practices and food insecurity and between a respondent's confidence in his or her financial management skills and food insecurity. That is, households with greater financial management abilities are less likely to be food insecure. This finding also holds when the sample is restricted to households with incomes <200% of the poverty line. These results suggest that improving households' financial management skills has the potential to reduce food insecurity in the United States.

Recommended reactor coolant water chemistry requirements for WWER-1000 units with 235U higher enriched fuel

International Nuclear Information System (INIS)

Dobrevski, I.; Zaharieva, N.

2011-01-01

The last decade worldwide experience of PWRs and WWERs confirms the trends for the improvement of the nuclear power industry electricity production through the implementation of high burn-up or high fuel duty, which are usually accompanied with the usage of UO 2 fuel with higher content of 235 U - 4.0% - 4.5% (5.0%). It was concluded that the onset of sub-cooled nucleate boiling (SNB) on the fuel cladding surfaces and the initial excess reactivity of the core are the primary and basic factors accompanying the implementation of uranium fuel with higher 235 U content, aiming extended fuel cycles and higher burn-up of the fuel in Pressurized Water Reactors. As main consequences of the presence of these factors the modifications of chemical / electrochemical environments of nuclear fuel cladding- and reactor coolant system- surfaces are evaluated. These conclusions are the reason for: 1) The determination of the choices of the type of fuel cladding materials in respect with their enough corrosion resistance to the specific fuel cladding environment, created by the presence of SNB; 2) The development and implementation of primary circuit water chemistry guidelines ensuring the necessary low corrosion rates of primary circuit materials and limitation of cladding deposition and out-of-core radioactivity buildup; 3) Implementation of additional neutron absorbers which allow enough decrease of the initial concentration of H 3 BO 3 in coolant, so that its neutralization will be possible with the permitted alkalising agent concentrations. In this paper the specific features of WWER-1000 units in Bulgarian Nuclear Power Plant; use of 235 U higher enriched fuel in the WWER-1000 reactors in the Kozloduy NPP; coolant water chemistry and radiochemistry plant data during the power operation period of the Kozloduy NPP Unit 5, 15 th fuel cycle; evaluation of the approaches and results by the conversion of the WWER-1000 Units at the Kozloduy NPP to the uranium fuel with 4.3% 235 U as

The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

International Nuclear Information System (INIS)

Meadows, J.W.

1986-12-01

The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

19.gadsimta Anglijas naratīvs japāņu animācijas seriālā „Emma: A Victorian Romance”

OpenAIRE

Čiževska, Inese

2014-01-01

Bakalaura darba mērķis ir noskaidrot, kā ar dažādiem stāstījuma veidiem, zīmēm un simboliem tiek reprezentēta 19.gs.Anglija, kādas ir līdzīgās un atšķirīgās iezīmes starp vēsturisko un animācijas seriālā atveidoto vidi. Darbā tiek analizēts japāņu animācijas seriāls „Emma: A Victorian Romance”. Empīriskie dati iegūti, veicot naratīva analīzi un semiotisko analīzi, ar kuru palīdzību tiks noskaidrots, kā caur japāņu kultūras prizmu tiek attēlota 19.gs. Anglija. Iegūtie rezultāti sniedz inf...

A feasibility study of U-Pb and Pb-Pb dating of kimberlites using groundmass mineral fractions and whole-rock samples

International Nuclear Information System (INIS)

Kramers, J.D.; Smith, C.B.

1983-01-01

This paper describes partly successful attempts to determine emplacement ages of kimberlites by U-Pb and Pb-Pb methods involving groundmass minerals with high U content (notably perovskite) and whole-rock kimberlite samples. U/Pb ratios in perovskite in the matrix of kimberlites can be two orders of magnitude larger than in the rest of the kimberlite material, and with simple mineral separation techniques moderate success was achieved in U-Pb dating of fresh samples of younger kimberlites (around 100 Ma). The differences in U/Pb ratios between kimberlite samples from different parts of the same pipe have also been found to be large enough, in some cases, to allow reasonably accurate U-Pb age determination. In older kimberlites the U-Pb ages obtained were mostly imcompatible with geological constraints and results obtained by other methods. However, for such pipes use of Pb-Pb systematics yields realistic age limits in some cases

A high incidence of polymorphic CYP2C19 variants in archival blood samples from Papua New Guinea

Directory of Open Access Journals (Sweden)

Hsu Huai-Ling

2008-09-01

Full Text Available Abstract There is considerable inter-ethnic variability in the incidence of CYP2C19 genetic poor metabolisers (var/var. About 3 per cent of Caucasians are CYP2C19 var/var. By contrast, an extremely high incidence (70 per cent is observed in the Melanesian island of Vanuatu. The colonisation of the Pacific Islands is believed to have involved migration through Papua New Guinea (PNG, and hence a high incidence may also be expected in this population. The reported incidence in PNG was only 36 per cent, however. PNG is a country of extensive ethnic diversity, and the incidence of the CYP2C19 var/var in other regional populations of PNG is currently not established. In this study, restriction fragment length polymorphism-polymerase chain reaction analysis of archival blood serum samples was used to determine the prevalence of the CYP2C19*2 and *3 variant alleles in three different ethnic and geographically isolated populations of PNG. In the largest population studied (Iruna, the frequency of both variant CYP2C19 alleles was high (0.37 and 0.34, respectively. Specifically, the frequency of the CYP2C19*3 allele was significantly higher than in the PNG (East Sepik population reported previously (0.34 vs 0.16; p 0.0001. In the Iruna population, 48.9 per cent of the samples were homozygous variants for CYP2C19*2 or *3, which although higher was not statistically different from the East Sepik population (36 per cent. The results of this study indicated that other regional populations of PNG also have a relatively high incidence of the CYP2C19 genetic polymorphism compared with Caucasian populations. The high incidence reported in Vanuatu, however, may be due to genetic drift rather than a PNG founder population, as the Vanuatu population is dominated by the CYP2C19*2 allele, with a lower contribution from the *3 allelic variant.

Differences in spirometry values between U.S. children 6-11 years and adolescents 12-19 years with current asthma, 2007-2010.

Science.gov (United States)

Kit, Brian K; Simon, Alan E; Tilert, Timothy; Okelo, Sande; Akinbami, Lara J

2016-03-01

National Asthma Education and Prevention Program (NAEPP) guidelines recommend that periodic spirometry be performed in youth with asthma. NAEPP uses different spirometry criteria to define uncontrolled asthma for children (6-11 years) and adolescents (12+ years). To describe differences in spirometry between U.S. children and adolescents with current asthma. We examined cross-sectional spirometry data from 453 U.S. youth with current asthma age 6-19 years from the 2007-2010 National Health and Nutrition Examination Surveys. The main outcomes were percentage predicted forced expiratory volume at 1 sec (FEV1%) ≤80 and the ratio of FEV1 to forced vital capacity (FEV1/FVC) ≤0.80. We also examined the prevalence of youth with spirometry values consistent with uncontrolled asthma, using NAEPP age-specific criteria, defined for children aged 6-11 years as FEV1% ≤80 or FEV1/FVC ≤0.80, and for adolescents aged 12-19 years as FEV1% ≤80. Children 6-11 years and adolescents 12-19 years did not differ in prevalence of FEV1% ≤80 (10.1% vs. 9.0%) or FEV1/FVC ≤0.80 (30.6% vs. 29.8%). However, based on the NAEPP age-specific criteria, 33.0% of children 6-11 years and 9.0% of adolescents 12-19 years had spirometry values consistent with uncontrolled asthma (P spirometry values consistent with uncontrolled asthma did differ. The difference appears to stem mainly from the different spirometry criteria for the two age groups. © 2015 Wiley Periodicals, Inc.

Human Parvovirus B19

OpenAIRE

Yarkın, Fügen

1992-01-01

Human parvavirus B19'un morfolojisi, oluşturduğu enfeksiyonun klinik belirtileri,tanı yöntemleri, epidemik özellikleri göz önüne alındığında, özellikle kronik olgularda B19 antikorlarının ilave edildiği immünglobulinlerin intravenöz infüzyonunun tedavide etkili olabilmektedir.

Site Characterization Data from the U3ax/bl Exploratory Boreholes at the Nevada Test Site

International Nuclear Information System (INIS)

2005-01-01

This report provides qualitative analyses and preliminary interpretations of hydrogeologic data obtained from two 45-degree, slanted exploratory boreholes drilled within the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site. Borehole UE-3bl-D1 was drilled beneath the U3ax/bl mixed waste disposal unit, and Borehole UE-3bl-U1 was drilled in undisturbed alluvium adjacent to the disposal unit. The U3ax/bl disposal unit is located within two conjoined subsidence craters, U3ax and U3bl, which were created by underground nuclear testing. Data from these boreholes were collected to support site characterization activities for the U3ax/bl disposal unit and the entire Area 3 RWMS. Site characterization at disposal units within the Area 3 RWMS must address the possibility that subsidence craters and associated disturbed alluvium of the chimneys beneath the craters might serve as pathways for contaminant migration. The two boreholes were drilled and sampled to compare hydrogeologic properties of alluvium below the waste disposal unit with those of adjacent undisturbed alluvium. Whether Borehole UE-3bl-D1 actually penetrated the chimney of the U3bl crater is uncertain. Analyses of core samples showed little difference in hydrogeologic properties between the two boreholes. Important findings of this study include the following: No hazardous or radioactive constituents of waste disposal concern were found in the samples obtained from either borehole. No significant differences in physical and hydrogeologic properties between boreholes is evident, and no evidence of significant trends with depth for any of these properties was observed. The values observed are typical of sandy materials. The alluvium is dry, with volumetric water content ranging from 5.6 to 16.2 percent. Both boreholes exhibit a slight increase in water content with depth, the only such trend observed. Water potential measurements on core samples from both boreholes show a large positive

Site Characterization Data from the U3ax/bl Exploratory Boreholes at the Nevada Test Site

Energy Technology Data Exchange (ETDEWEB)

Bechtel Nevada; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

2005-08-01

This report provides qualitative analyses and preliminary interpretations of hydrogeologic data obtained from two 45-degree, slanted exploratory boreholes drilled within the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site. Borehole UE-3bl-D1 was drilled beneath the U3ax/bl mixed waste disposal unit, and Borehole UE-3bl-U1 was drilled in undisturbed alluvium adjacent to the disposal unit. The U3ax/bl disposal unit is located within two conjoined subsidence craters, U3ax and U3bl, which were created by underground nuclear testing. Data from these boreholes were collected to support site characterization activities for the U3ax/bl disposal unit and the entire Area 3 RWMS. Site characterization at disposal units within the Area 3 RWMS must address the possibility that subsidence craters and associated disturbed alluvium of the chimneys beneath the craters might serve as pathways for contaminant migration. The two boreholes were drilled and sampled to compare hydrogeologic properties of alluvium below the waste disposal unit with those of adjacent undisturbed alluvium. Whether Borehole UE-3bl-D1 actually penetrated the chimney of the U3bl crater is uncertain. Analyses of core samples showed little difference in hydrogeologic properties between the two boreholes. Important findings of this study include the following: No hazardous or radioactive constituents of waste disposal concern were found in the samples obtained from either borehole. No significant differences in physical and hydrogeologic properties between boreholes is evident, and no evidence of significant trends with depth for any of these properties was observed. The values observed are typical of sandy materials. The alluvium is dry, with volumetric water content ranging from 5.6 to 16.2 percent. Both boreholes exhibit a slight increase in water content with depth, the only such trend observed. Water potential measurements on core samples from both boreholes show a large positive

Caught in the Middle at the U.S.-Canadian Border

Science.gov (United States)

2013-03-01

strategic-plan-fy-2012-2016.pdf.; Janet Napolitano, “Northern Border Strategy,” Homeland Security Digital Library, June 2012, http://www.hsdl.org...Stewardship,” Homeland Security Digital Library, January 19, 2007, http://www.hsdl.org/?view&did=470382. 14 U.S. Coast Guard, Great Lakes Maritime...28 per cent of merchandise shipments between Canada and the United States pass through the Windsor-Detroit Corridor … Our national economy―and our

The Mann-Whitney U: A Test for Assessing Whether Two Independent Samples Come from the Same Distribution

Directory of Open Access Journals (Sweden)

Nadim Nachar

2008-03-01

Full Text Available It is often difficult, particularly when conducting research in psychology, to have access to large normally distributed samples. Fortunately, there are statistical tests to compare two independent groups that do not require large normally distributed samples. The Mann-Whitney U is one of these tests. In the following work, a summary of this test is presented. The explanation of the logic underlying this test and its application are presented. Moreover, the forces and weaknesses of the Mann-Whitney U are mentioned. One major limit of the Mann-Whitney U is that the type I error or alpha (? is amplified in a situation of heteroscedasticity.

32 CFR 705.19 - Financing.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Financing. 705.19 Section 705.19 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY UNITED STATES NAVY REGULATIONS AND OFFICIAL RECORDS PUBLIC AFFAIRS REGULATIONS § 705.19 Financing. (a) The financial requirements for...

Improving Interagency Information Sharing Using Technology Demonstrations: The Legal Basis for Using New Sensor Technologies for Counterdrug Operations Along the U.S. Border

Science.gov (United States)

2014-01-01

addition, U.S. citizens are using a growing number of electronic, wireless, and digital com- munications devices, networks, and applications. These can be...departure of merchandise (as defined in section 401 of the Tariff Act of 1930 (19 U.S.C. 1401) into or out of the customs territory of the United

12 CFR 19.240 - Inflation adjustments.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Inflation adjustments. 19.240 Section 19.240... PROCEDURE Civil Money Penalty Inflation Adjustments § 19.240 Inflation adjustments. (a) The maximum amount... Civil Penalties Inflation Adjustment Act of 1990 (28 U.S.C. 2461 note) as follows: ER10NO08.001 (b) The...

Analysis of U and Pu resin bead samples with a single stage mass spectrometer

International Nuclear Information System (INIS)

Smith, D.H.; Walker, R.L.; Bertram, L.K.; Carter, J.A.

1979-01-01

Resin bead sampling enables the shipment of nanogram U and Pu quantities for analysis. Application of this sampling technique to safeguards was investigated with a single-stage mass spectrometer. Standards gave results in good agreement with NBS certified values. External precisions of +-0.5% were obtained on isotopic ratios of approx. 0.01; precisions on quantitative measurements are +-1.0%

Determination of uranium in tree bark samples by epithermal neutron activation analysis

International Nuclear Information System (INIS)

Lima, Nicole Pereira de; Saiki, Mitiko

2017-01-01

In this study uranium (U) concentrations were determined in certified reference materials (CRMs) and in tree bark samples collected in 'Cidade Universitaria Armando de Salles Oliveira' (CUASO) USP, Sao Paulo, SP, Brazil). The barks were collected from different species namely Poincianella pluviosa and Tipuana tipu. These bark samples were cleaned, dried, grated and milled for the analyses by epithermal neutron activation analysis method (ENAA). This method consists on irradiating samples and U standard in IEAR1 nuclear reactor with thermal neutron flux of 1:9 x 10 12 n cm -2 s -1 during 40 to 60 seconds depending on the samples matrices. The samples and standard were measured by gamma ray spectroscopy. U was identified by the peak of 74.66 keV of 239 U with half life of 23.47 minutes. Concentration of U was calculated by comparative method. For analytical quality control of U results, certified reference materials were analysed. Results obtained for CRMs presented good precision and accuracy, with |Z score| <= 0.39. Uranium concentrations in tree barks varied from 83.1 to 627.6 ng g - 1 and the relative standard deviations of these results ranged from 1.8 to 10%. (author)

Determination of uranium in tree bark samples by epithermal neutron activation analysis

Energy Technology Data Exchange (ETDEWEB)

Lima, Nicole Pereira de; Saiki, Mitiko, E-mail: mitiko@ipen.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2017-11-01

In this study uranium (U) concentrations were determined in certified reference materials (CRMs) and in tree bark samples collected in 'Cidade Universitaria Armando de Salles Oliveira' (CUASO) USP, Sao Paulo, SP, Brazil). The barks were collected from different species namely Poincianella pluviosa and Tipuana tipu. These bark samples were cleaned, dried, grated and milled for the analyses by epithermal neutron activation analysis method (ENAA). This method consists on irradiating samples and U standard in IEAR1 nuclear reactor with thermal neutron flux of 1:9 x 10{sup 12} n cm{sup -2} s{sup -1} during 40 to 60 seconds depending on the samples matrices. The samples and standard were measured by gamma ray spectroscopy. U was identified by the peak of 74.66 keV of {sup 239}U with half life of 23.47 minutes. Concentration of U was calculated by comparative method. For analytical quality control of U results, certified reference materials were analysed. Results obtained for CRMs presented good precision and accuracy, with |Z score| <= 0.39. Uranium concentrations in tree barks varied from 83.1 to 627.6 ng g{sup -} {sup 1} and the relative standard deviations of these results ranged from 1.8 to 10%. (author)

Application of bias correction methods to improve U{sub 3}Si{sub 2} sample preparation for quantitative analysis by WDXRF

Energy Technology Data Exchange (ETDEWEB)

Scapin, Marcos A.; Guilhen, Sabine N.; Azevedo, Luciana C. de; Cotrim, Marycel E.B.; Pires, Maria Ap. F., E-mail: mascapin@ipen.br, E-mail: snguilhen@ipen.br, E-mail: lvsantana@ipen.br, E-mail: mecotrim@ipen.br, E-mail: mapires@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)

2017-07-01

The determination of silicon (Si), total uranium (U) and impurities in uranium-silicide (U{sub 3}Si{sub 2}) samples by wavelength dispersion X-ray fluorescence technique (WDXRF) has been already validated and is currently implemented at IPEN's X-Ray Fluorescence Laboratory (IPEN-CNEN/SP) in São Paulo, Brazil. Sample preparation requires the use of approximately 3 g of H{sub 3}BO{sub 3} as sample holder and 1.8 g of U{sub 3}Si{sub 2}. However, because boron is a neutron absorber, this procedure precludes U{sub 3}Si{sub 2} sample's recovery, which, in time, considering routinely analysis, may account for significant unusable uranium waste. An estimated average of 15 samples per month are expected to be analyzed by WDXRF, resulting in approx. 320 g of U{sub 3}Si{sub 2} that would not return to the nuclear fuel cycle. This not only impacts in production losses, but generates another problem: radioactive waste management. The purpose of this paper is to present the mathematical models that may be applied for the correction of systematic errors when H{sub 3}BO{sub 3} sample holder is substituted by cellulose-acetate {[C_6H_7O_2(OH)_3_-_m(OOCCH_3)m], m = 0∼3}, thus enabling U{sub 3}Si{sub 2} sample’s recovery. The results demonstrate that the adopted mathematical model is statistically satisfactory, allowing the optimization of the procedure. (author)

Evaluation of a Validated Food Frequency Questionnaire for Self-Defined Vegans in the United States

Science.gov (United States)

Dyett, Patricia; Rajaram, Sujatha; Haddad, Ella H.; Sabate, Joan

2014-01-01

This study aimed to develop and validate a de novo food frequency questionnaire for self-defined vegans in the United States. Diet histories from pilot samples of vegans and a modified ‘Block Method’ using seven selected nutrients of concern in vegan diet patterns, were employed to generate the questionnaire food list. Food frequency responses of 100 vegans from 19 different U.S. states were obtained via completed mailed questionnaires and compared to multiple telephone-conducted diet recall interviews. Computerized diet analyses were performed. Correlation coefficients, t-tests, rank, cross-tabulations, and probability tests were used to validate and compare intake estimates and dietary reference intake (DRI) assessment trends between the two methods. A 369-item vegan-specific questionnaire was developed with 252 listed food frequency items. Calorie-adjusted correlation coefficients ranged from r = 0.374 to 0.600 (p vegans). This vegan-specific questionnaire can be a useful assessment tool for health screening initiatives in U.S. vegan communities. PMID:25006856

Evaluation of a validated food frequency questionnaire for self-defined vegans in the United States.

Science.gov (United States)

Dyett, Patricia; Rajaram, Sujatha; Haddad, Ella H; Sabate, Joan

2014-07-08

This study aimed to develop and validate a de novo food frequency questionnaire for self-defined vegans in the United States. Diet histories from pilot samples of vegans and a modified 'Block Method' using seven selected nutrients of concern in vegan diet patterns, were employed to generate the questionnaire food list. Food frequency responses of 100 vegans from 19 different U.S. states were obtained via completed mailed questionnaires and compared to multiple telephone-conducted diet recall interviews. Computerized diet analyses were performed. Correlation coefficients, t-tests, rank, cross-tabulations, and probability tests were used to validate and compare intake estimates and dietary reference intake (DRI) assessment trends between the two methods. A 369-item vegan-specific questionnaire was developed with 252 listed food frequency items. Calorie-adjusted correlation coefficients ranged from r = 0.374 to 0.600 (p vegans). This vegan-specific questionnaire can be a useful assessment tool for health screening initiatives in U.S. vegan communities.

19 CFR 12.142 - Entry of softwood lumber and softwood lumber products from any country into the United States.

Science.gov (United States)

2010-04-01

... purposes of paragraph (c)(1) of this section, the following definitions apply: (A) F.O.B. The term “F.O.B... Tariff Act of 1930, as amended (19 U.S.C. 1202 et seq.); and (B) To the best of the person's knowledge and belief: (1) The export price provided is determined in accordance with the definition set forth in...

Gamma-ray analysis for U, TH and K on bulk cutting samples from deep wells in the Danish subbasin and the North German basin

International Nuclear Information System (INIS)

Leth Nielsen, B.; Loevborg, L.; Soerensen, P.; Mose, E.

1987-04-01

A total of 1329 bulk cutting samples from deep wells in Denmark were analysed for U, Th and K by laboratory gamma-ray analysis. Contamination of the samples by drilling mud additives, mud solids and fall down was studied by means of a wash down experiment and by comparison with the total gamma-ray response from wire-line logging. It is concluded that the inorganic geochemistry on bulk cutting samples must be applied with great caution. The data are useful for geochemical characterization of well sections and for regional geochemical correlation. Radioelement abundance logs and radioelement ratio logs are presented from 3 wells in the Danish Subbasin and 2 wells in the North German Basin. The radioelement geochemistry is discussed for the successive lithostratigraphical units and a reference radio element profile is established for the central part of the Danish Subbasin. Finally, a model describing the relationship between common lithofacies and their U content and Th/U ratio is suggested. The model deliniates the depositional environment and the relative distances to the provenance areas. It is concluded that 1) Uranium is mobile during deposition, but since then it is fixed by stable mineral phases at depth. 2) Thorium reflects source area characteristics and that any available ions are readily adsorped by clay minerals. Thorium anomalies may thus serve as lithostratigraphical markers. 3) Potassium occurs in unstable rock forming mineral phases. The present distribution is controlled not only by the clastic mineral assemblage, but also by the diagenetic processes through geologic time. 33 refs. (author)

Gamma-ray analysis for U, Th and K on bulk cutting samples from deep wells in the Danish Subbasin and the North German Basin

International Nuclear Information System (INIS)

Lovborg, L.

