WorldWideScience

Sample records for samfunn av limnisk

  1. Effects of acidification and cadmium pollution on the populations and habitats of limnetic zooplankton; Effekter av forsuring og kadmium-forurensning paa populasjoner og samfunn av limnisk zooplankton

    Energy Technology Data Exchange (ETDEWEB)

    Schartau, A.K.L. [Norsk Inst. for Naturforskning, Trondheim (Norway)

    1996-01-01

    The conference paper deals with executed field tests on the adding of cadmium alone or combined with acidification of an enclosed space under different nutrient and predatory conditions. The addition of cadmium changed the biomass and the composition of the phytoplankton. In combination with the added nutrient salts, the biomass of special algae increased in the Cd loaded spaces, and the addition of acid changed the effect of Cd concentration by increased production of the same. The effect of a given Cd concentration on the zooplankton varied in a wide range of environmental conditions. 22 refs., 1 tab.

  2. Yrkesfaglærere og elever i et globalisert samfunn - deres utvikling og ontologiske sikkerhet

    OpenAIRE

    Tron Inglar

    2011-01-01

    Hvordan er det å; være yrkesfaglærer og -elev i et globalisert samfunn? Svarene kan utgjøre viktig kunnskap for Å forstå yrkesfaglærere og deres elever, slik at en kan organisere god lærerutdanning og yrkesopplæring. Giddens (1991:14-21) framsetter tre karakteristiske trekk ved dagens samfunn, atskillelsen av tid og rom, utløftingen av sosiale institusjoner og modernitetens refleksivitet. Jeg har valgt å betrakte yrkesfaglærerne i lys av disse fenomenene og har beskrevet ulike trekk ved deres...

  3. Yrkesfaglærere og elever i et globalisert samfunn - deres utvikling og ontologiske sikkerhet

    Directory of Open Access Journals (Sweden)

    Tron Inglar

    2011-05-01

    Full Text Available Hvordan er det å; være yrkesfaglærer og -elev i et globalisert samfunn? Svarene kan utgjøre viktig kunnskap for Å forstå yrkesfaglærere og deres elever, slik at en kan organisere god lærerutdanning og yrkesopplæring. Giddens (1991:14-21 framsetter tre karakteristiske trekk ved dagens samfunn, atskillelsen av tid og rom, utløftingen av sosiale institusjoner og modernitetens refleksivitet. Jeg har valgt å betrakte yrkesfaglærerne i lys av disse fenomenene og har beskrevet ulike trekk ved deres utvikling som lærere og deres ontologiske sikkerhet. Mine hovedkonklusjoner er at de konsekvenser Giddens beskriver som et resultat av det globaliserte samfunnet, ikke preget yrkesfaglærere så dramatisk som forventet bortsett fra at de hyppige reformene i skolen ikke erfares som bare positive. Det var derimot informantenes mening at dagens elever var annerledes enn tidligere.

  4. Postmoderne overbelastning : en komparativ analyse av tre storbyromaner

    OpenAIRE

    Andersen, Øystein

    2006-01-01

    Denne oppgaven er en komparativ analyse av tre storbyromaner; Crash av J.G. Ballard, Requiem for a Dream av Hubert Selby Jr, og Fight Club av Chuck Palahniuk. I hver av disse romanene skildres en form for stagnert storbytilværelse, der hovedkarakterenes liv er repeterende og stillestående. I et postmoderne samfunn i evig forandring, er det viktig å kunne tilpasse seg disse endringene, skifte kurs og ta i bruk nye muligheter. Dette er den postmoderne livsstrategi, en nødvendig strategi for å l...

  5. Kommuneplanens samfunnsdel som forankringsredskap i lokalt folkehelsearbeid : case-studie av en planprosess i en norsk kommune

    OpenAIRE

    Bagge, Cecilie Merethe

    2016-01-01

    Folkehelseloven fra 2012 styrker kommunenes ansvar for folkehelsearbeidet, og har et mål om at folkehelsearbeidet skal foregå i alle etater, ikke bare i helsesektoren. Plan- og bygningsloven fra 2008 styrker kommuneplanleggingen, med kommuneplanens samfunnsdel som retningsgivende for kommuneorganisasjon og -samfunn. Det systematiske folkehelsearbeidet skal styrke koblingen mellom planlegging og folkehelse, og innebærer at oversikt over helsetilstand skal ligge til grunn for fastsetting av fol...

  6. Det «overbestemte» livet?: Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California

    OpenAIRE

    Singstad, Birgit Nestvold

    2011-01-01

    Det “overbestemte” livet? Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California. Denne avhandlingen undersøker hvordan ansatte i IT-bransjen balanserer arbeid og familieliv i Norge, Malaysia og California. Jeg har valgt å undersøke dette i en gruppe høyt utdannede arbeidstakere, og har spurt: Er det slik at et interessant, morsomt og fleksibelt, men krevende arbeidsliv skaper tidsklemmer og balanseproblemer? Eller er det vårt senmoderne samfunn som skaper for m...