1987-07-01

A total of 1329 bulk cutting samples from deep wells in Denmark were analysed for U, Th and K by laboratory gamma-ray analysis. Contamination of the samples by drilling mud additives, mud solids and fall down was studied by means of a wash down experiment and by comparison with the total gamma-ray response from wireline logging. It is concluded that the inorganic geochemistry on bulk cutting samples must be applied with great caution. The data are useful for geochemical characterization of well sections and for regional geochemical correlation. Radioelement abundance logs and radioelement ratio logs are presented from 3 wells in the Danish Subbasin and 2 wells in the North German Basin. The radioelement geochemistry is discussed for the successive lithostratigraphical units and a reference radioelement profile is established for the central part of the Danish Subbasin. Finally, a model describing the relationship between common lithofacies and their U content and Th/U ratio is suggested. The model deliniates the depositional environment and the relative distances to the provenance areas. It is concluded that: (1) Uranium is mobile during deposition, but since then it is fixed by stable mineral phases at depth; (2) Thorium reflects source area characteristics and that any available ions are readily adsorbed by clay minerals. Thorium anomalies may thus serve as lithostratigraphical markers; (3) Potassium occurs in unstable rock forming mineral phases. The present distribution is controlled not only by the clastic mineral assemblage, but also by the diagenetic processes through geologic time

Horizontal and vertical individualism and collectivism among college students in the United States, Taiwan, and Argentina.

Science.gov (United States)

Chiou, J S

2001-10-01

Among college students in the United States, Taiwan, and Argentina, the author examined the strength of 4 cultural patterns (horizontal collectivism, vertical collectivism, horizontal individualism, vertical individualism; H. C. Triandis, 1995). A 3-group confirmatory factor analysis established the measurement equivalence among the 3 samples before the comparison. The Taiwanese and the Argentine samples were more vertically collectivist than the U.S. sample. The U.S. and the Taiwanese samples were more vertically individualistic than the Argentine sample. The U.S. sample was more horizontally individualistic than the Argentine sample, which, in turn, was more horizontally individualistic than the Taiwanese sample.

78 FR 42800 - Certain Crawler Cranes and Components Thereof; Institution of Investigation Pursuant to United...

Science.gov (United States)

2013-07-17

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-887] Certain Crawler Cranes and... amended, 19 U.S.C. 1337, on behalf of Manitowoc Cranes, LLC of Manitowoc, Wisconsin. The complaint alleges... the sale within the United States after importation of certain crawler cranes and components thereof...

Measurement and resonance analysis of neutron transmissions through four samples of 238U

International Nuclear Information System (INIS)

Olsen, D.K.; de Saussure, G.; Perez, R.B.; Difilippo, F.C.; Ingle, R.W.

1977-01-01

Accurate total and partial cross sections for 238 U are important for nuclear reactor design. In the resolved resonance region, energies below 4.0 keV, these cross sections are described in terms of individual resonance parameters of which the neutron widths in the 1.5 to 4.0 keV region from various workers appear discrepant. In order to determine these widths, (0.880 to 100.0 keV) neutron transmissions through 0.076, 0.254, 1.080, and 3.620 cm thick enriched 238 U samples were measured, and (0.880 to 100.0 keV) range transmissions were analyzed

19 CFR 113.75 - Bond conditions for deferral of duty on large yachts imported for sale at United States boat shows.

Science.gov (United States)

2010-04-01

... yachts imported for sale at United States boat shows. 113.75 Section 113.75 Customs Duties U.S. CUSTOMS... Customs Bond Conditions § 113.75 Bond conditions for deferral of duty on large yachts imported for sale at....C. 1484b for a dutiable large yacht imported for sale at a United States boat show must conform to...

Corrective Action Investigation Plan for Corrective Action Unit 561: Waste Disposal Areas, Nevada Test Site, Nevada, Revision 0

International Nuclear Information System (INIS)

Grant Evenson

2008-01-01

Corrective Action Unit (CAU) 561 is located in Areas 1, 2, 3, 5, 12, 22, 23, and 25 of the Nevada Test Site, which is approximately 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 561 is comprised of the 10 corrective action sites (CASs) listed below: (1) 01-19-01, Waste Dump; (2) 02-08-02, Waste Dump and Burn Area; (3) 03-19-02, Debris Pile; (4) 05-62-01, Radioactive Gravel Pile; (5) 12-23-09, Radioactive Waste Dump; (6) 22-19-06, Buried Waste Disposal Site; (7) 23-21-04, Waste Disposal Trenches; (8) 25-08-02, Waste Dump; (9) 25-23-21, Radioactive Waste Dump; and (10) 25-25-19, Hydrocarbon Stains and Trench. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives. Additional information will be obtained by conducting a corrective action investigation before evaluating corrective action alternatives and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 28, 2008, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office; Stoller-Navarro Joint Venture; and National Security Technologies, LLC. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 561. Appendix A provides a detailed discussion of the DQO methodology and the DQOs specific to each CAS. The scope of the Corrective Action Investigation for CAU 561 includes the following activities: (1) Move surface debris and/or materials, as needed, to facilitate sampling. (2) Conduct

15 CFR 2008.19 - Classification Review Committee.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Classification Review Committee. 2008.19 Section 2008.19 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE REGULATIONS TO IMPLEMENT E.O. 12065; OFFICE OF THE UNITED...

7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.

Science.gov (United States)

2010-01-01

... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...

A situation analysis of the competitive schools based cricket coaching programmes at u/19 level in the Gauteng province

OpenAIRE

2014-01-01

M.Phil. (Sport Management) The purpose of this study was to investigate the management of cricket coaching programmes at u/19 level in the Gauteng Province. Specifically, this study attempted to determine the current situation regarding management of coaching programmes and the delivery of in-school driven programmes in the province. Data was collected from schools offering cricket as a sport from both the Gauteng Lions and Northerns Cricket Union franchises. There were 10 schools in the N...

Food Insecurity and Mental Disorders in a National Sample of U.S. Adolescents

Science.gov (United States)

McLaughlin, Katie A.; Green, Jennifer Greif; Alegria, Margarita; Costello, E. Jane; Gruber, Michael J.; Sampson, Nancy A.; Kessler, Ronald C.

2012-01-01

Objective: To examine whether food insecurity is associated with past-year "DSM-IV" mental disorders after controlling for standard indicators of family socioeconomic status (SES) in a U.S. national sample of adolescents. Method: Data were drawn from 6,483 adolescent-parent pairs who participated in the National Comorbidity Survey Replication…

31 CFR 19.1005 - State.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false State. 19.1005 Section 19.1005 Money... (NONPROCUREMENT) Definitions § 19.1005 State. (a) State means— (1) Any of the states of the United States; (2) The... States; or (5) Any agency or instrumentality of a state. (b) For purposes of this part, State does not...

Hanford Site Environmental Surveillance Master Sampling Schedule

International Nuclear Information System (INIS)

Bisping, L.E.

1999-01-01

Environmental surveillance of the Hanford Site and surrounding areas is conducted by the Pacific Northwest National Laboratory (PNNL) for the U.S. Department of Energy (DOE). Sampling is conducted to evaluate levels of radioactive and nonradioactive pollutants in the Hanford environs, as required in DOE Order 5400.1, ''General Environmental protection Program,'' and DOE Order 5400.5, ''Radiation Protection of the Public and the Environment.'' The sampling methods are described in the Environmental Monitoring Plan, United States Department of Energy, Richland Operations Office, DOE/RL-91-50, Rev.2, U.S. Department of Energy, Richland, Washington. This document contains the CY1999 schedules for the routine collection of samples for the Surface Environmental Surveillance Project (SESP) and Drinking Water Monitoring Project. Each section includes the sampling location, sample type, and analyses to be performed on the sample. In some cases, samples are scheduled on a rotating basis and may not be collected in 1999 in which case the anticipated year for collection is provided. In addition, a map is included for each media showing approximate sampling locations

[Diagnosis for human parvovirus B19-polyarthritis: usefulness of empty particle B19.ELISA and B19-DNA.PCR].

Science.gov (United States)

Hatakeyama, Y; Ishii, K; Murai, C; Sugamura, K; Mitomo, N; Saitoh, T; Rikimaru, Y; Okazaki, T; Sasaki, T

1998-10-01

To evaluate the usefulness of new ELISA for human parvovirus B19 (B19) antibodies and PCR for the diagnosis of acute onset of B19 polyarthritis. We evaluated the reproducibility and sensitivity on the detection of anti-B19 antibody by ELISA using recombinant VP-1 and VP-2 (empty particle), and then studied for the prevalence of IgM and IgG B19 antibody in 125 samples for anti-B19 tests. The random study on anti-B19 antibody assay as well as PCR for B19-DNA was also performed in 130 cases with acute onset of arthritis excluding those with known origins, 224 with rheumatoid arthritis and 149 with other categories. The results by using B19-empty particle ELISA were reproducible and showed the assay was a sensitive way for clinical use. IgM anti-B19 antibodies were positive not only in all samples from erythema infectiosum, but also often in those from hemolytic anemia, pure red cell aplasia, fetal hydrops, hepatic injury, fever of unknown origin. Among 130 with acute onset of arthritis, 21 showed positive tests for IgM anti-B19 antibody and/or B19 DNA. On the other hand, 4 among 224 patients with rheumatoid arthritis were positive for IgM anti-B19 antibody, but all of 149 in control group were negative for IgM anti-B19 antibodies and for B19 DNA. Anti-B19 ELISA using B19-empty particle which has been introduced as a routine test system, is a useful tool for the diagnosis of acute onset of B19 arthritis. An additional examination using PCR for B19 DNA may contribute for understanding persistent B19 polyarthritis or reactivation of B19 infection.

STUDY OF HOME DEMONSTRATION UNITS IN A SAMPLE OF 27 COUNTIES IN NEW YORK STATE, NUMBER 3.

Science.gov (United States)

ALEXANDER, FRANK D.; HARSHAW, JEAN

AN EXPLORATORY STUDY EXAMINED CHARACTERISTICS OF 1,128 HOME DEMONSTRATION UNITS TO SUGGEST HYPOTHESES AND SCOPE FOR A MORE INTENSIVE STUDY OF A SMALL SAMPLE OF UNITS, AND TO PROVIDE GUIDANCE IN SAMPLING. DATA WERE OBTAINED FROM A SPECIALLY DESIGNED MEMBERSHIP CARD USED IN 1962. UNIT SIZE AVERAGED 23.6 MEMBERS BUT THE RANGE WAS FAIRLY GREAT. A NEED…

78 FR 37584 - U.S. Steel Tubular Products, Inc., Mckeesport Tubular Operations Division, Subsidiary of United...

Science.gov (United States)

2013-06-21

... make the following certification: All workers of U.S. Steel Tubular Products, McKeesport Tubular... Products, Inc., Mckeesport Tubular Operations Division, Subsidiary of United States Steel Corporation, Mckeesport, Pennsylvania; Notice of Amended Certification Pursuant to Section 221 of the Trade Act of 1974...

Vapor space characterization of Waste Tank 241-U-105: Results from samples collected on 2/24/95

International Nuclear Information System (INIS)

Pool, K.H.; Clauss, T.W.; Ligotke, M.W.

1995-10-01

This report describes inorganic and organic analyses results from samples obtained from the headspace of the Hanford waste storage Tank 241-U-105 (referred to as Tank U-105). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. In addition, quantitative results were obtained for the 39 TO-14 compounds plus an additional 14 analytes. Of these, six were observed above the 5-ppbv reporting cutoff. Three tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv and are reported with concentrations that are semiquantitative estimates based on internal-standard response factors. All nine of the organic analytes identified are listed in Table 1 and account for 100% of the total organic components in Tank U-105. Nitrous oxide (N 2 O) was the only permanent gas detected in the tank-headspace sample. Tank U-105 is on the Hydrogen Watch List

75 FR 78968 - Polyethylene Terephthalate Film, Sheet, and Strip From the United Arab Emirates: Preliminary...

Science.gov (United States)

2010-12-17

... Schedule of the United States (HTSUS). While HTSUS subheadings are provided for convenience and customs... movement charges, direct selling expenses, and packing. Pursuant to 19 CFR 351.403(c), and in accordance... U.S. sales, we examine selling functions along the chain of distribution between the respondent and...

Data validation report for the 100-HR-3 Operable Unit, fifth round groundwater samples

International Nuclear Information System (INIS)

Vukelich, S.E.

1994-01-01

The data from the chemical analysis of 68 samples from the 100-HR-3 Operable Unit Third Quarter 1993 Groundwater Sampling Investigation and their related quality assurance samples were reviewed and validated to verify that reported sample results were of sufficient quality to support decisions regarding remedial actions performed at the site. Sample analysis included inorganics and general chemical parameters. Fifty three samples were validated for radiochemical parameters

Data validation report for the 100-D Ponds Operable Unit: 100-D ponds sampling

International Nuclear Information System (INIS)

Stankovich, M.T.

1994-01-01

Westinghouse-Hanford has requested that 100 percent of the Sample Delivery Groups be validated for the 100-D Ponds Operable Unit Sampling Investigation. Therefore the data from the chemical analysis of all 30 samples from this sampling event and their related quality assurance samples were reviewed and validated to verify that reported sample results were of sufficient quality to support decisions regarding remedial actions performed at this site

Archaeological data recovery at drill pad U19au, Nye County, Nevada

International Nuclear Information System (INIS)

Henton, G.H.; Pippin, L.C.

1991-01-01

Construction activities accompanying underground nuclear tests result in the disturbance of the surface terrain at the Nevada Test Site. In compliance with Federal legislation (National Historic Preservation Act of 1966 [PL 89-665] and National Environmental Policy Act of 1969 [PL 91-190]), the US Department of Energy (DOE), Field Office, Nevada, has long required that cultural resources studies must precede all land-disturbing activities on the Nevada Test Site. In accordance with 36 CFR Part 800, these studies consist of archaeological surveys conducted prior to the land-disturbing activities. The intent of these surveys is to identify and evaluate all cultural resources that might be adversely affected by the proposed construction activity. This report presents the final analysis of the data recovered from archaeological investigations conducted at the U19au drill site and access road. This report includes descriptions of the archaeological sites as recorded during the original survey, the research design used to guide the investigations, the method and techniques used to collect and analyze the data, and the results and interpretations of the analysis. 200 refs., 112 figs., 53 tabs

Archaeological data recovery at drill pad U19au, Nye County, Nevada

Energy Technology Data Exchange (ETDEWEB)

Henton, G.H.; Pippin, L.C.

1991-01-01

Construction activities accompanying underground nuclear tests result in the disturbance of the surface terrain at the Nevada Test Site. In compliance with Federal legislation (National Historic Preservation Act of 1966 (PL 89-665) and National Environmental Policy Act of 1969 (PL 91-190)), the US Department of Energy (DOE), Field Office, Nevada, has long required that cultural resources studies must precede all land-disturbing activities on the Nevada Test Site. In accordance with 36 CFR Part 800, these studies consist of archaeological surveys conducted prior to the land-disturbing activities. The intent of these surveys is to identify and evaluate all cultural resources that might be adversely affected by the proposed construction activity. This report presents the final analysis of the data recovered from archaeological investigations conducted at the U19au drill site and access road. This report includes descriptions of the archaeological sites as recorded during the original survey, the research design used to guide the investigations, the method and techniques used to collect and analyze the data, and the results and interpretations of the analysis. 200 refs., 112 figs., 53 tabs.

12 CFR 19.10 - Filing of papers.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Filing of papers. 19.10 Section 19.10 Banks and... Rules of Practice and Procedure § 19.10 Filing of papers. (a) Filing. Any papers required to be filed...) Delivering the papers to a reliable commercial courier service, overnight delivery service, or to the U.S...

Hanford Site Environmental Surveillance Master Sampling Schedule

International Nuclear Information System (INIS)

Bisping, L.E.

2000-01-01

Environmental surveillance of the Hanford Site and surrounding areas is conducted by the Pacific Northwest National Laboratory (PNNL) for the U.S. Department of Energy (DOE). Sampling is conducted to evaluate levels of radioactive and nonradioactive pollutants in the Hanford environs, as required in DOE Order 5400.1, General Environmental Protection Program: and DOE Order 5400.5, Radiation Protection of the Public and the Environment. The sampling design is described in the Operations Office, Environmental Monitoring Plan, United States Department of Energy, Richland DOE/RL-91-50, Rev.2, U.S. Department of Energy, Richland, Washington. This document contains the CY 2000 schedules for the routine collection of samples for the Surface Environmental Surveillance Project (SESP) and Drinking Water Monitoring Project. Each section includes sampling locations, sample types, and analyses to be performed. In some cases, samples are scheduled on a rotating basis and may not be collected in 2000 in which case the anticipated year for collection is provided. In addition, a map showing approximate sampling locations is included for each media scheduled for collection

Hydrogen and fluorine in the surfaces of lunar samples

International Nuclear Information System (INIS)

Leich, D.A.; Goldberg, R.H.; Burnett, D.S.; Tombrello, T.A.

1974-04-01

The resonant nuclear reaction F-19 (p, alpha gamma)O-16 was used to perform depth sensitive analyses for both fluorine and hydrogen in lunar samples. The resonance at 0.83 MeV (center-of-mass) in this reaction was applied to the measurement of the distribution of trapped solar protons in lunar samples to depths of about 1 / 2 micrometer. These results are interpreted in terms of terrestrial H 2 O surface contamination and a redistribution of the implanted solar H which has been influenced by heavy radiation damage in the surface region. Results are also presented for an experiment to test the penetration of H 2 O into laboratory glass samples which have been irradiated with O-16 to simulate the radiation damaged surfaces of lunar glasses. Fluorine determinations were performed in a 1 pm surface layer on lunar samples using the same F-19(alpha gamma)O-16 resonance. The data are discussed from the standpoint of lunar fluorine and Teflon contamination. (U.S.)

Heel blood sampling in European neonatal intensive care units: compliance with pain management guidelines

DEFF Research Database (Denmark)

Losacco, Valentina; Cuttini, Marina; Greisen, Gorm

2011-01-01

Objective To describe the use of heel blood sampling and non-pharmacological analgesia in a large representative sample of neonatal intensive care units (NICUs) in eight European countries, and compare their self-reported practices with evidence-based recommendations. Methods Information on use...... of heel blood sampling and associated procedures (oral sweet solutions, non-nutritive sucking, swaddling or positioning, topical anaesthetics and heel warming) were collected through a structured mail questionnaire. 284 NICUs (78% response rate) participated, but only 175 with >/=50 very low birth weight...... admissions per year were included in this analysis. Results Use of heel blood sampling appeared widespread. Most units in the Netherlands, UK, Denmark, Sweden and France predominantly adopted mechanical devices, while manual lance was still in use in the other countries. The two Scandinavian countries...

The United Nations disarmament yearbook. V. 19: 1994

International Nuclear Information System (INIS)

1995-01-01

The United Nations Disarmament Yearbook contains a review of the main developments and negotiations in the field of disarmament taking place each year, together with a brief history of the major issues. The series began with the 1976 edition. The Yearbook makes no claim to present fully the views of Member States of the Organization. For further information on the official positions of States, readers should consult the Official Records of the General Assembly and other sources. General Assembly resolutions and decisions are quoted in The Yearbook in the form in which they were adopted by the General Assembly. For the edited texts of these documents for 1994, readers should consult the Official Records of the General Assembly, Forty-ninth Session, Supplement No. 49 (A/49/49). For an overview of the work of the United Nations in the field of disarmament, one should consult The United Nations and Disarmament: A short History (UN, 1988). A more detailed account is included in The United Nations and Disarmament: 1945-1970; United Nations and Disarmament: 1970-1975, and previous volumes of The United Nations Disarmament Yearbook

U.S. Geological Survey Noble Gas Laboratory’s standard operating procedures for the measurement of dissolved gas in water samples

Science.gov (United States)

Hunt, Andrew G.

2015-08-12

This report addresses the standard operating procedures used by the U.S. Geological Survey’s Noble Gas Laboratory in Denver, Colorado, U.S.A., for the measurement of dissolved gases (methane, nitrogen, oxygen, and carbon dioxide) and noble gas isotopes (helium-3, helium-4, neon-20, neon-21, neon-22, argon-36, argon-38, argon-40, kryton-84, krypton-86, xenon-103, and xenon-132) dissolved in water. A synopsis of the instrumentation used, procedures followed, calibration practices, standards used, and a quality assurance and quality control program is presented. The report outlines the day-to-day operation of the Residual Gas Analyzer Model 200, Mass Analyzer Products Model 215–50, and ultralow vacuum extraction line along with the sample handling procedures, noble gas extraction and purification, instrument measurement procedures, instrumental data acquisition, and calculations for the conversion of raw data from the mass spectrometer into noble gas concentrations per unit mass of water analyzed. Techniques for the preparation of artificial dissolved gas standards are detailed and coupled to a quality assurance and quality control program to present the accuracy of the procedures used in the laboratory.

19 CFR 122.167 - Aviation smuggling.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Aviation smuggling. 122.167 Section 122.167... TREASURY AIR COMMERCE REGULATIONS Penalties § 122.167 Aviation smuggling. (a) Civil penalties. Any aircraft.... More severe penalties are provided in 19 U.S.C. 1590 if the smuggled merchandise is a controlled...

Evaluation of daily intake of 238U and 232Th in a Korean mixed diet sample using RNAA

International Nuclear Information System (INIS)

Chung, Yong Sam; Moon, Jong Hwa; Kim, Sun Ha; Park, Kwang Won; Kang, Sang Hoon; Cho, Seung Yeon

2000-01-01

To estimate the degree of intake of 238 U and 232 Th through daily diet, a Korean mixed diet sample was prepared after the investigation of the amount of consumption of the daily diet which corresponds to the age of 20 to 60 years. For the analysis of U and Th, the RNAA method was applied. Two standard reference materials were used for quality control and assurance and the analytical results were compared with a certified value. The determination of U and Th in the Korean mixed diet sample was carried out under the same analytical conditions and procedures with SRM. It is found that the concentration of U and Th in a Korean mixed diet was about 35.4 ppb and 3.4 ppb. From these results, the daily intake of 238 U and 232 Th by diet is evaluated to be 6.98 and 0.67 μg per day, respectively. Radioactivities related to the intake of 238 U and 232 Th were estimated to be about 86 mBq per person per day and the annual dose equivalents from 238 U and 232 Th revealed as 3.18 μSv and 0.29 μSv per person, respectively

June 2012 Groundwater Sampling at the Central Nevada Test Area (Data Validation Package)

International Nuclear Information System (INIS)

2013-01-01

The U.S. Department of Energy Office of Legacy Management conducted annual sampling at the Central Nevada Test Area (CNTA) on June 26-27, 2012, in accordance with the 2004 Correction Action Decision Document/Corrective Action Plan for Corrective Action Unit 443: Central Nevada Test Area (CNTA)-Subsurface and the addendum to the 'Corrective Action Decision Document/Corrective Action Plan' completed in 2008. Sampling and analysis were conducted as specified in the Sampling and Analysis Plan for U.S. Department of Energy Office of Legacy Management Sites (LMS/PLN/S04351), continually updated).

May 2011 Groundwater Sampling at the Central Nevada Test Area (Data Validation Package)

International Nuclear Information System (INIS)

2011-01-01

The U.S. Department of Energy Office of Legacy Management conducted annual sampling at the Central Nevada Test Area (CNTA) on May 10-11, 2011, in accordance with the 2004 Correction Action Decision Document/Corrective Action Plan for Corrective Action Unit 443: Central Nevada Test Area (CNTA)-Subsurface and the addendum to the 'Corrective Action Decision Document/Corrective Action Plan' completed in 2008. Sampling and analysis were conducted as specified in the Sampling and Analysis Plan for U.S. Department of Energy Office of Legacy Management Sites (LMS/PLN/S04351), continually updated)

Heterogeneity in the 238U/235U Ratios of Angrites.

Science.gov (United States)

Tissot, F.; Dauphas, N.; Grove, T. L.

2016-12-01

Angrites are differentiated meteorites of basaltic composition, of either volcanic or plutonic origin, that display minimal post-crystallization alteration, metamorphism, shock or impact brecciation. Because quenched angrites cooled very rapidly, all radiochronometric systems closed simultaneously in these samples. Quenched angrites are thus often used as anchors for cross-calibrating short-lived dating methods (e.g., 26Al-26Mg) and the absolute dating techniques (e.g, Pb-Pb). Due to the constancy of the 238U/235U ratio in natural samples, Pb-Pb ages have long been calculated using a "consensus" 238U/235U ratio, but the discovery of resolvable variations in the 238U/235U ratio of natural samples, means that the U isotopic composition of the material to date also has to be determined in order to obtain high-precision Pb-Pb ages. We set out (a) to measure at high-precision the 238U/235U ratio of a large array of angrites to correct their Pb-Pb ages, and (b) to identify whether all angrites have a similar U isotopic composition, and, if not, what were the processes responsible for this variability. Recently, Brennecka & Wadhwa (2012) suggested that the angrite-parent body had a homogeneous 238U/235U ratio. They reached this conclusion partly because they propagated the uncertainties of the U isotopic composition of the various U double spikes that they used onto the final 238U/235U ratio the sample. Because this error is systematic (i.e., it affects all samples similarly), differences in the δ238U values of samples corrected by the same double spike are better known than one would be led to believe if uncertainties on the spike composition are propagated. At the conference, we will present the results of the high-precision U isotope analyses for six angrite samples: NWA 4590, NWA 4801, NWA 6291, Angra dos Reis, D'Orbigny, and Sahara 99555. We will show that there is some heterogeneity in the δ238U values of the angrites and will discuss the possible processes by

The Association between Mental Health and Violence among a Nationally Representative Sample of College Students from the United States.

Science.gov (United States)

Schwartz, Joseph A; Beaver, Kevin M; Barnes, J C

2015-01-01

Recent violent attacks on college campuses in the United States have sparked discussions regarding the prevalence of psychiatric disorders and the perpetration of violence among college students. While previous studies have examined the potential association between mental health problems and violent behavior, the overall pattern of findings flowing from this literature remain mixed and no previous studies have examined such associations among college students. The current study makes use of a nationally representative sample of 3,929 college students from the National Epidemiologic Study on Alcohol and Related Conditions (NESARC) to examine the prevalence of seven violent behaviors and 19 psychiatric disorder diagnoses tapping mood, anxiety, personality, and substance use disorders. Associations between individual and composite psychiatric disorder diagnoses and violent behaviors were also examined. Additional analyses were adjusted for the comorbidity of multiple psychiatric diagnoses. The results revealed that college students were less likely to have engaged in violent behavior relative to the non-student sample, but a substantial portion of college students had engaged in violent behavior. Age- and sex-standardized prevalence rates indicated that more than 21% of college students reported at least one violent act. In addition, more than 36% of college students had at least one diagnosable psychiatric disorder. Finally, the prevalence of one or more psychiatric disorders significantly increased the odds of violent behavior within the college student sample. These findings indicate that violence and psychiatric disorders are prevalent on college campuses in the United States, though perhaps less so than in the general population. In addition, college students who have diagnosable psychiatric disorders are significantly more likely to engage in various forms of violent behavior.

19 CFR 19.15 - Withdrawal for exportation of articles manufactured in bond; waste or byproducts for consumption.

Science.gov (United States)

2010-04-01

... manufactured in bond; waste or byproducts for consumption. 19.15 Section 19.15 Customs Duties U.S. CUSTOMS AND... exportation of articles manufactured in bond; waste or byproducts for consumption. (a) Except cigars... may be withdrawn from the warehouse for consumption under Customs Form 7501 upon payment of the duties...

The influence of the nature of soil and plant and pollution on the 238U, 232Th, 222Rn and 220Rn concentrations in various natural honey samples using nuclear track detectors: impact on the adult consumers

International Nuclear Information System (INIS)

Misdaq, M.A.; Mortassim, A.

2009-01-01

238 U and 232 Th concentrations as well as 222 Rn and 220 Rn α-activities per unit volume were measured in various natural honey samples collected from different regions in Morocco using CR-39 and LR-115 type II solid state nuclear track detectors (SSNTDs). These radionuclides were also measured in soils, plant flowers and nectar solutions corresponding to the honey samples studied. In addition, these radionuclides were measured in different imported honey samples. The measured 238 U, 232 Th, 222 Rn and 220 Rn concentrations ranged from (1.5 ± 0.1) mBq kg -1 to (10.6 ± 0.6) mBq kg -1 , (1.1 ± 0.1) mBq kg -1 to (4.2 ± 0.2) mBq kg -1 , (1.5 ± 0.1) Bq kg -1 to (10.6 ± 0.6) Bq kg -1 and (1.1 ± 0.1) Bq kg -1 to (4.2 ± 0.2) Bq kg -1 for the honey samples studied, respectively. Annual 238 U, 232 Th and 222 Rn intakes by Moroccan adults from the consumption of honey were assessed. The influence of the nature of soil and plant on the 238 U and 232 Th contents of the studied honey samples was investigated. These measurements were completed by an investigation of the 238 U and 232 Th transfer between soils and plant flowers and that between plant flowers and honey, and also by the investigation of the influence of pollution due to different material dusts on 238 U, 232 Th and 222 Rn in the honey samples studied. Committed equivalent doses due to the annual intake of 238 U, 232 Th and 222 Rn were evaluated in the organs of adult members of the Moroccan rural population from the ingestion of the honey samples. The maximum total committed effective dose due to 238 U, 232 Th and 222 Rn from the ingestion of natural honey by the Moroccan rural population was found to be equal to 0.64 μSνy -1 . (author)

19 CFR 191.173 - Imported duty-paid derivatives (no manufacture).

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Imported duty-paid derivatives (no manufacture). 191.173 Section 191.173 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... § 191.173 Imported duty-paid derivatives (no manufacture). When the basis for drawback under 19 U.S.C...

Headspace vapor characterization of Hanford waste tank 241-U-108: Results from samples collected on 8/29/95

International Nuclear Information System (INIS)

Thomas, B.L.; Clauss, T.W.; Evans, J.C.; McVeety, B.D.; Pool, K.H.; Olsten, K.B.; Fruchter, J.S.; Ligotke, M.W.

1996-05-01

This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-U-108 (Tank U-108) at the Hanford Site in Washington State. The results described in the report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC

Tank 241-U-104 headspace gas and vapor characterization results from samples collected on July 16, 1996

International Nuclear Information System (INIS)

Pool, K.H.; Evans, J.C.; Hayes, J.C.; Mitroshkov, A.V.; Edwards, J.A.; Julya, J.L.; Thornton, B.M.; Fruchter, J.S.; Silvers, K.L.

1997-08-01

This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-U-104 (Tank U-104) at the Hanford Site in Washington State. Tank headspace samples collected by Westinghouse Hanford Company (WHC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by WHC. No analytes were determined to be above the immediate notification limits specified by the sampling and analysis plan. None of the flammable constituents were present at concentrations above the analytical instrument detection limits. Total headspace flammability was estimated to be <0.108% of the lower flammability limit. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in a table. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0

Unraveling the tectonic evolution of a Neoproterozoic-Cambrian active margin in the Ribeira Orogen (Se Brazil): U-Pb and Lu-Hf provenance data

Energy Technology Data Exchange (ETDEWEB)

Fernandes, Gabriel Lamounier de F. [Servico Geologico do Estado do Rio de Janeiro (DRM-RJ), Niteroi, RJ (Brazil); Schmitt, Renata; Bongiolo, Everton M.; Mendes, Julio [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil); Basei, Miguel S. [Universidade de Sao Paulo (USP), SP (Brazil)

2015-07-01

Full text: The Neoproterozoic-Ordovician Central Ribeira Orogen, in SE Brazil, presents two contrasting tectonic domains in its southern portion: (a) The Arc Domain constituted of Neoproterozoic to Paleozoic magmatic rocks and low P-high T metamorphic para (Sao Fidelis Group) - and ortho- derived units (in Oriental Terrane); and (b) The Basement Domain, constituted of a Paleoproterozoic and Neoproterozoic medium P-high T metamorphic para (Palmital-Buzios Succession)- and ortho-derived units (in Cabo Frio Tectonic Domain). Our work focuses on paraderived rocks sequences from both domains. The provenance analysis using U-Pb and Lu-Hf in zircon grains is presented here as an effective tool to unravel the paleogeography and nature of the pre-collisional sedimentary basins. We performed 505 analyses (U-Pb) on detrital zircon grains and some metamorphic overgrowths from six paragneiss samples. Besides, 141 analyses (Lu-Hf) in six samples only on the detrital zircon grains domains. All samples present a main peak from Neoproterozoic sources (750-570 Ma) and the other minor peak in the Stenian/Tonian periods (1200-850Ma), this indicate an orogenic contribution for this basin. Scarce register from the Mesoproterozoic and two peaks in the Archean/Paleoproterozoic (2.6 and 1.9 Ga) are recognized as a contribution from an ancient continent. The Lu-Hf data reveals a juvenile source for the detrital zircon grains from Buzios Succession while Palmital and Sao Fidelis Group units show a main crustal signature for their detrital zircon population. Based on the U-Pb and Lu-Hf data presented here, plus petrological data, geological correlations, and compilation of data from literature, we propose a tectonic model for the origin of para-derived rocks from the eastern part of the Ribeira Orogen. Starting with an extensional environment of ca. 600 Ma in a back-arc basin (Buzios succession deposition) and continuing as an active margin between 570 and 550 Ma in the fore-arc and prism

Reduced interaction layer growth of U-Mo dispersion in Al-Si

Energy Technology Data Exchange (ETDEWEB)

Kim, Yeon Soo, E-mail: yskim@anl.gov [Argonne National Laboratory, 9700 South Cass Avenue, Argonne, IL 60439 (United States); Park, Jong Man; Ryu, Ho Jin; Jung, Yang Hong [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseong, Daejeon 305-353 (Korea, Republic of); Hofman, G.L. [Argonne National Laboratory, 9700 South Cass Avenue, Argonne, IL 60439 (United States)

2012-11-15

Development of high U-density U-Mo fuel particle dispersion in Al is needed to convert high power research and test reactors from HEU to LEU. Interaction layer growth between U-Mo and Al poses a challenge to this goal. The KOMO-4 test was designed at KAERI and irradiated in the HANARO reactor to {approx}50% burnup of initial 19.75% U-235 enrichment at {approx}200 Degree-Sign C. The main objective of the test was to examine the effect of the Si content in the matrix up to 8 wt.%. U-Mo/Al-Si dispersion samples with a Si addition in the range 0-8 wt.% in the matrix were tested. A sample with pre-irradiation Si-containing interaction layers (ILs) was also tested. As the Si content in the matrix increases, the IL growth was progressively reduced. Contrary to the thermodynamics prediction and out-of-pile observations, however, Si accumulation in the ILs occurred near the IL-matrix interface with only a slight increase in concentration. The effect of the pre-formed ILs was insignificant in reducing IL growth.

19 CFR Appendix C to Part 113 - Bond for Deferral of Duty on Large Yachts Imported for Sale at United States Boat Shows

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Bond for Deferral of Duty on Large Yachts Imported... Appendix C to Part 113—Bond for Deferral of Duty on Large Yachts Imported for Sale at United States Boat Shows Bond for Deferral of Duty on Large Yachts Imported for Sale at United States Boat Shows ____, as...

200-UP-2 Operable Unit technical baseline report

International Nuclear Information System (INIS)

Deford, D.H.

1991-02-01

This report is prepared in support of the development of a Remedial Investigation/Feasibility Study (RI/FS) Work Plan for the 200-UP-2 Operable Unit by EBASCO Environmental, Incorporated. It provides a technical baseline of the 200-UP-2 Operable Unit and results from an environmental investigation undertaken by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The 200-UP-2 Operable Unit Technical Baseline Report is based on review and evaluation of numerous Hanford Site current and historical reports, Hanford Site drawings and photographs and is supplemented with Hanford Site inspections and employee interviews. No field investigations or sampling were conducted. Each waste site in the 200-UP-2 Operable Unit is described separately. Close relationships between waste units, such as overflow from one to another, are also discussed. The 200-UP-2 Operable Unit consists of liquid-waste disposal sites in the vicinity of, and related to, U Plant operations in the 200 West Area of the Hanford Site. The ''U Plant'' refers to the 221-U Process Canyon Building, a chemical separations facility constructed during World War 2. It also includes the Uranium Oxide (UO 3 ) Plant, which was constructed at the same time and, like the 221-U Process Canyon Building, was later converted for other missions. Waste sites in the 200-UP-2 Operable Unit are associated with the U Plant Uranium Metal Recovery Program mission that occurred between 1952 and 1958 and the UO 3 Plant's ongoing uranium oxide mission and include one or more cribs, reverse wells, french drains, septic tanks and drain fields, trenches, catch tanks, settling tanks, diversion boxes, waste vaults, and the lines and encasements that connect them. 11 refs., 1 tab

Determination of U and Th α-emitters in NORM samples through extraction chromatography by using new and recycled UTEVA resins

International Nuclear Information System (INIS)

Casacuberta, N.; Lehritani, M.; Mantero, J.; Masqué, P.; Garcia-Orellana, J.; Garcia-Tenorio, R.

2012-01-01

This manuscript describes a protocol for the determination of U and Th isotopes via alpha spectrometry in NORM samples containing high concentrations of these radionuclides, up to kBq kg −1 . This technique is based on extraction chromatography with UTEVA (Triskem Int.) resins and it has been tested using both NORM samples from a phosphate industry and reference materials. The results proved that this method is highly optimized in terms of accuracy and precision when dealing with NORM samples. Recycling of UTEVA columns was also checked using NORM samples and successful results were obtained for both U and Th isotopes, thus proving the feasibility of re-using these type of columns. - Highlights: ► U and Th isotopes in NORM samples are determined via alpha spectrometry. ► The results show a highly optimized data in terms of accuracy and precision. ► Recycling of UTEVA columns was also checked and successful results were obtained.

The main conditions ensured problemless implementation of 235U high enriched fuel in Kozloduy NPP (Bulgaria) - WWER-1000 Units

International Nuclear Information System (INIS)

Dobrevski, I.; Zaharieva, N.; Minkova, K.; Michaylov, G.; Penev, P.; Gerchev, N.

2009-01-01

The collected water chemistry and radiochemistry data during the operation of the Kozloduy NPP Unit 5 for the period 2006-2009 (12-th, 13-th 14-th and 15-th fuel cycles) undoubtedly indicate for WWER-1000 Units (whose specific features are: Steam generators with austenitic stainless steel 08Cr18N10T tubing; Steam generators are with horizontal straight tubing and Fuel elements cladding material is Zr-1%Nb (Zr1Nb) alloy), that one realistic way for problemless implementation of 235 U high enriched fuel have been found. The main feature characteristics of this way are: Implementation of solid neutron burnable absorbers together with the dissolved in coolant neutron absorber - natural boric acid; Application of fuel cladding materials with enough corrosion resistance by the specific fuel cladding environment created by presence of SNB; Keeping of suitable coolant water chemistry which ensures low corrosion rates of core- and out-of-core- materials and limits in core (cladding) depositions and restricts out-of-core radioactivity buildup. The realization of this way in WWER-1000 Units in Kozloduy NPP was practically carried out through: 1) Implementation of Russian fuel assemblies TVSA which have as fuel cladding material E-110 alloy (Zr1Nb) with enough high corrosion resistance by presence of sub-cooled nucleate boiling (SNB) and use burnable absorber (Gd) integrated in the uranium-gadolinium (U-Gd 2 O 3 ) fuel (fuel rod with 5.0% Gd 2 O 3 ); 2) Development and implementation of water chemistry primary circuit guidelines, which require the relation between boric acid concentration and total alkalising agent concentrations to ensure coolant pH 300 = 7.0 - 7.2 values during the whole operation period. The above mentioned conditions by the passing of WWER-1000 Units in NPP Kozloduy to uranium fuel with 4.4% 235 U (TVSA fuel assemblies) practically ensured avoidance of the creation of the necessary conditions for AOA onset. The operational experience (2006-2009) of the

Investigate the capability of INAA absolute method to determine the concentrations of 238U and 232Th in rock samples

International Nuclear Information System (INIS)

Alnour, I.A.

2014-01-01

This work aimed to study the capability of INAA absolute method in determining the elemental concentration of 238 U and 232 Th in the rock samples. The INAA absolute method was implemented in PUSPATI TRIGA Mark II research reactor, Malaysian Nuclear Agency (NM). The accuracy of INAA absolute method was performed by analyzing the IAEA certified reference material (CRM) Soil-7. The analytical results showed the deviations between experimental and certified values were mostly less than 10 % with Z-score in most cases less than 1. In general, the results of analysed CRM Soil-7 show a good agreement between certified and experimental results which mean that the INAA absolute method can be used accurately for elemental analysis of uranium and thorium in various types of samples. The concentration of 238 U and 232 Th ranged from 1.77 to 24.25 and 0.88 to 95.50 ppm respectively. The highest value of 238 U and 232 Th was recorded for granite rock sample G17 of 238 U and sample G9 of 232 Th, whereas the lower value was 1.77 ppm of 238 U recorded in sandstone rock and 0.88 ppm of 232 Th for gabbro. Moreover, a comparison of the 238 U and 232 Th results obtained by the INAA absolute method shows an acceptable level of consistency with those obtained by the INAA relative method. (author)

Vapor space characterization of Waste Tank 241-U-107: Results from samples collected on 2/17/95

International Nuclear Information System (INIS)

McVeety, B.D.; Clauss, T.W.; Ligotke, M.W.

1995-10-01

This report describes inorganic and organic analyses results from samples obtained from the headspace of the Hanford waste storage Tank 241-U-107 (referred to as Tank U-107). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. In addition, quantitative results were obtained for the 39 TO-14 compounds plus an additional 14 analytes. Of these, 10 were observed above the 5-ppbv reporting cutoff. Sixteen organic tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv, and are reported with concentrations that are semiquantitative estimates based on internal-standard response factors. The 10 organic analytes with the highest estimated concentrations are listed in Table 1 and account for approximately 88% of the total organic components in Tank U-107. Nitrous oxide (N 2 O) was the only permanent gas detected in the tank-headspace samples. Tank U-107 is on the Organic and the Hydrogen Watch Lists

19 CFR 4.69 - Shipping articles.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Shipping articles. 4.69 Section 4.69 Customs... VESSELS IN FOREIGN AND DOMESTIC TRADES Foreign Clearances § 4.69 Shipping articles. No vessel of the U.S... officer, of the shipping articles agreements, including any seaman's allotment agreement, required by 46 U...

Design of fuel loading for Bohunice V-1 Unit 2 reaktor for fuel cycle No.19

International Nuclear Information System (INIS)

Majercik, J.

1998-01-01

The report contains description of the design of fuel loading for the fuel cycle No. 19 in the V-1 Bohunice Unit 2 reactor. Input data and computer codes used for the development of the design are shown. The fuel loading is characterized by the assortment of the fuel loaded and by the scheme of re shuffling of assemblies in the core. An evaluation of basic neutronic core parameters as relates to the compliance with safety criteria is a part of the report as well

First annual report RCRA post-closure monitoring and inspections for the U-3fi waste unit. Final report, July 1995--October 1996

International Nuclear Information System (INIS)

Emer, D.F.

1997-01-01

This annual Neutron Soil Moisture Monitoring report provides an analysis and summary for site inspections, meteorological information, and neutron soil moisture monitoring data obtained at the U-3fi RCRA Unit, located in Area 3 of the Nevada Site (NTS), Nye County, Nevada during the July 1995 to October 1996 period. Inspections of the U-3fi RCRA Unit are conducted to determine and document the physical condition of the covers, facilities, and any unusual conditions that could impact the proper operation of the waste unit closure. The objective of the neutron logging is to monitor the soil moisture conditions along the 420 ft ER3-3 borehole and detect changes that may be indicative of moisture movement in the regulated interval. This is the first annual report on the U-3fi closure and includes the first year baseline monitoring data as well as one quarter of compliance monitoring data

Preparation of 235mU targets for 235U(n,n')235mU cross section measurements

International Nuclear Information System (INIS)

Bond, E.M.; Vieira, D.J.; Rundberg, R.S.; Glover, S.; Hynek, D.; Jansen, Y.; Becker, J.; Macri, R.

2008-01-01

This paper describes the preparation of samples for an experiment to measure the cross-section for 235 U(n,n') 235m U in a fast fission spectrum of neutrons provided by a fast pulsed reactor/critical assembly. Samples of 235m U have been prepared for the calibration of the internal conversion electron detector that is used for the 235m U measurement. Two methods are described for the preparation of 235 mU. The first method used a U-Pu chemical separation based on anion-exchange chromatography and the second method used an alpha recoil collection method. Thin, uniform samples of 235m U+ 235 U were prepared for the experiment using electrodeposition. (author)

January 2011 Groundwater Sampling at the Gnome-Coach, New Mexico, Site (Data Validation Package)

International Nuclear Information System (INIS)

2011-01-01

Annual sampling was conducted January 19, 2011, to monitor groundwater for potential radionuclide contamination at the Gnome-Coach site in New Mexico. The sampling was performed as specified in the Sampling and Analysis Plan for U.S. Department of Energy Office of Legacy Management Sites (LMS/PLN/S04351, continually updated). Well LRL-7 was not sampled per instruction from the lead. A duplicate sample was collected from well USGS-1.Water levels were measured in the monitoring wells onsite.

Corrective Action Investigation Plan for Corrective Action Unit 561: Waste Disposal Areas, Nevada Test Site, Nevada with ROTC 1, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Grant Evenson

2008-07-01

Corrective Action Unit (CAU) 561 is located in Areas 1, 2, 3, 5, 12, 22, 23, and 25 of the Nevada Test Site, which is approximately 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 561 is comprised of the 10 corrective action sites (CASs) listed below: • 01-19-01, Waste Dump • 02-08-02, Waste Dump and Burn Area • 03-19-02, Debris Pile • 05-62-01, Radioactive Gravel Pile • 12-23-09, Radioactive Waste Dump • 22-19-06, Buried Waste Disposal Site • 23-21-04, Waste Disposal Trenches • 25-08-02, Waste Dump • 25-23-21, Radioactive Waste Dump • 25-25-19, Hydrocarbon Stains and Trench These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives. Additional information will be obtained by conducting a corrective action investigation before evaluating corrective action alternatives and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 28, 2008, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office; Stoller-Navarro Joint Venture; and National Security Technologies, LLC. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 561. Appendix A provides a detailed discussion of the DQO methodology and the DQOs specific to each CAS. The scope of the Corrective Action Investigation for CAU 561 includes the following activities: • Move surface debris and/or materials, as needed, to facilitate sampling. • Conduct radiological surveys

32 CFR 536.19 - Disaster claims planning.

Science.gov (United States)

2010-07-01

... 32 National Defense 3 2010-07-01 2010-07-01 true Disaster claims planning. 536.19 Section 536.19... AGAINST THE UNITED STATES The Army Claims System § 536.19 Disaster claims planning. All ACOs will prepare... requirements related to disaster claims planning. ...

Advantages of conducting in-situ U-Pb age dating of multiple U-bearing minerals from a single complex: Case in point - the Oka Carbonatite Complex

Science.gov (United States)

Chen, W.; Simonetti, A.