  7. Utvikling av et bærekraftsbarometer for norsk lakseoppdrett - Forprosjekt

    OpenAIRE

    Andreassen, Otto; Karlsen, Kine Mari; Robertsen, Roy; Solås, Ann-Magnhild

    2016-01-01

    - Det har vært lansert ønsker fra havbruksnæringen om å utvikle et årlig barometer eller en tilstandsrapportering, som gir en bredere og mer helhetlig forståelse av havbruksnæringens nasjonale bærekraftsutvikling og effekt på miljø og samfunn. I den forbindelse er det gjennomført et forprosjekt, der målet har vært å klargjøre rammer for et førstegenerasjons bærekraftsbarometer. Dette barometeret skal inkluderer miljømessig, økonomisk og sosial bærekraft. The objective of this project wa...

  8. Verdivurdering av Prosafe

    OpenAIRE

    Sanne, Tom

    2006-01-01

    Prosafe ASA er et offshore selskap som eier og driver verdens største flåte av halvtnedsenkbare bolig- og service rigger. I tillegg er de en ledende eier og operatør av flytende produksjons- og lagringsfartøyer. Selskapet har uttrykt følgende visjon: ”Prosafe har som visjon å være en ledende og innovativ leverandør av produkter og tjenester til utvalgte nisjer i den globale olje- og gassindustrien.”(Prosafe.no) Prosafe har mesteparten av sine inntekter, kostnader og gjeldsfo...

  9. Robust AVS Audio Watermarking

    Science.gov (United States)

    Wang, Yong; Huang, Jiwu

    Part III of AVS(China Audio and Video Coding Standard) is the first standard for Hi-Fi audio proposed in China and is becoming more popular in some IT industries. For MP3 audio, some efforts have been made to solve the problems such as copyright pirating and malicious modifications by the way of watermarking. But till now little efforts have been made to solve the same problems for AVS audio. In this paper, we present a novel robust watermarking algorithm which can protect the AVS audio from the above problems. The watermark is embedded into the AVS compressed bit stream. At the extracting end, the watermark bits can be extracted from the compressed bit stream directly without any computation. This algorithm achieves robustness to decoding/recoding attacks, and low complexity of both embedding and extracting while preserves the quality of the audio signals.

  10. Kampklubb : en kommentert oversettelse av Fight club av Chuck Palahniuk

    OpenAIRE

    Gottschalk, Morten Peter

    2006-01-01

    Oppgaven er en kommentert oversettelse av romanen Fight Club av Chuck Palahniuk. Den inneholder en oversettelse av de sju første kapitlene i romanen. Kommentardelen tar for seg oversetterproblemer, og diskuterer disse i detalj. Det dreier seg om stil, syntaks, oversettelse av navn med betydning og problemer der kulturelle forskjeller mellom USA og Norge skaper oversetterproblemer. Som bakgrunnsmateriale brukes Gideon Tourys begreper om adekvate og akseptable oversettelser, og hvordan kildekul...

  11. Restaurangernas val av livsmedel

    OpenAIRE

    Korpihalkola, Janica

    2009-01-01

    Syftet med detta lärdomsprov är att ta reda på vilka livsmedel restaurangerna i Vasa har valt att använda samt varifrån de skaffar sina råvaror och livsmedel. Avsikten var även att undersöka om valet av livsmedel skiljer sig vid lunch och a la carté -mat och om det finns skillnader mellan privata och kedjerestauranger med tanke på val av livsmedel. I teoridelen beskriver jag om hur restaurangerna och deras användning av råvaror har utvecklats på 1900-talet och om olika valmöjligheter som ...

  12. Nykonstruktion av trippelsaxlyftbord

    OpenAIRE

    Gisselman, Niklas

    2010-01-01

    SammanfattningDenna rapport behandlar konstruktion av ett trippelsaxlyftbord. Lyftbord är ett bord som harmöjlighet att lyfta eller sänka en bordsskiva till en höjd som underlättar arbete. Dessa lyftbordutgår från en av SIS standardiserat arbetsgång för att uppfylla CE-märkning. En förändring idenna standard har öppnat en marknad för lyftbord som lågfartshissar upp till 3 våningsplansom Edmolift avser att täcka. Av denna anledning vill Edmolift konstruera etttrippelsaxlyftbord med en kapacite...

  13. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  14. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    2017-01-01

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  15. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  16. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  17. Projektering av robotcell

    OpenAIRE

    Carnbo, Linda; Suonperä, Nadja

    2012-01-01

    Syftet med examensarbetet var att projektera en fysisk robotcell till Haldex i Landskrona, tillverkare av bromshävarmar, då det finns ett behov hos dem att effektivisera sin produktion för att kunna bibehålla konkurrenskraften och tillverkningen i Sverige. Bromshävarmen är en mogen produkt vilket medför att det inte skulle bli lönsamt att omforma den utan istället fokusera på tillverkningen. Därför vore lösningen att automatisera den del av monteringslinan som inte tillför något värde till sl...