2012-12-01

A detailed radiometric investigation is currently underway focusing on U-bearing accessory minerals apatite, perovskite, and niocalite from the Oka Carbonatite Complex (Canada). One of the main objectives is to obtain a comparative chronology of melt crystallization for the complex. Unlike other commonly adopted U-bearing minerals (e.g., zircon, monazite) for in-situ dating investigations, apatite, perovskite, and niocalite contain relatively high contents of common Pb. Hence, careful assessment of the proportion and composition of the common Pb, and usage of appropriate matrix-matched external standards are imperative. The Madagascar apatite was utilized as the external standard for apatite dating, and the Emerald Lake and Durango apatites were adopted as secondary standards; the latter yield ages of 92.6 ±1.8 and 32.2 ±1.1 Ma, respectively, and these are identical to their accepted ages. Pb/U ages for apatite from Oka were obtained for different rock types, including 8 carbonatites, 4 okaites, 3 ijolites and 3 alnoites, and these define a range of ages between ~105 and ~135 Ma; this result suggests a protracted crystallization history. In total, 266 individual analyses define two peaks at ~115 and ~125Ma. For perovskite dating, the Ice River perovskite standard was utilized as the external standard. The perovskites from one okaite sample yield an age of 112.2 ±1.9 Ma, and is much younger than the previously reported U-Pb perovskite age of 131 ±7 Ma. Hence, the combined U-Pb perovskite ages also suggest a rather prolonged time of melt crystallization. Niocalite is a rare, accessory silicate mineral that occurs within the carbonatites at Oka. The international zircon standard BR266 was selected for use as the external standard and rastering was employed to minimize the Pb-U fractionation. Two niocalite samples give young ages at 110.6 ±1.2 and 115.0 ±1.9 Ma, and are identical to their respective apatite ages (given associated uncertainties) from the same

27 CFR 19.68 - Other businesses.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Other businesses. 19.68... Activities Not Subject to This Part § 19.68 Other businesses. The appropriate TTB officer may authorize the carrying on of other businesses (not specifically prohibited by 26 U.S.C. 5601(a)(6)) on premises of plants...

Implementation of Cell Samples as Controls in National Proficiency Testing for Clopidogrel Therapy-Related CYP2C19 Genotyping in China: A Novel Approach.

Directory of Open Access Journals (Sweden)

Guigao Lin

Full Text Available Laboratories are increasingly requested to perform CYP2C19 genetic testing when managing clopidogrel therapy, especially in patients with acute coronary syndrome undergoing percutaneous coronary intervention. To ensure high quality molecular testing and ascertain that the referring clinician has the correct information for CYP2C19 genotype-directed antiplatelet therapy, a proficiency testing scheme was set up to evaluate the laboratory performance for the entire testing process. Proficiency panels of 10 cell samples encompassing the common CYP2C19 genetic polymorphisms were distributed to 62 participating laboratories for routine molecular testing and the responses were analyzed for accuracy of genotyping and the reporting of results. Data including the number of samples tested, the accreditation/certification status, and test methodology of each individual laboratory were also reviewed. Fifty-seven of the 62 participants correctly identified the CYP2C19 variants in all samples. There were six genotyping errors, with a corresponding analytical sensitivity of 98.5% (333/338 challenges; 95% confidence interval: 96.5-99.5% and an analytic specificity of 99.6% (281/282; 95% confidence interval: 98.0-99.9%. Reports of the CYP2C19 genotyping results often lacked essential information. In conclusion, clinical laboratories demonstrated good analytical sensitivity and specificity; however, the pharmacogenetic testing community requires additional education regarding the correct reporting of CYP2C19 genetic test results.

Study on Quantification for Multi-unit Seismic PSA Model using Monte Carlo Sampling

International Nuclear Information System (INIS)

Oh, Kyemin; Han, Sang Hoon; Jang, Seung-cheol; Park, Jin Hee; Lim, Ho-Gon; Yang, Joon Eon; Heo, Gyunyoung

2015-01-01

In existing PSA, frequency for accident sequences occurred in single-unit has been estimated. While multi-unit PSA has to consider various combinations because accident sequence in each units can be different. However, it is difficult to quantify all of combination between inter-units using traditional method such as Minimal Cut Upper Bound (MCUB). For this reason, we used Monte Carlo sampling as a method to quantify multi-unit PSA model. In this paper, Monte Carlo method was used to quantify multi-unit PSA model. The advantage of this method is to consider all of combinations by the increase of number of unit and to calculate nearly exact value compared to other method. However, it is difficult to get detailed information such as minimal cut sets and accident sequence. To solve partially this problem, FTeMC was modified. In multi-unit PSA, quantification for both internal and external multi-unit accidents is the significant issue. Although our result above mentioned was one of the case studies to check application of method suggested in this paper, it is expected that this method can be used in practical assessment for multi-unit risk

37 CFR 1.9 - Definitions.

Science.gov (United States)

2010-07-01

... Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions General Information and Correspondence § 1.9... Secretary of Commerce for Intellectual Property and Director of the United States Patent and Trademark...

Retrofitting Inefficient Rooftop Air-Conditioning Units Reduces U.S. Navy Energy Use (Fact Sheet)

Energy Technology Data Exchange (ETDEWEB)

None, None

2014-04-01

As part of the U.S. Navy's overall energy strategy, the National Renewable Energy Laboratory (NREL) partnered with the Naval Facilities Engineering Command (NAVFAC) to demonstrate market-ready energy efficiency measures, renewable energy generation, and energy systems integration. One such technology - retrofitting rooftop air-conditioning units with an advanced rooftop control system - was identified as a promising source for reducing energy use and costs, and can contribute to increasing energy security.

Population Pharmacokinetics of Gemcitabine and dFdU in Pancreatic Cancer Patients Using an Optimal Design, Sparse Sampling Approach.

Science.gov (United States)

Serdjebi, Cindy; Gattacceca, Florence; Seitz, Jean-François; Fein, Francine; Gagnière, Johan; François, Eric; Abakar-Mahamat, Abakar; Deplanque, Gael; Rachid, Madani; Lacarelle, Bruno; Ciccolini, Joseph; Dahan, Laetitia

2017-06-01

Gemcitabine remains a pillar in pancreatic cancer treatment. However, toxicities are frequently observed. Dose adjustment based on therapeutic drug monitoring might help decrease the occurrence of toxicities. In this context, this work aims at describing the pharmacokinetics (PK) of gemcitabine and its metabolite dFdU in pancreatic cancer patients and at identifying the main sources of their PK variability using a population PK approach, despite a sparse sampled-population and heterogeneous administration and sampling protocols. Data from 38 patients were included in the analysis. The 3 optimal sampling times were determined using KineticPro and the population PK analysis was performed on Monolix. Available patient characteristics, including cytidine deaminase (CDA) status, were tested as covariates. Correlation between PK parameters and occurrence of severe hematological toxicities was also investigated. A two-compartment model best fitted the gemcitabine and dFdU PK data (volume of distribution and clearance for gemcitabine: V1 = 45 L and CL1 = 4.03 L/min; for dFdU: V2 = 36 L and CL2 = 0.226 L/min). Renal function was found to influence gemcitabine clearance, and body surface area to impact the volume of distribution of dFdU. However, neither CDA status nor the occurrence of toxicities was correlated to PK parameters. Despite sparse sampling and heterogeneous administration and sampling protocols, population and individual PK parameters of gemcitabine and dFdU were successfully estimated using Monolix population PK software. The estimated parameters were consistent with previously published results. Surprisingly, CDA activity did not influence gemcitabine PK, which was explained by the absence of CDA-deficient patients enrolled in the study. This work suggests that even sparse data are valuable to estimate population and individual PK parameters in patients, which will be usable to individualize the dose for an optimized benefit to risk ratio.

Reimiep 87. An interlaboratory U-235 enrichment determination by gamma measurement on solid UF6 sample

International Nuclear Information System (INIS)

Aparo, M.; Cresti, P.

1988-01-01

Gamma spectroscopy technique, based on the measurement of U 235 186 KeV flux, is now currently used for the determination of Uranium enrichment in different material of nuclear fuel cycle, namely: Uranium metallic, UO 2 pellets, UF 6 liquid or solid. The present paper describes the use of such a technique and the obtained results in determining the U 235 /U atomic isotopic abundance on a certified UF 6 solid sample. The measurements have been carried out in the frame work of the partecipation to the ''UF 6 Interlaboratory Measurements Evaluation Programme'' organized by CBNM/Geel with the support of the ESARDA (European Safeguards Research and Development Association)

U.S. studies of the Oklo phenomenon

International Nuclear Information System (INIS)

Cowan, G.A.; Bryant, E.A.; Daniels, W.R.; Maeck, W.J.

1975-01-01

Analyses of samples from the Oklo site are in agreement with previous reports by Naudet et al concerning the occurrence of a natural chain reaction in Precambrian times. A preliminary modeling of the reactor suggests that the event took place 1.7 to 1.9 b.y. ago, and that the period of criticality lasted at least 2 x 10 5 years. Uranium may have accreted and, to a lesser extent, migrated during the period of criticality or subsequent to it. (U.S.)

40 CFR 75.19 - Optional SO2, NOX, and CO2 emissions calculation for low mass emissions (LME) units.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Optional SO2, NOX, and CO2 emissions... § 75.19 Optional SO2, NOX, and CO2 emissions calculation for low mass emissions (LME) units. (a... input, NOX, SO2, and CO2 mass emissions, and NOX emission rate under this part. If the owner or operator...

50 CFR 401.19 - Statements and payrolls.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Statements and payrolls. 401.19 Section 401.19 Wildlife and Fisheries JOINT REGULATIONS (UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT... FISHERIES CONSERVATION, DEVELOPMENT AND ENHANCEMENT § 401.19 Statements and payrolls. The regulations of the...

A statistical study of {sup 238}U and {sup 234}U/{sup 238}U distributions in coral samples from the Egyptian shoreline of the north-western Red sea and in fossil mollusk shells from the Atlantic coast of High Atlas in Morocco: implications for {sup 230}Th/{sup 234}U dating

Energy Technology Data Exchange (ETDEWEB)

Choukri, A.; Hakam, O.K. [Lab. des Faibles Radioactivites et d' Environnements, UFR: Faibles Radioactivites, Mathematiques physiques et environnement, Kenitra (Morocco); Reyss, J.L. [Lab. des Sciences de Climat et de l' Environnement, Domaine du CNRS, Gif sur Yvette (France); Plaziat, J.C. [Univ. de Paris-Sud, Dept. des Sciences de la Terre, Orsay (France)

2002-07-01

In this work, radiochemical analysis results of 126 uncrystallized coral samples from the Egyptian shoreline of northwestern Red Sea and 120 fossil mollusk shell samples from the Atlantic coast of Moroccan High Atlas at the North of Agadir City in Morocco are presented and discussed. The coral samples were collected in Egypt from the emerged coral reef terraces over 500 km from The Ras Gharib-Ras Shukeir depression (28 10') in the north to Wadi Lahami (north of Ras Banas, 24 10') in the south. The fossil mollusk shells were collected in Morocco from Agadir-Harbour in the south to Tamri village in the north extending over about 50 km. The statistical distributions of results ({sup 238}U content, {sup 234}U/{sup 238}U activity ratio and ages) obtained on the dated materials in the two different regions were compared for three fossil sea levels corresponding to three different climatic stages (Holocene, 5e, 7 and/or 9) in the aim to establish methodological criteria for judging validity of the measured ages. For corals, {sup 238}U content varies in narrow interval around the same average value of 3 ppm for the three sea levels, the calculated initial {sup 234}U/{sup 238}U values are in agreement with the actual sea water ratio (1.15) with some values slightly higher than for the older sea levels. The obtained ages are in good agreement with the ages reported previously for the three emerged fossil sea levels on unrecrystallized corals by alpha spectrometry and by mass spectrometry. For mollusk shells, except for Holocene sea level, {sup 238}U and initial {sup 234}U/{sup 238}U activity ratios vary for the older levels in wide intervals, independent of species and calcite contents of samples. The high {sup 238}U contents and {sup 234}U/{sup 238}U activity ratio are due eventually to a post-incorporation of secondary uranium from sea water or from continental waters drained away rivers. This incorporation leads to a rejuvenation of mollusk shell ages and is

Determination of Pb-210 and U-238 in environment samples by direct measurement using low energy γ spectrometry

International Nuclear Information System (INIS)

Godoy, J.M. de; Mendonca, A.H.; Sachett, I.A.

1985-01-01

The determination of Pb-210 and U-238 by γ spectrometry in environmental samples was carried out using the 47 KeV (4%) line for Pb-210 and the 63 KeV (3,9%) line from Th-234 to U-238. An intrinsic Ge detector with 0,8 KeV resolution for the 60 KeV line of Am-41 was employed. The eficiency was determined by using the radionuclide water solution. The samples were measured in a cylindric geometry with 7 cm diameter and 3 cm hight with a mass ranging from 25 to 180g, depending on the density. The self absorption correction factor for each sample was determined by using an external source of Pb-210 and Am-241. The results showed good agreement with the radiochemical analysis values. The diferences were lower than 20%; the detection limit changed from sample to sample staying on the pCi/g range for the 200 minutes couting time. (Author) [pt

Behavior of uranium along Jucar River (Eastern Spain). Determination of 234U/238U and 235U/238U ratios

International Nuclear Information System (INIS)

Rodriguez-Alvarez, M.J.; Sanchez, F.

1995-01-01

The uranium concentration and the 234 U/ 238 U, 235 U/ 238 U activity ratios were studied in water samples from Jucar River, using low-level α-spectrometry. The effects of pH, temperature and salinity were considered and more detailed sampling was done in the neighbourhood of Cofrentes Nuclear Plant (Valencia, Spain). Changes were observed in the uranium concentration with the salinity and the 234 U/ 238 U activity ratio was found to vary with pH. Leaching and dilution, which depend on pH and salinity, are the probable mechanisms for these changes in the concentration of uranium and the activity ratios. (author) 25 refs.; 4 figs.; 1 tab

The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

Energy Technology Data Exchange (ETDEWEB)

Meadows, J.W.

1986-12-01

The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

Vapor space characterization of Waste Tank 241-U-106 (in situ): Results from samples collected on 8/25/94

International Nuclear Information System (INIS)

Ligotke, M.W.; Lucke, R.B.; Pool, K.H.

1995-10-01

This report describes inorganic and organic analyses results from in situ samples obtained from the headspace of the Hanford waste storage Tank 241-U-106 (referred to as Tank U-106). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not performed. In addition, the authors looked for the 39 TO-14 compounds plus an additional 14 target analytes. Of these, six were observed above the 5-ppbv reporting cutoff. Ten organic tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv in two or more of the three samples collected and are reported with concentrations that are semiquantitative estimates based on internal standard response factors. The 10 organic analytes with the highest estimated concentrations are listed in Table 1 and account for approximately 89% of the total organic components in Tank U-106. Methyl isocyanate, a compound of possible concern in Tank U-106, was not detected. Tank U-106 is on the Organic Watch List

ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*

Formaldehyde exposure in U.S. industries from OSHA air sampling data.

Science.gov (United States)

Lavoue, Jerome; Vincent, Raymond; Gerin, Michel

2008-09-01

National occupational exposure databanks have been cited as sources of exposure data for exposure surveillance and exposure assessment for occupational epidemiology. Formaldehyde exposure data recorded in the U.S Integrated Management Information System (IMIS) between 1979 and 2001 were collected to elaborate a multi-industry retrospective picture of formaldehyde exposures and to identify exposure determinants. Due to the database design, only detected personal measurement results (n = 5228) were analyzed with linear mixed-effect models, which explained 29% of the total variance. Short-term measurement results were higher than time-weighted average (TWA) data and decreased 18% per year until 1987 (TWA data 5% per year) and 5% per year (TWA data 4% per year) after that. Exposure varied across industries with maximal estimated TWA geometric means (GM) for 2001 in the reconstituted wood products, structural wood members, and wood dimension and flooring industries (GM = 0.20 mg/m(3). Highest short-term GMs estimated for 2001 were in the funeral service and crematory and reconstituted wood products industries (GM = 0.35 mg/m(3). Exposure levels in IMIS were marginally higher during nonprogrammed inspections compared with programmed inspections. An increasing exterior temperature tended to cause a decrease in exposure levels for cold temperatures (-5% per 5 degrees C for T 15 degrees C). Concentrations measured during the same inspection were correlated and varied differently across industries and sample type (TWA, short term). Sensitivity analyses using TOBIT regression suggested that the average bias caused by excluding non-detects is approximately 30%, being potentially higher for short-term data if many non-detects were actually short-term measurements. Although limited by availability of relevant exposure determinants and potential selection biases in IMIS, these results provide useful insight on formaldehyde occupational exposure in the United States in the last

Household pesticide usage in the United States.

Science.gov (United States)

Savage, E P; Keefe, T J; Wheeler, H W; Mounce, L; Helwic, L; Applehans, F; Goes, E; Goes, T; Mihlan, G; Rench, J; Taylor, D K

1981-01-01

A total of 10,000 U.S. households in 25 standard metropolitan statistical areas and 25 counties were included in the United States. More than 8,200 households granted an interview. Nine of every ten households in the United States used some types of pesticide in their house, garden, or yard. Households in the southeastern United States used the most pesticides. Although more than 500 different pesticide formulations were used by the sampled households, 15 pesticides accounted for 65.5% of all pesticides reported in this study. Thirteen of these 15 pesticides were insecticides, one was a herbicide, and one was a rodenticide.

Data validation summary report for the 100-BC-5 Operable Unit Round 8 Groundwater Sampling

International Nuclear Information System (INIS)

Kearney, A.T.

1996-03-01

The information provided in this validation summary report includes data from the chemical analyses of samples from the 100-BC-5 Operable Unit Round 8 Groundwater Sampling Investigation. All of the data from this sampling event and their related quality assurance samples were reviewed and validated to verify that the reported sample results were of sufficient quality to support decisions regarding remedial actions performed at this site. Sample analyses included metals, general chemistry and radiochemistry

Comparing U.S. Army suicide cases to a control sample: initial data and methodological lessons.

Science.gov (United States)

Alexander, Cynthia L; Reger, Mark A; Smolenski, Derek J; Fullerton, Nicole R

2014-10-01

Identification of risk and protective factors for suicide is a priority for the United States military, especially in light of the recent steady increase in military suicide rates. The Department of Defense Suicide Event Report contains comprehensive data on suicides for active duty military personnel, but no analogous control data is available to permit identification of factors that differentially determine suicide risk. This proof-of-concept study was conducted to determine the feasibility of collecting such control data. The study employed a prospective case-control design in which control cases were randomly selected from a large Army installation at a rate of four control participants for every qualifying Army suicide. Although 111 Army suicides were confirmed during the study period, just 27 control soldiers completed the study. Despite the small control sample, preliminary analyses comparing suicide cases to controls identified several factors more frequently reported for suicide cases, including recent failed intimate relationships, outpatient mental health history, mood disorder diagnosis, substance abuse history, and prior self-injury. No deployment-related risk factors were found. These data are consistent with existing literature and form a foundation for larger control studies. Methodological lessons learned regarding study design and recruitment are discussed to inform future studies. Reprint & Copyright © 2014 Association of Military Surgeons of the U.S.

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

A Biopsychosocial Conceptual Framework of Postpartum Depression Risk in Immigrant and U.S.-born Latina Mothers in the United States.

Science.gov (United States)

Lara-Cinisomo, Sandraluz; Girdler, Susan S; Grewen, Karen; Meltzer-Brody, Samantha

2016-01-01

In this review, we offer a conceptual framework that identifies risk factors of postpartum depression (PPD) in immigrant and U.S.-born Latinas in the United States by focusing on psychosocial and neuroendocrine factors. Although the evidence of the impact psychosocial stressors have on the development of PPD has been well-documented, less is known about the biological etiology of PPD or how these complex stressors jointly increase the risk of PPD in immigrant and U.S.-born Latinas in the United States. Using PubMed, CINAHL, and Embase, we reviewed the literature from 2000 to 2015 regarding psychosocial and physiological risk factors associated with PPD to develop a conceptual model for Latinas. Our search yielded 16 relevant studies. Based on our review of the literature, we developed a biopsychosocial conceptual model of PPD for Latinas in the United States. We make arguments for an integrated model designed to assess psychosocial and physiological risk factors and PPD in a high-risk population. Our framework describes the hypothesized associations between culturally and contextually relevant psychosocial stressors, neurobiological factors (e.g., hypothalamic-pituitary-adrenal [HPA] axis response system and oxytocin signaling), and PPD in Latinas in the United States. Future studies should evaluate prospectively the impact psychosocial stressors identified here have on the development of PPD in both immigrant and U.S-born Latinas while examining neuroendocrine function, such as the HPA axis and oxytocin signaling. Our conceptual framework will allow for the reporting of main and indirect effects of psychosocial risk factors and biomarkers (e.g., HPA axis and oxytocin function) on PPD in foreign- and U.S.-born postpartum Latinas. Copyright © 2016 Jacobs Institute of Women's Health. Published by Elsevier Inc. All rights reserved.

HIV Risk Behaviors in the U.S. Transgender Population: Prevalence and Predictors in a Large Internet Sample

Science.gov (United States)

Feldman, Jamie; Romine, Rebecca Swinburne; Bockting, Walter O.

2014-01-01

To study the influence of gender on HIV risk, a sample of the U.S. transgender population (N = 1,229) was recruited via the Internet. HIV risk and prevalence were lower than reported in prior studies of localized, urban samples, but higher than the overall U.S. population. Findings suggest that gender nonconformity alone does not itself result in markedly higher HIV risk. Sex with nontransgender men emerged as the strongest independent predictor of unsafe sex for both male-to-female (MtF) and female-to-male (FtM) participants. These sexual relationships constitute a process that may either affirm or problematize gender identity and sexual orientation, with different emphases for MtFs and FtMs, respectively. PMID:25022491

A United States forensic sample for the Gudjonsson Suggestibility Scales.

Science.gov (United States)

Frumkin, I Bruce; Lally, Stephen J; Sexton, James E

2012-01-01

The Gudjonsson Suggestibility Scales (GSS) is a valuable test to use as part of a comprehensive assessment of psychological and interrogative factors relevant to a defendant's vulnerability to giving a false or involuntary confession. One limitation of the test is that the manual only provides information for samples from Iceland and Great Britain. This report describes the results of 334 individuals in the United States, who were administered the tests as part of an evaluation to assess confession-related issues in a forensic context (i.e., capacity to waive Miranda rights or vulnerability in providing a false or involuntary confession). This forensic sample includes both juveniles and adults. Results are consistent with Gudjonsson's British and Icelandic samples, in which the Yield 1 score is more affected by intellectual and cognitive variables, but Shift and, to a lesser extent, Yield 2 scores are more related to emotional and personality characteristics. Copyright © 2012 John Wiley & Sons, Ltd.

Hanford site environmental surveillance master sampling schedule

International Nuclear Information System (INIS)

Bisping, L.E.

1998-01-01

Environmental surveillance of the Hanford Site and surrounding areas is conducted by the Pacific Northwest National Laboratory (PNNL) for the U.S. Department of Energy (DOE). Sampling is conducted to evaluate levels of radioactive and nonradioactive pollutants in the Hanford environs, as required in DOE Order 5400.1 open-quotes General Environmental Protection Program,close quotes and DOE Order 5400.5, open-quotes Radiation Protection of the Public and the Environment.close quotes The sampling methods are described in the Environmental Monitoring Plan, United States Department of Energy, Richland Operations Office, DOE/RL91-50, Rev. 2, U.S. Department of Energy, Richland, Washington. This document contains the 1998 schedules for routine collection of samples for the Surface Environmental Surveillance Project (SESP) and Drinking Water Monitoring Project. Each section of this document describes the planned sampling schedule for a specific media (air, surface water, biota, soil and vegetation, sediment, and external radiation). Each section includes the sample location, sample type, and analyses to be performed on the sample. In some cases, samples are scheduled on a rotating basis and may not be planned for 1998 in which case the anticipated year for collection is provided. In addition, a map is included for each media showing sample locations

Ethos of independence across regions in the United States: the production-adoption model of cultural change.

Science.gov (United States)

Kitayama, Shinobu; Conway, Lucian Gideon; Pietromonaco, Paula R; Park, Hyekyung; Plaut, Victoria C

2010-09-01

Contemporary U.S. culture has a highly individualistic ethos. Nevertheless, exactly how this ethos was historically fostered remains unanalyzed. A new model of dynamic cultural change maintains that sparsely populated, novel environments that impose major threats to survival, such as the Western frontier in the United States during the 18th and 19th centuries, breed strong values of independence, which in turn guide the production of new practices that encourage self-promotion and focused, competitive work. Faced with few significant threats to survival, residents in traditional areas are likely to seek social prestige by adopting existing practices of other, higher status groups. Because of both the massive economic success of the frontier and the official endorsement of the frontier by the federal government, eastern residents of the United States in the 18th and 19th centuries may have actively adopted the frontier practices of independence, thus incorporating the frontier ethos of independence to form the contemporary U.S. national culture. Available evidence is reviewed, and implications for further research on cultural change are suggested. Copyright 2010 APA, all rights reserved.

Effect of biomimetic non-smooth unit morphology on thermal fatigue behavior of H13 hot-work tool steel

Science.gov (United States)

Meng, Chao; Zhou, Hong; Cong, Dalong; Wang, Chuanwei; Zhang, Peng; Zhang, Zhihui; Ren, Luquan

2012-06-01

The thermal fatigue behavior of hot-work tool steel processed by a biomimetic coupled laser remelting process gets a remarkable improvement compared to untreated sample. The 'dowel pin effect', the 'dam effect' and the 'fence effect' of non-smooth units are the main reason of the conspicuous improvement of the thermal fatigue behavior. In order to get a further enhancement of the 'dowel pin effect', the 'dam effect' and the 'fence effect', this study investigated the effect of different unit morphologies (including 'prolate', 'U' and 'V' morphology) and the same unit morphology in different sizes on the thermal fatigue behavior of H13 hot-work tool steel. The results showed that the 'U' morphology unit had the optimum thermal fatigue behavior, then the 'V' morphology which was better than the 'prolate' morphology unit; when the unit morphology was identical, the thermal fatigue behavior of the sample with large unit sizes was better than that of the small sizes.

CA 19-9 Pancreatic Tumor Marker Fluorescence Immunosensing Detection via Immobilized Carbon Quantum Dots Conjugated Gold Nanocomposite.

Science.gov (United States)

Alarfaj, Nawal Ahmad; El-Tohamy, Maha Farouk; Oraby, Hesham Farouk

2018-04-11

The clinical detection of carbohydrate antigen 19-9 (CA 19-9), a tumor marker in biological samples, improves and facilitates the rapid screening and diagnosis of pancreatic cancer. A simple, low cost, fast, and green synthesis method to prepare a viable carbon quantum dots/gold (CQDs/Au) nanocomposite fluorescence immunosensing solution for the detection of CA 19-9 was reported. The present method is conducted by preparing glucose-derived CQDs using a microwave-assisted method. CQDs were employed as reducing and stabilizing agents for the preparation of a CQDs/Au nanocomposite. The immobilized anti-CA 19-9-labeled horseradish peroxidase enzyme (Ab-HRP) was anchored to the surface of a CQDs/Au nanocomposite by a peptide interaction between the carboxylic and amine active groups. The CA 19-9 antigen was trapped by another monoclonal antibody that was coated on the surface of microtiter wells. The formed sandwich capping antibody-antigen-antibody enzyme complex had tunable fluorescence properties that were detected under excitation and emission wavelengths of 420 and 530 nm. The increase in fluorescence intensities of the immunoassay sensing solution was proportional to the CA 19-9 antigen concentration in the linear range of 0.01-350 U mL -1 and had a lower detection limit of 0.007 U mL -1 . The proposed CQDs/Au nanocomposite immunoassay method provides a promising tool for detecting CA 19-9 in human serum.

Trends in darunavir resistance-associated mutations and phenotypic resistance in commercially tested United States clinical samples between 2006 and 2012.

Science.gov (United States)

Lathouwers, Erkki; Gupta, Soumi; Haddad, Mojgan; Paquet, Agnes; de Meyer, Sandra; Baugh, Bryan

2015-06-01

HIV-1 samples submitted by clinicians from the United States for routine drug susceptibility testing (PhenoSense GT) were evaluated for genotypic and phenotypic resistance to darunavir and other protease inhibitors (PIs). Among these samples (Monogram Biosciences database January 2006-June 2012; N=78,843), isolates harboring zero IAS-USA darunavir resistance-associated mutations (RAMs) increased from 77.7% in 2006 to 92.8% through the first half of 2012 (H1 2012; upward trend, p=0.0008); a downward trend seen for samples with three or more darunavir RAMs (7.5% in 2006 and 2.6% in H1 2012; p=0.002). Among samples with any PI resistance (N=15,932), samples harboring zero darunavir RAMs gradually increased (39.9% in 2006 vs. 55.0% in H1 2012; upward trend, p=0.005), but three or more darunavir RAMs did not change over time (21.7% in 2006 and 19.2% in H1 2012; p=0.27). During this period, the frequency of the 11 individual darunavir RAMs (IAS-USA 2011 list) decreased among all samples. The frequency of each darunavir RAM in PI-resistant samples decreased or remained relatively stable. The prevalence of samples with phenotypic resistance to darunavir (partial-to-full) decreased over time in all samples (8.2% in 2006 vs. 2.3% in H1 2012), as did resistance to other PIs (p<0.006 for all PIs). Phenotypic resistance to darunavir and other PIs also decreased in PI-resistant samples (darunavir: 23.9% in 2006 vs. 17.1% in H1 2012; p<0.013 for all PIs). Since approval of darunavir in 2006, there was a significant decrease in prevalence of samples with genotypic and phenotypic resistance to darunavir in commercially tested HIV-1 isolates. Furthermore, the prevalence of phenotypic resistance to darunavir was lower than all other PIs.

Conversion from insulin glargine U-100 to insulin glargine U-300 or insulin degludec and the impact on dosage requirements.

Science.gov (United States)

Pearson, Scott M; Trujillo, Jennifer M

2018-04-01

We wanted to determine whether basal insulin requirements change when patients transition from insulin glargine U-100 (Gla-100) to insulin glargine U-300 (Gla-300) or insulin degludec. This study involved subjects seen in the University of Colorado Health Endocrine Clinic who were transitioned from Gla-100 to either Gla-300 ( n = 95) or insulin degludec ( n = 39). The primary outcome was the difference between baseline Gla-100 dose and dose of Gla-300 or insulin degludec prescribed after first follow-up visit within 1-12 months. Secondary outcomes included changes in glycemic control and empiric dose conversion from Gla-100 to Gla-300 or insulin degludec on the day of transition. Wilcoxon rank sum tests evaluated changes in insulin doses, and paired t tests assessed changes in glycemic control using GraphPad statistical software. Median daily basal insulin dose increased for individuals transitioned from Gla-100 to Gla-300 from 30 [19-60 interquartile range (IQR)] units at baseline to 34.5 (19-70 IQR) units after follow up ( p = 0.01). For patients transitioned to insulin degludec, dose changes from baseline to follow up were not significantly different ( p = 0.56). At the time of transition, the prescribed dose of Gla-300 or insulin degludec did not significantly differ from the previous dose of Gla-100 ( p = 0.73 and 0.28, respectively), indicating that empiric dose adjustments were not routinely prescribed. Patients who transitioned from Gla-100 to Gla-300 had increased basal insulin requirements between visits, while basal insulin requirements for those transitioned from Gla-100 to insulin degludec were not significantly different.

Sorption of Cs, Eu and U(VI) onto rock samples from Nizhnekansky massive

Energy Technology Data Exchange (ETDEWEB)

Petrov, V.; Vlasova, I.; Kalmykov, S. [Lomonosov Moscow State University (Russian Federation); Kuzmenkova, N. [Vernadsky Institute of Geochemistry and Analytical Chemistry, Russian Academy of Science (Russian Federation); Petrov, V.; Poluektov, V. [Institute of Geology of Ore Deposits, Petrography, Mineralogy and Geochemistry, Russian Academy of Sciences - IGEM RAS (Russian Federation)

2014-07-01

The accepted in Russia concept for high level wastes (HLW) and spent nuclear fuel (SNF) disposal is based on their isolation into the deep underground crystalline rock formations. The 'Eniseysky' area (Nizhnekansky massive) is supposed as the most perspective location for the future HLW and SNF repository. Core materials from different areas of Nizhnekasnsky massive have been studied in terms of petrographic and mineralogical characterization; definition of filtration, elastic, petro-physical and strength properties; estimation of hydrothermal-metasomatic transformation of rocks. We used both undisturbed sliced cores and crushed material for the sorption experiments. Preliminary results of uranium sorption show some significant differences between used rock samples from different depth in sorption rate and pH-dependence. In all cases maximum sorption (more than 90%) is reached in 2-3 weeks. The pH-dependence of sorbed uranium fraction has typical hump-shape: increase of sorption percentage with increasing pH values to 6, plateau (90-98 % of uranium sorbed), decrease of sorption percentage with increasing pH values from 8 due to U(VI) hydrolysis. In the case of cesium the sorption maximum is reached within 10-12 days and in the case of europium - about 5 days. All radionuclides sorbed preferentially onto dark minerals. Local distribution and preferential sorption of cesium, europium and uranium (VI) onto different minerals within the sample were studied by radiography, SEM-EDX, etc. These data accompanying with rock sample composition will allow the development of quantitative model for Cs, Eu and U(VI) sorption onto investigated rocks. Document available in abstract form only. (authors)

27 CFR 19.704 - Labels.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Labels. 19.704 Section 19... TREASURY LIQUORS DISTILLED SPIRITS PLANTS Samples of Spirits § 19.704 Labels. (a) On each container of spirits to be withdrawn under the provisions of § 19.701, the proprietor shall affix a label showing the...

The presence of enterovirus, adenovirus, and parvovirus B19 in myocardial tissue samples from autopsies

DEFF Research Database (Denmark)

Nielsen, Trine Skov; Hansen, Jakob; Nielsen, Lars Peter

2014-01-01

of adenovirus, enterovirus, and parvovirus B19 (PVB) in myocardial autopsy samples from myocarditis related deaths and in non-inflamed control hearts in an effort to clarify their significance as the causes of myocarditis in a forensic material. METHODS: We collected all autopsy cases diagnosed with myocarditis...... from 1992 to 2010. Eighty-four suicidal deaths with morphologically normal hearts served as controls. Polymerase chain reaction was used for the detection of the viral genomes (adenovirus, enterovirus, and PVB) in myocardial tissue specimens. The distinction between acute and persistent PVB infection...... was made by the serological determination of PVB-specific immunoglobulins M and G. RESULTS: PVB was detected in 33 of 112 (29 %) myocarditis cases and 37 of 84 (44 %) control cases. All of the samples were negative for the presence of adenovirus and enterovirus. Serological evidence of an acute PVB...

Vapor space characterization of waste Tank 241-U-103: Results from samples collected on 2/15/95

International Nuclear Information System (INIS)

Ligotke, M.W.; Pool, K.H.; Clauss, T.W.; McVeety, B.D.; Klinger, G.S.; Olsen, K.B.; Bredt, O.P.; Fruchter, J.S.; Goheen, S.C.

1995-11-01

This report describes inorganic and organic analyses results from samples obtained from the headspace of the Hanford waste storage Tank 241-U-103 (referred to as Tank U-103). The results described her were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water vapor (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. In addition, quantitative results were obtained for the 39 TO-14 compounds plus an additional 14 analytes. Of these, 11 were observed above the 5-ppbv reporting cutoff. Eleven tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv and are reported with concentrations that are semiquantitative estimates based on internal-standard response factors. The 10 organic analytes with the highest estimated concentrations are listed in Table 1 and account for approximately 90% of the total organic components in Tank U-103. Two permanent gases, hydrogen (H 2 ) and nitrous oxide (N 2 O), were also detected. Tank U-103 is on the Hydrogen Watch List

U.S. Level III and IV Ecoregions (U.S. EPA)

Data.gov (United States)

U.S. Environmental Protection Agency — This map service displays Level III and Level IV Ecoregions of the United States and was created from ecoregion data obtained from the U.S. Environmental Protection...

Dicty_cDB: FC-BS19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/

234U and 238U in the Carrizo Sandstone aquifer of South Texas

International Nuclear Information System (INIS)

Cowart, J.B.; Osmond, J.K.

1974-01-01

The waters of the Carrizo Sand formation of South Texas, United States of America, exhibit a pattern of uranium isotopic disequilibrium, described in terms of 234 U/ 238 U activity ratio ('A.R.') and uranium concentration, which may be a function of geochemical factors and the hydrologic history of the area. In terms of uranium, two regimes seem to exist. The first, including outcrop and near outcrop sample locations, has waters with relatively high concentration and low A.R. Somewhat downdip, the uranium concentration decreases sharply at the downdip limit of the oxidation environment, a zone of uranium precipitation. Recoil of daughter products from the precipitated uranium causes an increase of A.R. of the water. Water of low uranium concentration and high A.R. is found throughout the downdip regime. If a constant input of 234 U through time is assumed, the downdip decrease in A.R. after the initial introduction of 234 U into the water may be ascribed to radioactive decay of 234 U. However, this assumption leads to the calculation of a water flow rate one twentieth that determined by other means. Alternatively, this pattern may be an artifact of a change of climate from 20,000 years to 10,000 years ago. In this case, the decrease in A.R. downdip is a function of a varying input of 234 U as well as decay. (author)

48 CFR 19.000 - Scope of part.

Science.gov (United States)

2010-10-01

... PROGRAMS SMALL BUSINESS PROGRAMS 19.000 Scope of part. (a) This part implements the acquisition-related sections of the Small Business Act (15 U.S.C. 631, et seq.), applicable sections of the Armed Services...), section 7102 of the Federal Acquisition Streamlining Act of 1994 (Public Law 103-355), 10 U.S.C. 2323, and...

34 CFR 81.19 - Costs and fees of parties.

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false Costs and fees of parties. 81.19 Section 81.19 Education Office of the Secretary, Department of Education GENERAL EDUCATION PROVISIONS ACT-ENFORCEMENT General Provisions § 81.19 Costs and fees of parties. The Equal Access to Justice Act, 5 U.S.C. 504...

Sampling and decontamination plan for the Transuranic Storage Area--1/-R container storage unit

International Nuclear Information System (INIS)

Barry, G.A.

1992-11-01

This document describes the sampling and decontamination of the Transuranic Storage Area (TSA)-l/-R container storage area and the earthen-covered portion of the TSA-2 container storage unit at the Radioactive Waste Management Complex. Stored containers from the earthen-covered asphalt pads will be retrieved from the TSA-l/-R and TSA-2 container storage units. Container retrieval will be conducted under the TSA retrieval enclosure, a fabricated steel building to be constructed over the earthen-covered pad to provide containment and weather protection. Following container retrieval, the TSA retrieval enclosure will be decontaminated to remove radioactive and hazardous contamination. The underlying soils will be sampled and analyzed to determine whether any contaminated soils require removal

Oleuropein Decreases Cyclooxygenase-2 and Interleukin-17 Expression and Attenuates Inflammatory Damage in Colonic Samples from Ulcerative Colitis Patients.

Science.gov (United States)

Larussa, Tiziana; Oliverio, Manuela; Suraci, Evelina; Greco, Marta; Placida, Roberta; Gervasi, Serena; Marasco, Raffaella; Imeneo, Maria; Paolino, Donatella; Tucci, Luigi; Gulletta, Elio; Fresta, Massimo; Procopio, Antonio; Luzza, Francesco

2017-04-15

Oleuropein (OLE) is the major phenolic secoiridoid of olive tree leaves, and its antioxidant and anti-inflammatory activities have been demonstrated in in vitro and in vivo animal models. The aim of this study was to investigate the activity of OLE in the colonic mucosa from patients with ulcerative colitis (UC). Biopsies obtained during colonoscopy from 14 patients with active UC were immediately placed in an organ culture chamber and challenged with lipopolysaccharide from Escherichia coli (EC-LPS) at 1 μg/mL in the presence or absence of 3 mM OLE. The expression of cyclooxygenase (COX)-2 and interleukin (IL)-17 was assessed in total protein extracts from treated colonic biopsies by Western blotting. Levels of IL-17 were also measured in culture supernatant by ELISA. A microscopic evaluation of the cultured biopsies was performed by conventional histology and immunohistochemistry. The expression of COX-2 and IL-17 were significantly lower in samples treated with OLE + EC-LPS compared with those treated with EC-LPS alone (0.80 ± 0.15 arbitrary units (a.u.) vs. 1.06 ± 0.19 a.u., p = 0.003, and 0.71 ± 0.08 a.u. vs. 1.26 ± 0.42 a.u., p = 0.03, respectively) as were the levels of IL-17 in culture supernatants of OLE + EC-LPS treated colonic samples (21.16 ± 8.64 pg/mL vs. 40.67 ± 9.24 pg/mL, p = 0.01). Histologically, OLE-treated colonic samples showed an amelioration of inflammatory damage with reduced infiltration of CD3, CD4, and CD20 cells, while CD68 numbers increased. The anti-inflammatory activity of OLE was demonstrated in colonic biopsies from UC patients. These new data support a potential role of OLE in the treatment of UC.

27 CFR 19.26 - Tax on wine.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Tax on wine. 19.26 Section... THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Taxes Gallonage Taxes § 19.26 Tax on wine. (a) Imposition of tax. A tax is imposed by 26 U.S.C. 5041 or 7652 on wine (including imitation, substandard, or...

Assessment of land use change in the coterminous United States and Alaska for global assessment of forest loss conducted by the food and agricultural organization of the United Nations

Science.gov (United States)

Tanushree Biswas; Mike Walterman; Paul Maus; Kevin A. Megown; Sean P. Healey; Kenneth Brewer

2012-01-01

The Food and Agricultural Organization (FAO) of the United Nations conducted a global assessment for forest change in 2010 using satellite imagery from 1990, 2000, and 2005. The U.S. Forest Service was responsible for assessing forest change in the United States. A polygon-based, stratified sampling design developed by FAO was used to assess change in forest area...

31 CFR 500.321 - United States; continental United States.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 500.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof, including U.S. trust territories...

Real-time polymerase chain reaction detection of parvovirus B19 DNA in blood donations using a commercial and an in-house assay.

Science.gov (United States)

Koppelman, M H G M; van Swieten, P; Cuijpers, H T M

2011-06-01

European regulations require testing of manufacturing plasma for parvovirus B19 (B19) DNA to limit the load of this virus to a maximum acceptable level of 10 IU/µL. To meet this requirement, most manufacturers introduced a test algorithm to identify and eliminate high-load donations before making large manufacturing pools of plasma units. Sanquin screens all donations using a commercial assay from Roche and an in-house assay. Between 2006 and 2009, 6.2 million donations were screened using two different polymerase chain reaction (PCR) assays targeting B19 DNA. Donations with B19 DNA loads of greater than 1 × 10(6) IU/mL showing significant differences in viral load between the two assays were further analyzed by sequencing analysis. A total of 396 donations with B19 DNA loads of greater than 1 × 10(6) IU/mL were identified. Fifteen samples (3.8%) had discordant test results; 10 samples (2.5%) were underquantified by the Roche assay, two samples (0.5%) were underquantified by the in-house assay, and three samples (0.8%) were not detected by the Roche assay. Sequencing analysis revealed mismatches in primer and probe-binding regions. Phylogenetic analysis showed that 12 samples were B19 Genotype 1. The three samples not detected by the Roche assay were B19 Genotype 2. This study shows that 3.8% of the viremic B19 DNA-positive donations are not quantified correctly by the Roche or in-house B19 DNA assays. B19 Genotype 1 isolates showing incorrect test results are more common than B19 Genotype 2 or 3 isolates. Newly designed B19 PCR assays for blood screening should preferably have multiplexed formats targeting multiple regions of the B19 genome. © 2010 American Association of Blood Banks.

Automated Blood Sample Preparation Unit (ABSPU) for Portable Microfluidic Flow Cytometry.

Science.gov (United States)

Chaturvedi, Akhil; Gorthi, Sai Siva

2017-02-01

Portable microfluidic diagnostic devices, including flow cytometers, are being developed for point-of-care settings, especially in conjunction with inexpensive imaging devices such as mobile phone cameras. However, two pervasive drawbacks of these have been the lack of automated sample preparation processes and cells settling out of sample suspensions, leading to inaccurate results. We report an automated blood sample preparation unit (ABSPU) to prevent blood samples from settling in a reservoir during loading of samples in flow cytometers. This apparatus automates the preanalytical steps of dilution and staining of blood cells prior to microfluidic loading. It employs an assembly with a miniature vibration motor to drive turbulence in a sample reservoir. To validate performance of this system, we present experimental evidence demonstrating prevention of blood cell settling, cell integrity, and staining of cells prior to flow cytometric analysis. This setup is further integrated with a microfluidic imaging flow cytometer to investigate cell count variability. With no need for prior sample preparation, a drop of whole blood can be directly introduced to the setup without premixing with buffers manually. Our results show that integration of this assembly with microfluidic analysis provides a competent automation tool for low-cost point-of-care blood-based diagnostics.

Racial and ethnic differences in the transition to a teenage birth in the United States.

Science.gov (United States)

Manlove, Jennifer; Steward-Streng, Nicole; Peterson, Kristen; Scott, Mindy; Wildsmith, Elizabeth

2013-06-01

Rates of teenage childbearing are high in the United States, and they differ substantially by race and ethnicity and nativity status. Data from the National Longitudinal Survey of Youth 1997 cohort were used to link characteristics of white, black, U.S.-born Hispanic and foreign-born Hispanic adolescents to teenage childbearing. Following a sample of 3,294 females aged 12-16 through age 19, discrete-time logistic regression analyses were used to examine which domains of teenagers' lives were associated with the transition to a teenage birth for each racial and ethnic group, and whether these associations help explain racial and ethnic and nativity differences in this transition. In a baseline multivariate analysis controlling for age, compared with whites, foreign-born Hispanics had more than three times the odds of a teenage birth (odds ratio, 3.5), while blacks and native-born Hispanics had about twice the odds (2.1 and 1.9, respectively). Additional controls (for family environments; individual, peer and dating characteristics; characteristics of first sexual relationships; and subsequent sexual experience) reduced the difference between blacks and whites, and between foreign-born Hispanics and whites, and eliminated the difference between U.S.-born Hispanics and whites. Further, if racial or ethnic minority adolescents had the same distribution as did white teenagers across all characteristics, the predicted probability of a teenage birth would be reduced by 40% for blacks and 35% for U.S.-born Hispanics. Differences in the context of adolescence may account for a substantial portion of racial, ethnic and nativity differences in teenage childbearing. Copyright © 2013 by the Guttmacher Institute.

[Detection of human parvovirus B19, human bocavirus and human parvovirus 4 infections in blood samples among 95 patients with liver disease in Nanjing by nested PCR].

Science.gov (United States)

Tong, Rui; Zhou, Wei-Min; Liu, Xi-Jun; Wang, Yue; Lou, Yong-Liang; Tan, Wen-Jie

2013-04-01

To analyze the infection of human parvovirus B19, human bocavirus (HBoV) and human parvovirus 4 (PARV4) in blood samples among patients with liver disease in Nanjing by molecular detection. Nested PCR assays were designed and validated to detect B19, HBoV and PARV4, respectively. The assays were used to screen three parvoviruses in blood samples from 95 patients with different liver disease in Nanjing. The parvovirus infection was analyzed statistically. The detection limits were 10 copies of genomic DNA equivalents per reaction for each assays and the good specificity were observed. The frequency of B19 and HBoV were 2/95 (2.1%) and 9/95 (9.5%) in blood samples respectively. No PARV4 was detected. HBoV was detected in 3/5 patients with drug-induced hepatitis. Both B19 and HBoV infection were detected in blood from patients with liver disease.

Effect-directed analysis for estrogenic compounds in a fluvial sediment sample using transgenic cyp19a1b-GFP zebrafish embryos.

Science.gov (United States)

Fetter, Eva; Krauss, Martin; Brion, François; Kah, Olivier; Scholz, Stefan; Brack, Werner

2014-09-01

Xenoestrogens may persist in the environment by binding to sediments or suspended particulate matter serving as long-term reservoir and source of exposure, particularly for organisms living in or in contact with sediments. In this study, we present for the first time an effect-directed analysis (EDA) for identifying estrogenic compounds in a sediment sample using embryos of a transgenic reporter fish strain. In the tg(cyp19a1b-GFP) transgenic zebrafish strain, the expression of GFP (green fluorescent protein) in the brain is driven by an oestrogen responsive element in the promoter of the cyp19a1b (aromatase) gene. The selected sediment sample of the Czech river Bilina had already been analysed in a previous EDA using the yeast oestrogen screening assay and had revealed fractions containing estrogenic compounds. When normal phase HPLC (high performance liquid chromatography) fractionation was used for the separation of the sediment sample, the biotest with transgenic fish embryos revealed two estrogenic fractions. Chemical analysis of candidate compounds in these sediment fractions suggested alkylphenols and estrone as candidate compounds responsible for the observed estrogenic effect. Alkylphenol concentrations could partially explain the estrogenicity of the fractions. However, xenoestrogens below the analytical detection limit or non-targeted estrogenic compounds have probably also contributed to the sample's estrogenic potency. The results indicated the suitability of the tg(cyp19a1b-GFP) fish embryo for an integrated chemical-biological analysis of estrogenic effects. Copyright © 2014 Elsevier B.V. All rights reserved.

Validity of the reduced-sample insulin modified frequently-sampled intravenous glucose tolerance test using the nonlinear regression approach.

Science.gov (United States)

Sumner, Anne E; Luercio, Marcella F; Frempong, Barbara A; Ricks, Madia; Sen, Sabyasachi; Kushner, Harvey; Tulloch-Reid, Marshall K

2009-02-01

The disposition index, the product of the insulin sensitivity index (S(I)) and the acute insulin response to glucose, is linked in African Americans to chromosome 11q. This link was determined with S(I) calculated with the nonlinear regression approach to the minimal model and data from the reduced-sample insulin-modified frequently-sampled intravenous glucose tolerance test (Reduced-Sample-IM-FSIGT). However, the application of the nonlinear regression approach to calculate S(I) using data from the Reduced-Sample-IM-FSIGT has been challenged as being not only inaccurate but also having a high failure rate in insulin-resistant subjects. Our goal was to determine the accuracy and failure rate of the Reduced-Sample-IM-FSIGT using the nonlinear regression approach to the minimal model. With S(I) from the Full-Sample-IM-FSIGT considered the standard and using the nonlinear regression approach to the minimal model, we compared the agreement between S(I) from the Full- and Reduced-Sample-IM-FSIGT protocols. One hundred African Americans (body mass index, 31.3 +/- 7.6 kg/m(2) [mean +/- SD]; range, 19.0-56.9 kg/m(2)) had FSIGTs. Glucose (0.3 g/kg) was given at baseline. Insulin was infused from 20 to 25 minutes (total insulin dose, 0.02 U/kg). For the Full-Sample-IM-FSIGT, S(I) was calculated based on the glucose and insulin samples taken at -1, 1, 2, 3, 4, 5, 6, 7, 8,10, 12, 14, 16, 19, 22, 23, 24, 25, 27, 30, 40, 50, 60, 70, 80, 90, 100, 120, 150, and 180 minutes. For the Reduced-Sample-FSIGT, S(I) was calculated based on the time points that appear in bold. Agreement was determined by Spearman correlation, concordance, and the Bland-Altman method. In addition, for both protocols, the population was divided into tertiles of S(I). Insulin resistance was defined by the lowest tertile of S(I) from the Full-Sample-IM-FSIGT. The distribution of subjects across tertiles was compared by rank order and kappa statistic. We found that the rate of failure of resolution of S(I) by

Venezuelas Pursuit of Caribbean Basin Interests: Implications for United States National Security.

Science.gov (United States)

1985-01-01

sold to buyers in Western Europe and the United States. The most important Venezuelan exports in the 19th century were cocoa and coffee. In the 20th...confusion in the U.S. Congress over the difference between the Organiza- tion of Arab Petroleum Exporting Countries (OAPEC), of which Venezuela was not a...member, and the Organization of Petroleum Exporting Countries (OPEC), to which Venezuela belonged, the action remained in force even though Caracas had

Task 08/41, Low temperature loop at the RA reactor, Review IV - Maximum temperature values in the samples without forced cooling; Zadatak 08/41, Niskotemperaturna petlja u reaktoru 'RA', Pregled IV - Maksimalne temperature u uzorcima bez prinudnog hladjenja

Energy Technology Data Exchange (ETDEWEB)

Zaric, Z [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1961-12-15

The quantity of heat generated in the sample was calculated in the Review III. In stationary regime the heat is transferred through the air layer between the sample and the wall of the channel to the heavy water of graphite. Certain value of maximum temperature t{sub 0} is achieved in the sample. The objective of this review is determination of this temperature. [Serbo-Croat] Kolicina toplote generisana u uzorku, izracunata u pregledu III, u ravnoteznom stanju odvodi se kroz vazdusni sloj izmedju uzorka i zida kanala na tesku vodu odnosno grafit, pri cemu se u uzorku dostize izvesna maksimalna temperatura t{sub 0}. Odredjivanje ove temperature je predmet ovog pregleda.

19 CFR 10.62 - Bunker fuel oil.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Bunker fuel oil. 10.62 Section 10.62 Customs... Equipment for Vessels § 10.62 Bunker fuel oil. (a) Withdrawal under section 309, Tariff Act of 1930, as... section 309, Tariff Act of 1930, as amended (19 U.S.C. 1309), when all the bunker fuel oil in a Customs...

31 CFR 15.737-19 - Administrative Law Judge.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Administrative Law Judge. 15.737-19... CONFLICT OF INTEREST Administrative Enforcement Proceedings § 15.737-19 Administrative Law Judge. (a) Appointment. An Administrative Law Judge appointed as provided by 5 U.S.C. 3105 (1966), shall conduct...

48 CFR 19.1001 - General.

Science.gov (United States)

2010-10-01

... SMALL BUSINESS PROGRAMS Small Business Competitiveness Demonstration Program 19.1001 General. The Small Business Competitiveness Demonstration Program was established by the Small Business Competitiveness Demonstration Program Act of 1988, Public Law 100-656 (15 U.S.C. 644 note). The program is implemented by a...

Births to teenagers in the United States, 1940-2000.

Science.gov (United States)

Ventura, S J; Mathews, T J; Hamilton, B E

2001-09-25

This report presents trends in national birth rates for teenagers, with particular focus on the decade of the 1990s. The percent change in rates for 1991-2000 is presented for the United States, and the change for 1991-99 is presented for States. Tabular and graphical descriptions of the trends in teenage birth rates for the Nation and each State, by age group, race, and Hispanic origin, are discussed. Birth rates for teenagers 15-19 years generally declined in the United States since the late 1950s, except for a brief, but steep, upward climb in the late 1980s until 1991. The 2000 rate (49 births per 1,000) is about half the peak rate recorded in 1957 (96 per 1,000). Still the U.S. rate is considerably higher than rates for other developed countries. During the 1990s rate declines were especially large for black teenagers. State-specific rates fell significantly in all States for ages 15-19 and 15-17 years, and in all but three States for ages 18-19 years. Overall the range of decline in State rates for ages 15-19 years was 11 to 36 percent. For teenagers 15-17 years, the range of decline by State was 13 to 43 percent. Reductions by State were largest for black teenagers 15-19 years, with rates falling 40 percent or more in seven States. The factors accounting for these declines include decreased sexual activity reflecting changing attitudes towards premarital sex, increases in condom use, and adoption of newly available hormonal contraception, implants, and injectables.

Attitudes of U.S. retailers toward China, Canada, and the United States as manufacturing sources for furniture: an assessment of competitive priorities

Science.gov (United States)

Urs Buehlmann; Matthew Bumgardner; Torsten Lihra; Mary Frye

2006-01-01

While much has been written regarding the declining global competitiveness of U.S. furniture manufacturing and the subsequent loss of domestic market share and jobs, less is known about the role of retailers in furniture importing. This study investigated the attitudes of U.S. furniture retailers toward China, Canada, and the United States as manufacturing sources for...

Headspace vapor characterization of Hanford waste tank 241-U-109: Results from samples collected on 8/10/95

International Nuclear Information System (INIS)

Evans, J.C.; Thomas, B.L.; Pool, K.H.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

1996-05-01

This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-U-109 (Tank U-109) At the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. This tank is on the Hydrogen Waste List. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases and total non-methane hydrocarbons is listed in a table. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples is also listed in the table. Detailed descriptions of the analytical results appear in the text

Examining Developmental Transitions in Civic Engagement across Adolescence: Evidence from a National U.S. Sample

Science.gov (United States)

Wray-Lake, Laura; Rote, Wendy M.; Benavides, Celina M.; Victorino, Christine

2014-01-01

Describing how much and what type(s) of change are evident in civic engagement across adolescence is a fundamental starting point for advancing developmental theory in the civic domain. Using five annual waves of data from a large national U.S. sample spanning 8th-12th grades, our study describes civic engagement typologies and transitions in and…

Competitive Wrestling-related Injuries in School Aged Athletes in U.S. Emergency Departments

OpenAIRE

Myers, Richard J.; Linakis, Seth W.; Mello, Michael J.; Linakis, James G.

2010-01-01

Objective: To describe the characteristics of wrestling injuries occurring in male athletes aged 7-17 treated in United States (U.S.) emergency departments (ED) from 2000-2006, and to compare injury patterns between younger & older youth wrestlers. Methods: A stratified probability sample of U.S. hospitals providing emergency services in the National Electronic Injury Surveillance System was used for 2000-2006. ED visits for injuries sustained in organized wrestling were analyzed for...

Methicillin-Resistant Staphylococcus aureus (MRSA) Detected at Four U.S. Wastewater Treatment Plants

OpenAIRE

Goldstein, Rachel E. Rosenberg; Micallef, Shirley A.; Gibbs, Shawn G.; Davis, Johnnie A.; He, Xin; George, Ashish; Kleinfelter, Lara M.; Schreiber, Nicole A.; Mukherjee, Sampa; Sapkota, Amir; Joseph, Sam W.; Sapkota, Amy R.

2012-01-01

Background: The incidence of community-acquired methicillin-resistant Staphylococcus aureus (CA-MRSA) infections is increasing in the United States, and it is possible that municipal wastewater could be a reservoir of this microorganism. To date, no U.S. studies have evaluated the occurrence of MRSA in wastewater. Objective: We examined the occurrence of MRSA and methicillin-susceptible S. aureus (MSSA) at U.S. wastewater treatment plants. Methods: We collected wastewater samples from two Mid...

Determination of specific concentrations of 40K, 238U and 232Th in mineral fertilizer samples

International Nuclear Information System (INIS)

Garcez, Ricardo W.D.; Lopes, Jose M.; Silva, Ademir X.

2015-01-01

The use of fertilizer is an established practice worldwide to promote agricultural productivity increased without increasing the planted area, resulting in native forests protection and increase of the food availability. Some kinds of fertilizer have in their chemical composition some radionuclides due the origin of its feedstock, such as 238 U, the 232 Th, and their descendants, beyond 40 K. Knowledge of the radioactivity levels in the environment is great importance to know the gamma radiation dose that the human being is exposed. For identification and quantitation of radionuclides, it was used gamma spectrometry where HPGe detector was used to obtain the spectra, and LabSOCS software for calculating the detection efficiency for each energy. The values of 232 Th specific concentrations ranged from 4.1 to 368.1 Bq.Kg -1 , the values of 238 U specific concentrations ranged from 16.0 to 647.7 Bq.Kg -1 and 40 K specific concentrations ranged from 19.1 to 12713 Bq.Kg -1 . Concentrations of values are consistent with those found in literature. (author)

Chapter E: History and Overview of the U.S. Diatomite Mining Industry, with Emphasis on the Western United States

Science.gov (United States)

Moyle, Phillip R.; Dolley, Thomas P.

2003-01-01

The United States is the largest producer and consumer of diatomite in the world. In 2001, the United States produced about a third of the estimated global production of 1.95 million metric tons (Mt) of diatomite (Dolley, 2003). In any given year, the United States accounts for at least 50 percent of all the diatomite exported in the world (Roskill, 1994). Seven diatomite companies operating in the United States produce diatomite in various grades for a range of applications, including filtration, absorbents, fillers, insulation, and cement manufacture. Economic deposits of diatomite within the United States depend on variations in the physical and chemical properties between and within deposits, potential end uses, and proximity to suitable markets. On the basis of historical production figures, estimated U.S. diatomite-production capacity is currently about 800,000 metric tons per year (t/yr).

19 CFR 143.2 - Application.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Application. 143.2 Section 143.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... description of the computer hardware, communications and entry processing systems to be used and the estimated...

Phase-Contrast Hounsfield Units of Fixated and Non-Fixated Soft-Tissue Samples

Science.gov (United States)

Willner, Marian; Fior, Gabriel; Marschner, Mathias; Birnbacher, Lorenz; Schock, Jonathan; Braun, Christian; Fingerle, Alexander A.; Noël, Peter B.; Rummeny, Ernst J.; Pfeiffer, Franz; Herzen, Julia

2015-01-01

X-ray phase-contrast imaging is a novel technology that achieves high soft-tissue contrast. Although its clinical impact is still under investigation, the technique may potentially improve clinical diagnostics. In conventional attenuation-based X-ray computed tomography, radiological diagnostics are quantified by Hounsfield units. Corresponding Hounsfield units for phase-contrast imaging have been recently introduced, enabling a setup-independent comparison and standardized interpretation of imaging results. Thus far, the experimental values of few tissue types have been reported; these values have been determined from fixated tissue samples. This study presents phase-contrast Hounsfield units for various types of non-fixated human soft tissues. A large variety of tissue specimens ranging from adipose, muscle and connective tissues to liver, kidney and pancreas tissues were imaged by a grating interferometer with a rotating-anode X-ray tube and a photon-counting detector. Furthermore, we investigated the effects of formalin fixation on the quantitative phase-contrast imaging results. PMID:26322638

Comparison of the APA-H (Westinghouse) calculations with the operational data for ZpNPP unit 3 cycles 16-19

International Nuclear Information System (INIS)

Abdullayev, A. M.; Gorbachenko, O. V.; Ignatchenko, A.I.; Maryokhin, S.V.; Zhukov, A. I.

2007-01-01

The computer simulation of ZpNPP Unit 3 (WWER-1000) Cycles 16-19 core depletion has been performed on the basis of the operational data. The changes in reactor heat rate, lead bank position and inlet temperature during the core operation have been taken into account. These calculations were performed by using Westinghouse APA-H (ALPHA/PHOENIX/ ANC-H) code system. The main objectives of the calculations were the comparison with operational data for core loading with TVS-M (Cycle 16) and transition core loading with TVS-A (Cycle 17-19). The calculation results were compared with the results of Critical boric acid concentration vs. Cycle Burnup measurements and Start up Physics Test measurements (at HZP, BOC, NoXe core conditions). Additionally, the comparison between the results of assemblies power calculation performed by ANC-H and BIPR-7A codes is presented (Authors)

46 CFR 386.19 - Dogs and other animals.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Dogs and other animals. 386.19 Section 386.19 Shipping... AND GROUNDS AT THE UNITED STATES MERCHANT MARINE ACADEMY § 386.19 Dogs and other animals. Persons are prohibited from bringing dogs and other animals on to the Academy premises, except for authorized purposes...

Relational Inequality: Gender Earnings Inequality in U.S. and Japanese Manufacturing Plants in the Early 1980s

Science.gov (United States)

Avent-Holt, Dustin; Tomaskovic-Devey, Donald

2012-01-01

We examine the relational model of inequality using samples of employer-employee matched data from manufacturing plants in the United States and Japan. We argue that gender is a salient status characteristic in both the United States and Japan, but because of differences in gender politics, wage inequality will vary more across U.S. workplaces…

29 CFR 501.19 - Civil money penalty assessment.

Science.gov (United States)

2010-07-01

... workers. (c) A civil money penalty for each violation of the work contract or a requirement of 8 U.S.C..., with the following exceptions: (1) A civil money penalty for each willful violation of the work... 29 Labor 3 2010-07-01 2010-07-01 false Civil money penalty assessment. 501.19 Section 501.19 Labor...

Genotyping of human parvovirus B19 in clinical samples from Brazil and Paraguay using heteroduplex mobility assay, single-stranded conformation polymorphism and nucleotide sequencing

Directory of Open Access Journals (Sweden)

Marcos César Lima de Mendonça

2011-06-01

Full Text Available Heteroduplex mobility assay, single-stranded conformation polymorphism and nucleotide sequencing were utilised to genotype human parvovirus B19 samples from Brazil and Paraguay. Ninety-seven serum samples were collected from individuals presenting with abortion or erythema infectiosum, arthropathies, severe anaemia and transient aplastic crisis; two additional skin samples were collected by biopsy. After the procedure, all clinical samples were classified as genotype 1.

Human Parvovirus B19 NS1 Protein Aggravates Liver Injury in NZB/W F1 Mice

Science.gov (United States)

Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Hsu, Huai-Sheng; Tzang, Bor-Show; Hsu, Tsai-Ching

2013-01-01

Human parvovirus B19 (B19) has been associated with a variety of diseases. However, the influence of B19 viral proteins on hepatic injury in SLE is still obscure. To elucidate the effects of B19 viral proteins on livers in SLE, recombinant B19 NS1, VP1u or VP2 proteins were injected subcutaneously into NZB/W F1 mice, respectively. Significant expressions of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) were detected in NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Markedly hepatocyte disarray and lymphocyte infiltration were observed in livers from NZB/WF 1 mice receiving B19 NS1 as compared to those mice receiving PBS. Additionally, significant increases of Tumor Necrosis Factor –α (TNF-α), TNF-α receptor, IκB kinase –α (IKK-α), nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor (IκB) and nuclear factor-kappa B (NF-κB) were detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Accordingly, significant increases of matrix metalloproteinase-9 (MMP9) and U-plasminogen activator (uPA) were also detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Contrarily, no significant variation on livers from NZB/W F1 mice receiving B19 VP1u or VP2 was observed as compared to those mice receiving PBS. These findings firstly demonstrated the aggravated effects of B19 NS1 but not VP1u or VP2 protein on hepatic injury and provide a clue in understanding the role of B19 NS1 on hepatic injury in SLE. PMID:23555760

Sampling and Analysis Plan for U.S. Department of Energy Office of Legacy Management Sites

International Nuclear Information System (INIS)

2012-01-01

This plan incorporates U.S. Department of Energy (DOE) Office of Legacy Management (LM) standard operating procedures (SOPs) into environmental monitoring activities and will be implemented at all sites managed by LM. This document provides detailed procedures for the field sampling teams so that samples are collected in a consistent and technically defensible manner. Site-specific plans (e.g., long-term surveillance and maintenance plans, environmental monitoring plans) document background information and establish the basis for sampling and monitoring activities. Information will be included in site-specific tabbed sections to this plan, which identify sample locations, sample frequencies, types of samples, field measurements, and associated analytes for each site. Additionally, within each tabbed section, program directives will be included, when developed, to establish additional site-specific requirements to modify or clarify requirements in this plan as they apply to the corresponding site. A flowchart detailing project tasks required to accomplish routine sampling is displayed in Figure 1. LM environmental procedures are contained in the Environmental Procedures Catalog (LMS/PRO/S04325), which incorporates American Society for Testing and Materials (ASTM), DOE, and U.S. Environmental Protection Agency (EPA) guidance. Specific procedures used for groundwater and surface water monitoring are included in Appendix A. If other environmental media are monitored, SOPs used for air, soil/sediment, and biota monitoring can be found in the site-specific tabbed sections in Appendix D or in site-specific documents. The procedures in the Environmental Procedures Catalog are intended as general guidance and require additional detail from planning documents in order to be complete; the following sections fulfill that function and specify additional procedural requirements to form SOPs. Routine revision of this Sampling and Analysis Plan will be conducted annually at the

Sampling and Analysis Plan for U.S. Department of Energy Office of Legacy Management Sites

Energy Technology Data Exchange (ETDEWEB)

None

2012-10-24

This plan incorporates U.S. Department of Energy (DOE) Office of Legacy Management (LM) standard operating procedures (SOPs) into environmental monitoring activities and will be implemented at all sites managed by LM. This document provides detailed procedures for the field sampling teams so that samples are collected in a consistent and technically defensible manner. Site-specific plans (e.g., long-term surveillance and maintenance plans, environmental monitoring plans) document background information and establish the basis for sampling and monitoring activities. Information will be included in site-specific tabbed sections to this plan, which identify sample locations, sample frequencies, types of samples, field measurements, and associated analytes for each site. Additionally, within each tabbed section, program directives will be included, when developed, to establish additional site-specific requirements to modify or clarify requirements in this plan as they apply to the corresponding site. A flowchart detailing project tasks required to accomplish routine sampling is displayed in Figure 1. LM environmental procedures are contained in the Environmental Procedures Catalog (LMS/PRO/S04325), which incorporates American Society for Testing and Materials (ASTM), DOE, and U.S. Environmental Protection Agency (EPA) guidance. Specific procedures used for groundwater and surface water monitoring are included in Appendix A. If other environmental media are monitored, SOPs used for air, soil/sediment, and biota monitoring can be found in the site-specific tabbed sections in Appendix D or in site-specific documents. The procedures in the Environmental Procedures Catalog are intended as general guidance and require additional detail from planning documents in order to be complete; the following sections fulfill that function and specify additional procedural requirements to form SOPs. Routine revision of this Sampling and Analysis Plan will be conducted annually at the

Taxonomic classification of world map units in crop producing areas of Argentina and Brazil with representative US soil series and major land resource areas in which they occur

Science.gov (United States)

Huckle, H. F. (Principal Investigator)

1980-01-01

The most probable current U.S. taxonomic classification of the soils estimated to dominate world soil map units (WSM)) in selected crop producing states of Argentina and Brazil are presented. Representative U.S. soil series the units are given. The map units occurring in each state are listed with areal extent and major U.S. land resource areas in which similar soils most probably occur. Soil series sampled in LARS Technical Report 111579 and major land resource areas in which they occur with corresponding similar WSM units at the taxonomic subgroup levels are given.

Tank vapor characterization project - Tank 241-U-112 headspace gas and vapor characterization: Results for homogeneity samples collected on December 6, 1996

Energy Technology Data Exchange (ETDEWEB)

Sklarew, D.S.; Pool, K.H.; Evans, J.C.; Hayes, J.C. [and others

1997-09-01

This report presents the results of analyses of samples taken from the headspace of waste storage tank 241-U-112 (Tank U-112) at the Hanford Site in Washington State. Samples were collected to determine the homogeneity of selected inorganic and organic headspace constitutents. Two risers (Riser 3 and Riser 6) were sampled at three different elevations (Bottom, Middle, and Top) within the tank. Tank headspace samples were collected by SGN Eurisys Service Corporation (SESC) and were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan.

19 CFR 12.32 - Honeybees and honeybee semen.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Honeybees and honeybee semen. 12.32 Section 12.32... semen. (a) Honeybees from any country may be imported into the U.S. by the Department of Agriculture for.... (b) Honeybee semen may be imported into the U.S. only from countries determined by the Secretary of...

The 4th surveillance testing for Kori unit 3 reactor vessel materials

Energy Technology Data Exchange (ETDEWEB)

Chang, Kee Ok; Kim, Byoung Chul; Lee, Sam Lai; Choi, Kwun Jae; Gong, Un Sik; Chang, Jong Hwa; Joo, Yong Sun; Ahn, Sang Bok; Hong, Joon Hwa [Korea Atomic Energy Research Institute, Taejeon (Korea)

2000-10-01

Surveillance testing for reactor vessel materials is performed in order to evaluate the irradiation embrittlement due to neutrons during operation and set the condition of safe operation of nuclear reactor. The 4th surveillance testing was performed completely by Korea Atomic Energy Research Institute at Taejeon after the capsule was transported from Kori site including its removal from reactor. Fast neutron fluences for capsules were calculated and various testing including mechanical and chemistry analysis were performed in order to evaluate the integrity of Kori unit 3 reactor vessel during the operation until life time. The evaluation results are as follows; Fast neutron fluences for capsules U, V, X and W are 4.983E+18, 1.641E+19, 3.158E+19, and 4.469E+19n/cm{sup 2}, respectively. The bias factor, the ratio of calculation/measurement, was 0.840 for the 1st through 4th testing and the calculational uncertainty, 12% satisfied the requirement of USNRC Reg.Guide DG-1053, 20%. The best estimated neutron fluence for reactor vessel inside surface was 1.362E+19n/cm{sup 2} based on the end of 12th fuel cycle and it was predicted that the fluences of vessel inside surface at 32, 40, 48 and 56EFPY would reach 3.481E+19, 4.209E+19, 5.144E+19 and 5.974E+19n/cm{sup 2} based on the current calculation. The result through this analysis for Kori unit 3 showed that there would be no problem for the pressurized thermal shock(PTS) during the operation until design life. 48 refs., 35 figs., 41 tabs. (Author)

Groundwater-quality data in seven GAMA study units: results from initial sampling, 2004-2005, and resampling, 2007-2008, of wells: California GAMA Program Priority Basin Project

Science.gov (United States)

Kent, Robert; Belitz, Kenneth; Fram, Miranda S.

2014-01-01

The Priority Basin Project (PBP) of the Groundwater Ambient Monitoring and Assessment (GAMA) Program was developed in response to the Groundwater Quality Monitoring Act of 2001 and is being conducted by the U.S. Geological Survey (USGS) in cooperation with the California State Water Resources Control Board (SWRCB). The GAMA-PBP began sampling, primarily public supply wells in May 2004. By the end of February 2006, seven (of what would eventually be 35) study units had been sampled over a wide area of the State. Selected wells in these first seven study units were resampled for water quality from August 2007 to November 2008 as part of an assessment of temporal trends in water quality by the GAMA-PBP. The initial sampling was designed to provide a spatially unbiased assessment of the quality of raw groundwater used for public water supplies within the seven study units. In the 7 study units, 462 wells were selected by using a spatially distributed, randomized grid-based method to provide statistical representation of the study area. Wells selected this way are referred to as grid wells or status wells. Approximately 3 years after the initial sampling, 55 of these previously sampled status wells (approximately 10 percent in each study unit) were randomly selected for resampling. The seven resampled study units, the total number of status wells sampled for each study unit, and the number of these wells resampled for trends are as follows, in chronological order of sampling: San Diego Drainages (53 status wells, 7 trend wells), North San Francisco Bay (84, 10), Northern San Joaquin Basin (51, 5), Southern Sacramento Valley (67, 7), San Fernando–San Gabriel (35, 6), Monterey Bay and Salinas Valley Basins (91, 11), and Southeast San Joaquin Valley (83, 9). The groundwater samples were analyzed for a large number of synthetic organic constituents (volatile organic compounds [VOCs], pesticides, and pesticide degradates), constituents of special interest (perchlorate, N

19 CFR 163.7 - Summons.

Science.gov (United States)

2010-04-01

... summons is prima facie evidence of the facts it states. (d) Transcript of testimony under oath. Testimony... 19 Customs Duties 2 2010-04-01 2010-04-01 false Summons. 163.7 Section 163.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED...

19 CFR 191.2 - Definitions.

Science.gov (United States)

2010-04-01

... under the provision for the substitution of finished petroleum derivatives, § 313(p), as amended (19 U.S... identified for purposes of direct identification drawback by use of the accounting methods provided for in... (CONTINUED) DRAWBACK General Provisions § 191.2 Definitions. For the purposes of this part: (a) Abstract...

19 CFR 174.32 - Publication.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Publication. 174.32 Section 174.32 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) PROTESTS Review and Disposition of Protests § 174.32 Publication. Within 120 days after issuing a...

19 CFR 101.0 - Scope.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 101.0 Section 101.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY GENERAL PROVISIONS § 101.0 Scope. This part sets forth general regulations governing the authority of Customs...

19 CFR 113.0 - Scope.

Science.gov (United States)

2010-04-01

... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...

19 CFR 115.2 - Application.

Science.gov (United States)

2010-04-01

... Customs Convention on Containers, 1972, may be accomplished by the competent authority of the country in... 19 Customs Duties 1 2010-04-01 2010-04-01 false Application. 115.2 Section 115.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO...

19 CFR 12.18 - Labels.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Labels. 12.18 Section 12.18 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Viruses, Serums, and Toxins for Treatment of Domestic Animals § 12.18 Labels. Each...

Determination of beta-adrenergic receptor blocking pharmaceuticals in united states wastewater effluent

Energy Technology Data Exchange (ETDEWEB)

Huggett, D.B.; Khan, I.A.; Foran, C.M.; Schlenk, D

2003-02-01

This is the first report of beta-adrenergic receptor antagonist pharmaceuticals in United States wastewater effluent. - Beta adrenergic receptor antagonists ({beta}-Blockers) are frequently prescribed medications in the United States and have been identified in European municipal wastewater effluent, however no studies to date have investigated these compounds in United States wastewater effluent. Municipal wastewater effluent was collected from treatment facilities in Mississippi, Texas, and New York to investigate the occurrence of metoprolol, nadolol, and propranolol. Propranolol was identified in all wastewater samples analyzed (n=34) at concentrations {<=}1.9 {mu}g/l. Metoprolol and nadolol were identified in {>=}71% of the samples with concentrations of metoprolol {<=}1.2 {mu}g/l and nadolol {<=}0.36 {mu}g/l. Time course studies at both Mississippi plants and the Texas plant indicate that concentrations of propranolol, metoprolol, and nadolol remain relatively constant at each sampling period. This study indicates that {beta}-Blockers are present in United States wastewater effluent in the ng/l to {mu}g/l range.

Ability To Serologically Confirm Recent Zika Virus Infection in Areas with Varying Past Incidence of Dengue Virus Infection in the United States and U.S. Territories in 2016.

Science.gov (United States)

Lindsey, Nicole P; Staples, J Erin; Powell, Krista; Rabe, Ingrid B; Fischer, Marc; Powers, Ann M; Kosoy, Olga I; Mossel, Eric C; Munoz-Jordan, Jorge L; Beltran, Manuela; Hancock, W Thane; Toews, Karrie-Ann E; Ellis, Esther M; Ellis, Brett R; Panella, Amanda J; Basile, Alison J; Calvert, Amanda E; Laven, Janeen; Goodman, Christin H; Gould, Carolyn V; Martin, Stacey W; Thomas, Jennifer D; Villanueva, Julie; Mataia, Mary L; Sciulli, Rebecca; Gose, Remedios; Whelen, A Christian; Hills, Susan L

2018-01-01

Cross-reactivity within flavivirus antibody assays, produced by shared epitopes in the envelope proteins, can complicate the serological diagnosis of Zika virus (ZIKAV) infection. We assessed the utility of the plaque reduction neutralization test (PRNT) to confirm recent ZIKAV infections and rule out misleading positive immunoglobulin M (IgM) results in areas with various levels of past dengue virus (DENV) infection incidence. We reviewed PRNT results of sera collected for diagnosis of ZIKAV infection from 1 January through 31 August 2016 with positive ZIKAV IgM results, and ZIKAV and DENV PRNTs were performed. PRNT result interpretations included ZIKAV, unspecified flavivirus, DENV infection, or negative. For this analysis, ZIKAV IgM was considered false positive for samples interpreted as a DENV infection or negative. In U.S. states, 208 (27%) of 759 IgM-positive results were confirmed to be ZIKAV compared to 11 (21%) of 52 in the U.S. Virgin Islands (USVI), 15 (15%) of 103 in American Samoa, and 13 (11%) of 123 in Puerto Rico. In American Samoa and Puerto Rico, more than 80% of IgM-positive results were unspecified flavivirus infections. The false-positivity rate was 27% in U.S. states, 18% in the USVI, 2% in American Samoa, and 6% in Puerto Rico. In U.S. states, the PRNT provided a virus-specific diagnosis or ruled out infection in the majority of IgM-positive samples. Almost a third of ZIKAV IgM-positive results were not confirmed; therefore, providers and patients must understand that IgM results are preliminary. In territories with historically higher rates of DENV transmission, the PRNT usually could not differentiate between ZIKAV and DENV infections. This is a work of the U.S. Government and is not subject to copyright protection in the United States. Foreign copyrights may apply.

Samples in applied psychology: over a decade of research in review.

Science.gov (United States)

Shen, Winny; Kiger, Thomas B; Davies, Stacy E; Rasch, Rena L; Simon, Kara M; Ones, Deniz S

2011-09-01

This study examines sample characteristics of articles published in Journal of Applied Psychology (JAP) from 1995 to 2008. At the individual level, the overall median sample size over the period examined was approximately 173, which is generally adequate for detecting the average magnitude of effects of primary interest to researchers who publish in JAP. Samples using higher units of analyses (e.g., teams, departments/work units, and organizations) had lower median sample sizes (Mdn ≈ 65), yet were arguably robust given typical multilevel design choices of JAP authors despite the practical constraints of collecting data at higher units of analysis. A substantial proportion of studies used student samples (~40%); surprisingly, median sample sizes for student samples were smaller than working adult samples. Samples were more commonly occupationally homogeneous (~70%) than occupationally heterogeneous. U.S. and English-speaking participants made up the vast majority of samples, whereas Middle Eastern, African, and Latin American samples were largely unrepresented. On the basis of study results, recommendations are provided for authors, editors, and readers, which converge on 3 themes: (a) appropriateness and match between sample characteristics and research questions, (b) careful consideration of statistical power, and (c) the increased popularity of quantitative synthesis. Implications are discussed in terms of theory building, generalizability of research findings, and statistical power to detect effects. PsycINFO Database Record (c) 2011 APA, all rights reserved

REIMEP-22 inter-laboratory comparison: "U Age Dating - Determination of the production date of a uranium certified test sample"

OpenAIRE

VENCHIARUTTI CELIA; VARGA ZSOLT; RICHTER Stephan; JAKOPIC Rozle; MAYER Klaus; AREGBE Yetunde

2015-01-01

The REIMEP-22 inter-laboratory comparison aimed at determining the production date of a uranium certified test sample (i.e. the last chemical separation date of the material). Participants in REIMEP-22 on "U Age Dating - Determination of the production date of a uranium certified test sample" received one low-enriched 20 mg uranium sample for mass spectrometry measurements and/or one 50 mg uranium sample for D-spectrometry measurements, with an undisclosed value for the production date. They ...

40Ar/39Ar dating and zircon chronochemistry for the Izu-Bonin rear arc, IODP site U1437

Science.gov (United States)

Schmitt, A. K.; Konrad, K.; Andrews, G. D.; Horie, K.; Brown, S. R.; Koppers, A. A. P.; Busby, C.; Tamura, Y.

2016-12-01

The scientific objective of IODP Expedition 350 drilling at Site U1437 (31°47.390'N, 139°01.580'E) was to reveal the "missing half of the subduction factory": the rear arc of a long-lived intraoceanic subduction zone. Site U1437 lies in a 50 km long and 20 km wide volcano-bounded basin, 90 km west of the Izu arc front, and is the only IODP site drilled in the rear arc. The Izu rear arc is dominated by Miocene basaltic to dacitic seamount chains, which strike at a high angle to the arc front. Radiometric dating targeted a single igneous unit (1390 mbsf), and fine to coarse volcaniclastic units for which we present zircon and 40Ar/39Ar (hornblende, plagioclase, and groundmass) age determinations. All zircons analyzed as grain separates were screened for contamination from drill-mud (Andrews et al., 2016) by analyzing trace elements and, where material was available, O and Hf isotope compositions. Igneous Unit 1 is a rhyolite sheet and yielded concordant in-situ and crystal separate U-Pb zircon ages (13.7±0.3 Ma; MSWD = 1.3; n = 40 spots), whereas the 40Ar/39Ar hornblende plateau age (12.9±0.3; MSWD = 1.1; n = 9 steps) is slightly younger, possibly reflecting pre-eruptive zircon crystallization, or alteration of hornblende. U-Pb zircon and 40Ar/39Ar plateau ages from samples above igneous Unit 1 are concordant with biostratigraphic and paleomagnetic ages (available to 1300 mbsf), but plagioclase and groundmass samples below 1300 m become younger with depth, hinting at post-depositional alteration. A single zircon from 1600 mbsf yielded a U-Pb age of 15.4±1.8 Ma; its trace element composition resembles other igneous zircons from U1437, and is tentatively interpreted as a Middle Miocene age for the lowermost lithostratigraphic unit VII. Oxygen and Hf isotopic values of igneous zircon indicate mantle origins, with some influence of assimilation of hydrothermally altered oceanic crust evident in sub-mantle oxygen isotopic compositions. Lessons from site U1437 are

Effect of alpha self irradiation on helium migration in (U,Pu)O2 samples

International Nuclear Information System (INIS)

Pipon, Yves; Roudil, Daniele; Jegou, Christophe; Khodja, Hicham; Raepsaet, Caroline

2008-01-01

The helium behavior and its migration mechanisms in nuclear spent fuel (UOX and MOX) significantly impact the possible evolution of the spent fuel matrix in a closed system during interim storage or during a disposal repository. An experimental study has been conducted on (U,Pu)O 2 samples in order to investigate the impact of defects created by alpha decay on helium diffusion. One large part is devoted to thermal atomic diffusion and applied on 3 He implanted samples, annealed at 850 and 1000 deg. C. The He profiles, as implanted and after annealing, were investigated with the 3 He(d,p) 4 He nuclear reaction. Another part deals with the thermal release of 4 He amassed in the samples. The measured thermal diffusion coefficients are compared with previously published values, thereby highlighting the effect of the alpha self-irradiation on helium behavior. (authors)

International Aviation: Competition Issues in the U.S. - U.K. Market

Science.gov (United States)

1997-06-04

Access to London's Heathrow Airport is important to any airline that desires to : be a major participant in the transatlantic market. Current U.S. bilateral : aviation agreement with the United Kingdom restricts the number of U.S. airlines : that can...

The 1990 conterminous U.S. AVHRR data set

International Nuclear Information System (INIS)

Eidenshink, J.C.

1992-01-01

The U.S. Geological Survey, using NOAA-11 Advanced Very High Resolution Radiometer (AVHRR) 1-km data, has produced a time series of 19 biweekly maximum normalized difference vegetation index (NDVI) composites of the conterminous United States for the 1990 growing season. Each biweekly composite included data from approximately 20 calibrated and georegistered daily overpasses. The output is a data set which includes all five calibrated AVHRR channels, NDVI values, three satellite/solar viewing angles, and date of observation pointer for each biweekly composite. The data set is intended for assessing seasonal variations in vegetation condition and provides a foundation for studying long-term changes in vegetation resulting from human interactions or global climate alterations. 12 refs

Negative and Positive Outflow-Feedback in Nearby (U)LIRGs

Energy Technology Data Exchange (ETDEWEB)

Cazzoli, Sara, E-mail: sara@iaa.es [Instituto de Astrofisica de Andalucia (CSIC), Granada (Spain)

2017-12-15

The starburst-AGN coexistence in local (U)LIRGs makes these galaxies excellent laboratories for the study of stellar and AGN outflows and feedback. Outflows regulate star formation and AGN activity, redistributing gas, dust and metals over large scales in the interstellar and intergalactic media (negative feedback) being also considered to be able to undergo vigorous star formation (positive feedback). In this contribution, I will summarize the results from a search for outflows in a sample of nearby 38 local (U)LIRG systems observed with VIMOS/VLT integral field unit. For two galaxies of the sample I will detail the outflow properties and discuss the observational evidence for negative and positive outflow-feedback. The assessment of both negative and positive feedback effects represent a novel approach toward a comprehensive understanding of the impact of outflow feedback in the galaxy evolution.

Human parvovirus B19 (B19V) infection in systemic sclerosis patients

DEFF Research Database (Denmark)

Zakrzewska, K.; Corcioli, F.; Carlsen, Karen Marie

2009-01-01

BACKGROUND: Our previous reports suggested a possible association between parvovirus B19 (B19V) infection and systemic sclerosis (SSc), based on higher prevalence of B19V DNA in SSc patients in respect to controls. METHODS: In the present study, to further evaluate the differences in the pattern...... of B19 infection in SSc, skin biopsies and bone marrow samples from patients and controls were analysed for B19V DNA detection, genotyping and viral expression. RESULTS: B19V DNA was detected in skin biopsies from 39/49 SSc patients and from 20/28 controls. Bone marrow showed positive in 17/29 SSc...... in the skin of genotype 1-positive patients and not in control skins. CONCLUSION: The results outline some differences in the rate of persistence of B19V DNA, in the simultaneous persistence of 2 genotypes and in the pattern of viral expression among SSc patients and controls Udgivelsesdato: 2009...

19 CFR 207.69 - Publication of determinations.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Publication of determinations. 207.69 Section 207.69 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS... SUBSIDIZED EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.69 Publication of determinations. Whenever...

Data Validation Package October 2015 Groundwater and Surface Water Sampling at the Monticello, Utah, Processing Site January 2016

Energy Technology Data Exchange (ETDEWEB)

Nguyen, Jason [U.S. Dept. of Energy, Washington, DC (United States). Office of Legacy Management; Smith, Fred [Navarro Research and Engineering, Inc., Oak Ridge, TN (United States)

2016-01-21

Sampling Period: October 12–14, 2015. This semiannual event includes sampling groundwater and surface water at the Monticello Mill Tailings Site. Sampling and analyses were conducted as specified in the 2004 Monticello Mill Tailings Site Operable Unit III Post-Record of Decision Monitoring Plan, Draft Final and Sampling and Analysis Plan for U.S. Department of Energy Office of Legacy Management Sites (LMS/PRO/S04351, continually updated). Samples were collected from 52 of 61 planned locations (15 of 17 former mill site wells, 17 of 18 downgradient wells, 9 of 9 downgradient permeable reactive barrier wells, 2 of 7 seeps and wetlands, and 9 of 10 surface water locations). Locations MW00-07, Seep 1, Seep 2, Seep 3, Seep 5, Seep 6, SW00-01, T01-13, and T01-19 were not sampled because of insufficient water availability. All samples were filtered as specified in the monitoring plan. Duplicate samples were collected from surface water location W3-04 and from monitoring wells 82-08, 92-09, and 92-10. Water levels were measured at all but one sampled well and an additional set of wells. The contaminants of concern (COCs) for the Monticello Mill Tailings Site are arsenic, manganese, molybdenum, nitrate + nitrite as nitrogen (nitrate + nitrite as N), selenium, uranium, and vanadium. Time-concentration graphs of the COCs for all groundwater and surface water locations are included in this report. Locations with COCs that exceeded remediation goals are listed.

19 CFR 10.212 - Definitions.

Science.gov (United States)

2010-04-01

...) which has been the subject of a finding by the President or his designee, published in the Federal... Opportunity Act (19 U.S.C. 3722) and which the President has designated as a beneficiary sub-Saharan African... Mexico on December 17, 1992. Originating. “Originating” means having the country of origin determined by...

19 CFR 173.0 - Scope.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Scope. 173.0 Section 173.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ADMINISTRATIVE REVIEW IN GENERAL § 173.0 Scope. This part deals with the general authority of review, the...

Mendelian breeding units versus standard sampling strategies: mitochondrial DNA variation in southwest Sardinia

Directory of Open Access Journals (Sweden)

Daria Sanna

2011-01-01

Full Text Available We report a sampling strategy based on Mendelian Breeding Units (MBUs, representing an interbreeding group of individuals sharing a common gene pool. The identification of MBUs is crucial for case-control experimental design in association studies. The aim of this work was to evaluate the possible existence of bias in terms of genetic variability and haplogroup frequencies in the MBU sample, due to severe sample selection. In order to reach this goal, the MBU sampling strategy was compared to a standard selection of individuals according to their surname and place of birth. We analysed mitochondrial DNA variation (first hypervariable segment and coding region in unrelated healthy subjects from two different areas of Sardinia: the area around the town of Cabras and the western Campidano area. No statistically significant differences were observed when the two sampling methods were compared, indicating that the stringent sample selection needed to establish a MBU does not alter original genetic variability and haplogroup distribution. Therefore, the MBU sampling strategy can be considered a useful tool in association studies of complex traits.

The Effect of Rolling As-Cast and Homogenized U-10Mo Samples on the Microstructure Development and Recovery Curves

Energy Technology Data Exchange (ETDEWEB)

Joshi, Vineet V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Paxton, Dean M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lavender, Curt A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Burkes, Douglas [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2016-07-30

Over the past several years Pacific Northwest National Laboratory (PNNL) has been actively involved in supporting the U.S. Department of Energy National Nuclear Security Administration Office of Material Management and Minimization (formerly Global Threat Reduction Initiative). The U.S. High- Power Research Reactor (USHPRR) project is developing alternatives to existing highly enriched uranium alloy fuel to reduce the proliferation threat. One option for a high-density metal fuel is uranium alloyed with 10 wt% molybdenum (U-10Mo). Forming the U-10Mo fuel plates/foils via rolling is an effective technique and is actively being pursued as part of the baseline manufacturing process. The processing of these fuel plates requires systematic investigation/understanding of the pre- and post-rolling microstructure, end-state mechanical properties, residual stresses, and defects, their effect on the mill during processing, and eventually, their in-reactor performance. In the work documented herein, studies were conducted to determine the effect of cold and hot rolling the as-cast and homogenized U-10Mo on its microstructure and hardness. The samples were homogenized at 900°C for 48 h, then later annealed for several durations and temperatures to investigate the effect on the material’s microstructure and hardness. The rolling of the as-cast plate, both hot and cold, was observed to form a molybdenum-rich and -lean banded structure. The cold rolling was ineffective, and in some cases exacerbated the as-cast defects. The grains elongated along the rolling direction and formed a pancake shape, while the carbides fractured perpendicularly to the rolling direction and left porosity between fractured particles of UC. The subsequent annealing of these samples at sub-eutectoid temperatures led to rapid precipitation of the ' lamellar phase, mainly in the molybdenum-lean regions. Annealing the samples above the eutectoid temperature did not refine the grain size or the banded

Prevalence of Hearing Loss Among a Representative Sample of Canadian Children and Adolescents, 3 to 19 Years of Age.

Science.gov (United States)

Feder, Katya Polena; Michaud, David; McNamee, James; Fitzpatrick, Elizabeth; Ramage-Morin, Pamela; Beauregard, Yves

There are no nationally representative hearing loss (HL) prevalence data available for Canadian youth using direct measurements. The present study objectives were to estimate national prevalence of HL using audiometric pure-tone thresholds (0.5 to 8 kHz) and or distortion product otoacoustic emissions (DPOAEs) for children and adolescents, aged 3 to 19 years. This cross-sectional population-based study presents findings from the 2012/2013 Canadian Health Measures Survey, entailing an in-person household interview and hearing measurements conducted in a mobile examination clinic. The initial study sample included 2591 participants, aged 3 to 19 years, representing 6.5 million Canadians (3.3 million males). After exclusions, subsamples consisted of 2434 participants, aged 3 to 19 years and 1879 participants, aged 6 to 19 years, with valid audiometric results. Eligible participants underwent otoscopic examination, tympanometry, DPOAE, and audiometry. HL was defined as a pure-tone average >20 dB for 6- to 18-year olds and ≥26 dB for 19-year olds, for one or more of the following: four-frequency (0.5, 1, 2, and 4 kHz) pure-tone average, high-frequency (3, 4, 6, and 8 kHz) pure-tone average, and low-frequency (0.5, 1, and 2 kHz) pure-tone average. Mild HL was defined as >20 to 40 dB (6- to 18-year olds) and ≥26 to 40 dB (19-year olds). Moderate or worse HL was defined as >40 dB (6- to 19-year olds). HL in 3- to 5-year olds (n = 555) was defined as absent DPOAEs as audiometry was not conducted. Self-reported HL was evaluated using the Health Utilities Index Mark 3 hearing questions. The primary study outcome indicates that 7.7% of Canadian youth, aged 6 to 19, had any HL, for one or more pure-tone average. Four-frequency pure-tone average and high-frequency pure-tone average HL prevalence was 4.7 and 6.0%, respectively, whereas 5.8% had a low-frequency pure-tone average HL. Significantly more children/adolescents had unilateral HL. Mild HL was significantly

A comparative study of 232Th and 238U activity estimation in soil samples by gamma spectrometry and Neutron Activation Analysis (NAA) technique

International Nuclear Information System (INIS)

Rekha, A.K.; Anilkumar, S.; Narayani, K.; Babu, D.A.R.

2012-01-01

Radioactivity in the environment is mainly due to the naturally occurring radionuclides like uranium, thorium with their daughter products and potassium. Even though Gamma spectrometry is the most commonly used non destructive method for the quantification of these naturally occurring radionuclides, Neutron Activation Analysis (NAA), a well established analytical technique, can also be used. But the NAA technique is a time consuming process and needs proper standards, proper sample preparation etc. In this paper, the 232 Th and 238 U activity estimated using gamma ray spectrometry and NAA technique are compared. In the case of direct gamma spectrometry method, the samples were analysed after sealing in a 250 ml container. Whereas for the NAA, about 300 mg of each sample, after irradiation were subjected to gamma spectrometry. The 238 U and 232 Th activities (in Bq/kg) in samples were estimated after the proper efficiency correction and were compared. The estimated activities by these two methods are in good agreement. The variation in 238 U and 232 Th activity values are within ± 15% which are acceptable for environmental samples

19 CFR 210.21 - Termination of investigations.

Science.gov (United States)

2010-04-01

....21 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.21 Termination of investigations. (a) Motions for... and Human Services, the U.S. Department of Justice, the Federal Trade Commission, the U.S. Customs...

Headspace vapor characterization of Hanford Waste Tank SX-102: Results from samples collected on July 19, 1995. Tank Vapor Characterization Project

International Nuclear Information System (INIS)

McVeety, B.D.; Evans, J.C.; Clauss, T.W.; Pool, K.H.

1996-05-01

This report describes the results of vapor samples taken from the headspace of waste storage tank 241-SX-102 (Tank SX-102) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed under the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5046. Samples were collected by WHC on July 19, 1995, using the vapor sampling system (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace

U.S.-born compared to non-U.S.-born abused women: analysis of baseline data.

Science.gov (United States)

Montalvo-Liendo, Nora; Koci, Anne; McFarlane, Judith; Gilroy, Heidi; Maddoux, John

2013-01-01

It is evident from recent studies that a woman's citizenship status does not exempt her from exposure to partner violence. The purpose of this article was to examine if social support, self-efficacy, and marginalization of abused women differ based on U.S. born compared to non-U.S. born with and without documentation. The findings suggest that women who were born in the United States had significantly higher self-efficacy scores compared to non-U.S.-born women without documents. There were no significant differences in social support among abused women who are U.S. born compared to non-U.S. born with and without documentation. In addition, women who were not born in the United States and did not have documents had higher marginalization.

REIMEP-22 inter-laboratory comparison. ''U Age Dating - determination of the production date of a uranium certified test sample''

Energy Technology Data Exchange (ETDEWEB)

Venchiarutti, Celia; Richter, Stephan; Jakopic, Rozle; Aregbe, Yetunde [European Commission, Joint Research Centre (JRC), Geel (Belgium). Institute for Reference Materials and Measurements (IRMM); Varga, Zsolt; Mayer, Klaus [European Commission, Joint Research Centre (JRC), Karlsruhe (Germany). Institute for Transuranium Elements (ITU)

2015-07-01

The REIMEP-22 inter-laboratory comparison aimed at determining the production date of a uranium certified test sample (i.e. the last chemical separation date of the material). Participants in REIMEP-22 on ''U Age Dating - Determination of the production date of a uranium certified test sample'' received one low-enriched 20 mg uranium sample for mass spectrometry measurements and/or one 50 mg uranium sample for a-spectrometry measurements, with an undisclosed value for the production date. They were asked to report the isotope amount ratios n({sup 230}Th)/n({sup 234}U) for the 20 mg uranium sample and/or the activity ratios A({sup 230}Th)/A({sup 234}U) for the 50 mg uranium sample in addition to the calculated production date of the certified test samples with its uncertainty. Reporting of the {sup 231}Pa/{sup 235}U ratio and the respective calculated production date was optional. Eleven laboratories reported results in REIMEP-22. Two of them reported results for both the 20 mg and 50 mg uranium certified test samples. The measurement capability of the participants was assessed against the independent REIMEP-22 reference value by means of z- and zeta-scores in compliance with ISO 13528:2005. Furthermore a performance assessment criterion for acceptable uncertainty was applied to evaluate the participants' results. In general, the REIMEP-22 participants' results were satisfactory. This confirms the analytical capabilities of laboratories to determine accurately the age of uranium materials with low amount of ingrown thorium (young certified test sample). The Joint Research Centre of the European Commission (EC-JRC) organised REIMEP-22 in parallel to the preparation and certification of a uranium reference material certified for the production date (IRMM-1000a and IRMM-1000b).

The regional distribution and correlates of an entrepreneurship-prone personality profile in the United States, Germany, and the United Kingdom: a socioecological perspective.

Science.gov (United States)

Obschonka, Martin; Schmitt-Rodermund, Eva; Silbereisen, Rainer K; Gosling, Samuel D; Potter, Jeff

2013-07-01

In recent years the topic of entrepreneurship has become a major focus in the social sciences, with renewed interest in the links between personality and entrepreneurship. Taking a socioecological perspective to psychology, which emphasizes the role of social habitats and their interactions with mind and behavior, we investigated regional variation in and correlates of an entrepreneurship-prone Big Five profile. Specifically, we analyzed personality data collected from over half a million U.S. residents (N = 619,397) as well as public archival data on state-level entrepreneurial activity (i.e., business-creation and self-employment rates). Results revealed that an entrepreneurship-prone personality profile is regionally clustered. This geographical distribution corresponds to the pattern that can be observed when mapping entrepreneurial activity across the United States. Indeed, the state-level correlation (N = 51) between an entrepreneurial personality structure and entrepreneurial activity was positive in direction, substantial in magnitude, and robust even when controlling for regional economic prosperity. These correlations persisted at the level of U.S. metropolitan statistical areas (N = 15) and were replicated in independent German (N = 19,842; 14 regions) and British (N = 15,617; 12 regions) samples. In contrast to these profile-based analyses, an analysis linking the individual Big Five dimensions to regional measures of entrepreneurial activity did not yield consistent findings. Discussion focuses on the implications of these findings for interdisciplinary theory development and practical applications. PsycINFO Database Record (c) 2013 APA, all rights reserved.

32 CFR 537.19 - Demands arising from maritime claims.

Science.gov (United States)

2010-07-01

... 32 National Defense 3 2010-07-01 2010-07-01 true Demands arising from maritime claims. 537.19 Section 537.19 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY CLAIMS AND ACCOUNTS CLAIMS ON BEHALF OF THE UNITED STATES § 537.19 Demands arising from maritime claims. (a) It is...

Closure Report for Corrective Action Unit 547: Miscellaneous Contaminated Waste Sites, Nevada National Security Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

NSTec Environmental Restoration

2012-07-17

This Closure Report (CR) presents information supporting closure of Corrective Action Unit (CAU) 547, Miscellaneous Contaminated Waste Sites, and provides documentation supporting the completed corrective actions and confirmation that closure objectives for CAU 547 were met. This CR complies with the requirements of the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the State of Nevada; the U.S. Department of Energy (DOE), Environmental Management; the U.S. Department of Defense; and DOE, Legacy Management (FFACO, 1996 as amended). CAU 547 consists of the following three Corrective Action Sites (CASs), located in Areas 2, 3, and 9 of the Nevada National Security Site: (1) CAS 02-37-02, Gas Sampling Assembly; (2) CAS 03-99-19, Gas Sampling Assembly; AND (3) CAS 09-99-06, Gas Sampling Assembly Closure activities began in August 2011 and were completed in June 2012. Activities were conducted according to the Corrective Action Decision Document/Corrective Action Plan (CADD/CAP) for CAU 547 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2011). The recommended corrective action for the three CASs in CAU 547 was closure in place with administrative controls. The following closure activities were performed: (1) Open holes were filled with concrete; (2) Steel casings were placed over vertical expansion joints and filled with cement; (3) Engineered soil covers were constructed over piping and exposed sections of the gas sampling system components; (4) Fencing, monuments, Jersey barriers, radiological postings, and use restriction (UR) warning signs were installed around the perimeters of the sites; (5) Housekeeping debris was picked up from around the sites and disposed; and (6) Radiological surveys were performed to confirm final radiological postings. UR documentation is included in Appendix D. The post-closure plan was presented in detail in the CADD/CAP for CAU 547 and is included as

Closure Report for Corrective Action Unit 547: Miscellaneous Contaminated Waste Sites, Nevada National Security Site, Nevada

International Nuclear Information System (INIS)

2012-01-01

This Closure Report (CR) presents information supporting closure of Corrective Action Unit (CAU) 547, Miscellaneous Contaminated Waste Sites, and provides documentation supporting the completed corrective actions and confirmation that closure objectives for CAU 547 were met. This CR complies with the requirements of the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the State of Nevada; the U.S. Department of Energy (DOE), Environmental Management; the U.S. Department of Defense; and DOE, Legacy Management (FFACO, 1996 as amended). CAU 547 consists of the following three Corrective Action Sites (CASs), located in Areas 2, 3, and 9 of the Nevada National Security Site: (1) CAS 02-37-02, Gas Sampling Assembly; (2) CAS 03-99-19, Gas Sampling Assembly; AND (3) CAS 09-99-06, Gas Sampling Assembly Closure activities began in August 2011 and were completed in June 2012. Activities were conducted according to the Corrective Action Decision Document/Corrective Action Plan (CADD/CAP) for CAU 547 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2011). The recommended corrective action for the three CASs in CAU 547 was closure in place with administrative controls. The following closure activities were performed: (1) Open holes were filled with concrete; (2) Steel casings were placed over vertical expansion joints and filled with cement; (3) Engineered soil covers were constructed over piping and exposed sections of the gas sampling system components; (4) Fencing, monuments, Jersey barriers, radiological postings, and use restriction (UR) warning signs were installed around the perimeters of the sites; (5) Housekeeping debris was picked up from around the sites and disposed; and (6) Radiological surveys were performed to confirm final radiological postings. UR documentation is included in Appendix D. The post-closure plan was presented in detail in the CADD/CAP for CAU 547 and is included as

Elevated serum CA 19-9 at screening tests: underlying conditions and role of abdominopelvic CT

Energy Technology Data Exchange (ETDEWEB)

Kim, Ji Yang [University of Louisville, Department of Radiology and Molecular Imaging Research Center, Louisville, KY (United States); Seoul National University Hospital, Department of Radiology, Healthcare System Gangnam Center, Seoul (Korea, Republic of); Kim, Se Hyung [Seoul National University Hospital, Department of Radiology and the Institute of Radiation Medicine, Seoul (Korea, Republic of); Kim, Soo Young [Seoul National University Hospital, Department of Radiology, Healthcare System Gangnam Center, Seoul (Korea, Republic of); Bundang CHA Hospital, Department of Radiology, Bundang (Korea, Republic of)

2014-10-15

To investigate underlying conditions of patients with elevated CA 19-9 at screening tests and to evaluate diagnostic performance of abdominopelvic CT. One hundred and thirteen patients with elevated CA 19-9 (>37 U/ml) who underwent abdominopelvic CT in a screening program were selected. Underlying conditions were determined by reviewing all available data and follow-up records. Patients were categorized into malignancy, benign, and normal/non-related disease groups. Their mean CA 19-9 and percent of patients with CA 19-9 ≥ 100 U/ml were compared. Diagnostic sensitivity of CT for detecting underlying conditions of elevated CA 19-9 was analysed. Seventeen patients (17/113, 15 %) had 17 elevated CA 19-9-related malignancies, and 55 patients (55/113, 48.7 %) had 70 benign diseases. Mean CA 19-9 and percent of patients with CA 19-9 ≥ 100 U/ml in the malignancy group were significantly higher than in the two other groups. CT detected all except one malignant lesion with a detection sensitivity of 94.1 % (16/17). Of 70 CA 19-9-related benign diseases, CT detected 34 benign diseases (48.6 %) providing an alternative diagnosis for elevated CA 19-9. Abdominopelvic CT is not only useful in detecting malignancies, but can also diagnose alternative benign causes of elevated CA 19-9 in asymptomatic screening tests. (orig.)

Nizozemska bolest u Bolivarijanskoj Republici Venezueli

OpenAIRE

Jošić, Doc. dr. sc. Hrvoje; Maček Pandak, Fran

2017-01-01

Venezuela je od svog osamostaljenja gospodarstvo temeljila na proizvodnji i izvozu jednog proizvoda. U 19. stoljeću to su bili kava i kakaovac koje je u 20. stoljeću zamijenila nafta. Navedeno je dovelo do nizozemske bolesti koja je gušila ostale gospodarske grane, pa su često korumpirane vlasti kupovale socijalni mir socijalističkim politikama i državnom potrošnjom. 1980-ih došlo je do prvog značajnijeg pada cijene nafte u 20. stoljeću te je Venezuela morala provesti liberalne reforme kako b...

Groundwater-quality data in the northern Coast Ranges study unit, 2009: Results from the California GAMA Program

Science.gov (United States)

Mathany, Timothy M.; Dawson, Barbara J.; Shelton, Jennifer L.; Belitz, Kenneth

2011-01-01

Groundwater quality in the 633-square-mile Northern Coast Ranges (NOCO) study unit was investigated by the U.S. Geological Survey (USGS) from June to November 2009, as part of the California State Water Resources Control Board (SWRCB) Groundwater Ambient Monitoring and Assessment (GAMA) Program's Priority Basin Project (PBP) and the U.S. Geological Survey National Water-Quality Assessment Program (NAWQA). The GAMA-PBP was developed in response to the California Groundwater Quality Monitoring Act of 2001 and is being conducted in collaboration with the SWRCB and Lawrence Livermore National Laboratory (LLNL). The NOCO study unit was the thirtieth study unit to be sampled as part of the GAMA-PBP.

19 CFR 210.22 - [Reserved

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false [Reserved] 210.22 Section 210.22 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.22 [Reserved] ...

File list: Unc.PSC.50.AllAg.P19 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.50.AllAg.P19 mm9 Unclassified Pluripotent stem cell P19 SRX1098121,SRX10981...20,SRX1098122,SRX1098124,SRX1098123,SRX1098125 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.50.AllAg.P19.bed ...

File list: Unc.PSC.05.AllAg.P19 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.05.AllAg.P19 mm9 Unclassified Pluripotent stem cell P19 SRX1098120,SRX10981...23,SRX1098121,SRX1098122,SRX1098125,SRX1098124 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.P19.bed ...

File list: Unc.PSC.20.AllAg.P19 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.20.AllAg.P19 mm9 Unclassified Pluripotent stem cell P19 SRX1098121,SRX10981...20,SRX1098123,SRX1098122,SRX1098124,SRX1098125 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.20.AllAg.P19.bed ...

File list: Unc.PSC.10.AllAg.P19 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Unc.PSC.10.AllAg.P19 mm9 Unclassified Pluripotent stem cell P19 SRX1098120,SRX10981...21,SRX1098122,SRX1098124,SRX1098123,SRX1098125 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.10.AllAg.P19.bed ...

19 CFR 10.222 - Definitions.

Science.gov (United States)

2010-04-01

...” means a “beneficiary country” as defined in § 10.191(b)(1) for purposes of the CBERA which the President... apparel articles under 19 U.S.C. 2703(b)(2) and which has been the subject of a finding by the President... Mexico on December 17, 1992. Preferential treatment. “Preferential treatment” means entry, or withdrawal...

19 CFR 148.44 - Gifts.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Gifts. 148.44 Section 148.44 Customs Duties U.S...) PERSONAL DECLARATIONS AND EXEMPTIONS Exemptions for Nonresidents § 148.44 Gifts. (a) Exemption. An arriving... and are to be disposed of by him as bona fide gifts. See § 148.43(b) for limitations on cigars under...

19 CFR 111.67 - Hearing.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Hearing. 111.67 Section 111.67 Customs Duties U.S... Revocation § 111.67 Hearing. (a) Hearing officer. The hearing officer must be an administrative law judge... right to examine all exhibits offered at the hearing and will have the right to cross-examine witnesses...

19 CFR 210.68 - Complainant's temporary relief bond.

Science.gov (United States)

2010-04-01

... Section 210.68 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Temporary Relief § 210.68 Complainant's temporary... by Individual Surety United States International Trade Commission Affidavit by Individual Surety 19...

Human parvovirus B19 antibodies induce altered membrane protein expression and apoptosis of BeWo trophoblasts.

Science.gov (United States)

Tzang, Bor-Show; Chiang, Szu-Yi; Chan, Hsu-Chin; Liu, Chung-Hsien; Hsu, Tsai-Ching

2016-11-01

Human parvovirus B19 (B19) is harmful during pregnancy since it can be vertically transmitted to the developing fetus. In addition, the anti‑B19 antibodies induced by B19 infection are believed to have a cytopathic role in B19 transmission; however, knowledge regarding the effects of anti‑B19 antibodies during pregnancy is limited. To investigate the possible roles of anti‑B19 antibodies during pregnancy, the present study examined the effects of anti‑B19‑VP1 unique region (VP1u), anti‑B19‑VP2 and anti‑B19‑nonstructural protein 1 (NS1) immunoglobulin G (IgG) antibodies on BeWo trophoblasts. Briefly, BeWo trophoblasts were incubated with purified IgG against B19‑VP1u, B19‑VP2 and B19‑NS1. Subsequently, the expression of surface proteins and apoptotic molecules were assessed in BeWo trophoblasts using flow cytometry, ELISA and western blotting. The expression levels of human leukocyte antigen (HLA)‑G were significantly increased on BeWo trophoblasts treated with rabbit anti‑B19‑VP1u IgG, and were unchanged in those treated with rabbit anti‑B19‑NS1 and anti‑B19‑VP2 IgG, as compared with the control group. Furthermore, the expression levels of globoside (P blood group antigen) and cluster of differentiation (CD)29 (β1 integrin) were significantly increased in BeWo trophoblasts treated with rabbit anti‑B19‑NS1 and anti‑B19‑VP2 IgG, whereas only CD29 was also significantly increased in cells treated with anti‑B19‑VP1u IgG. In addition, the number of cells at sub‑G1 phase; caspase‑3 activity; and the expression of intrinsic and extrinsic apoptotic molecules, including Fas‑associated death domain protein, activated caspase‑8, activated caspase‑3, B‑cell lymphoma 2‑associated X protein, cytochrome c, apoptotic peptidase activating factor 1 and activated caspase‑9, were significantly increased in BeWo trophoblasts treated with anti‑B19‑VP1u and anti‑B19‑NS1 IgG. In conclusion, the present

19 CFR 12.101 - Seizure of prohibited switchblade knives.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure of prohibited switchblade knives. 12.101...; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Switchblade Knives § 12.101 Seizure of prohibited... accordance with § 12.100(a) shall be seized under 19 U.S.C. 1595a(c). (b) Notice of seizure. Notice of...

Measurements at the RA Reactor related to the VISA-2 project - Part 3, calculation of VISA-2 samples influence on the reactor reactivity, on the depression of thermal neutron flux in VK-5 channel and VISA-2 samples; Fizicka merenja na reaktoru RA u vezi projekta VISA-2 - III deo, Proracun uticaja uzoraka VISA-2 na reaktivnost reaktora, na depresiju fluksa termalnih neuntrona u kanalu VK-5 i u uzorcima VISA-2

Energy Technology Data Exchange (ETDEWEB)

Markovic, H; Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1962-07-01

The objective of this task was to determine the thermal neutron flux in the RA reactor cell with VISA-2 samples, the influence of VISA-2 samples on the thermal neutron flux distribution in the vicinity of VK-5 channel and the antireactivity of VISA-2 samples placed in the RA reactor core. This distribution is needed for calculating the mean value of absorption and thermal efficiency factor in the reactor cell with the sample. Thermal neutron flux distribution without the sample was calculated by diffusion theory. Fast neutron flux space distribution was assumed to be constant, i.e. that it is dependent only on the nuclear properties of the materials. Macroscopic thermal neutron flux distribution was determined by two-group diffusion theory using the four factor formula applied for two regions: active RA region, and reactor region with calls containing VISA-2 samples. This calculation enables estimation of the VISA-2 samples influence on the thermal neutron flux distribution in the VK-5 channel. Antireactivity of VISA-2 samples was calculated by neutron diffusion theory applying the perturbation method. [Serbo-Croat] Cilj ovog zadatka je da se odredi raspodela fluksa termalnih neutrona u celiji reaktora RA sa uzorcima VISA-2, uticaj uzoraka VISA-2 na makroskopsku raspodelu termalnih neutrona u blizini uzoraka, tj. u kanalu VK-5, kao i antiraktivnost uzoraka VISA-2 ubacenih u jezgro RA. Poznavanje ove raspodele potrebno je za izracunavanje srednje apsorpcije i faktora termalnog iskoriscenja u celiji reaktora sa uzorkom. Raspodela fluksa termalnih neutrona u celiji RA bez uzorka izracunata je na bazi difuzione teorije. Fluks brzih neutrona uzet je kao konstanta s obzirom na prostorne koordinate, tj. da zavisi samo od nuklearnih karakteristika materijala. Makroskopska raspodela fluksa termalnih neutrona u okolini VISA-2 odredjena je na bazi dvogrupne difuzione teorije preko formule cetiri faktora, primenjene na dve zone: prva aktivna zona RA, i druga reaktorka sredina

U.S. Job Creation Due to Nuclear Power Resurgence in The United States — Volumes 1 and 2

Energy Technology Data Exchange (ETDEWEB)

Catherine M. Plowman

2004-11-01

The recent revival of interest in nuclear power is causing a reexamination of the role of nuclear power in the United States. This renewed interest has led to questions regarding the capability and capacity of current U.S. industries to support a renewal of nuclear power plant deployment. This study was conducted to provide an initial estimate of jobs to be gained in the U.S. through the repatriation of the nuclear manufacturing industry. In the course of the study, related job categories were also modeled to provide an additional estimate of the potential expansion of existing industries (i.e., plant construction and operations) in conjunction with the repatriation of manufacturing jobs.