  18. Konkurranseutsetting av pleie- og omsorgstjenester : en studie av Oslo kommune

    OpenAIRE

    Seim, Karianne

    2006-01-01

    Sammendrag Siden konkurranseutsetting av pleie- og omsorgstjenester har vært, og er, et omstridt tema, synes jeg at det er spennende å studere hvorfor noen kommuner likevel bestemmer seg for å ta i bruk denne formen for produksjon av sine tjenester, og hvordan de går frem for å gjennomføre dette. For å kunne dekke alle sider ved konkurranseutsetting, valgte jeg derfor å konsentrere meg om å se på innføringen av konkurranseutsetting av pleie- og omsorgstjenester i Oslo kommune. Jeg har...

  19. Utveckling av ett snabblyftblock

    OpenAIRE

    Svensk, Johanna; Schönning, Lisa

    2014-01-01

    Detta examensarbete har genomförts i samarbete med Svero Lifting. Företaget säljer och utvecklar lyftanordningar. Svero Lifting arbetar idag med att reducera vikten på företagets komponenter genom ett materialbyte och har påbörjat utveckling av en ny lyftanordning, en blockvagn och ett snabblyftblock. Svero Lifting vill fortsätta utveckla företagets lyftanordning så att komponenterna i lyftanordningen passar varandra och utmärker sig på marknaden. Idag har Svero Lifting inga CAD-modeller elle...

  20. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  1. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  2. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  3. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  4. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  5. Opplevelsen av god helse på tross av KOLS

    OpenAIRE

    Blakseth, Margrethe

    2017-01-01

    Master i folkehelsevitenskap med vekt på endringer av livsstilsvaner, 2017 Bakgrunn: Verdens helseorganisasjon (WHO) kom i 1978 med utsagnet og et ambisiøst mål kalt «Helse for alle i år 2000». I 2013 i Almaty ble det på nytt diskutert de globale utfordringene. Her ble det fokusert på to hovedtemaer, ulikheter i helse og den økte byrden av kroniske sykdommer. Hovedvekten ble lagt på samarbeid mellom helsevesenet og brukerne for å imøtekomme disse problemene. I Stortingsmelding 26 snakkes d...

  6. Ny versjon av standarden ISO 15489

    OpenAIRE

    Herbjørn Andresen

    2016-01-01

    Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. ...

  7. En analyse av Yoga-kundalini-upanisad

    OpenAIRE

    Martinsen, Fred

    2006-01-01

    Avhandlingen En analyse av Yoga-kundalini-upanisad bygger på den indiske asketen Narayanaswamy Aiyers engelske oversettelse av Yoga-kundalini-upanisad, utgitt i Thirty Minor Upanisad-s, Including the Yoga Upanisad-s (Oklahoma, Santarasa Publications, 1980). Denne hinduistiske teksten er omtalt som en av de 21 yoga-upanishadene, den åttisjette av de 108 klassiske upanishadene, og utgjør en del av tekstkorpuset Krsna-Yajurveda. Teksten fungerer som en manual i øvelser fra disiplinene hathayoga,...

  8. Evaluering av inflammatoriske mediatorer i diagnostikk av alvorlige neonatale infeksjoner

    Directory of Open Access Journals (Sweden)

    Henrik Døllner

    2009-10-01

    Full Text Available  Formål: SAMMENDRAGStudie design: Resultater: IL-6 predikerte uavhengig infeksjon (bidrag til infeksjonsdiagnosen. En kombinert parameter bestående av CRP≥ 10 mg/l og/eller IL-6 > 50 pg/mlga en sensitivitet på 96% (95% CI: 88–100%, en spesifisitet på 74% (95% CI: 65–83%, en negativ prediktivverdi på 99% (95% CI: 96–100% og en positiv prediktiv verdi på 49% (95% CI: 35–63%.Konklusjon: diagnosis of severe neonatal infections  ObjectiveENGLISH SUMMARY Study design Results: of IL-6 yielded independent contributions to the diagnosis of infection ( mediator made any further contribution to the diagnosis. A combined parameter of CRP≥ 10 mg/l and/or IL-6 >50 pg/ml yielded a sensitivity of 96% (95% CI: 88–100%, a specificity of 74% (95% CI: 65–83%, a negativepredictive value of 99% (95% CI: 96–100% and a positive predictive value of 49% (95% CI: 35–63%.Conclusion: severe neonatal infections.IL-6 in combination with CRP may constitute a valuable parameter in the early diagnosis ofp p p = 0.03. No other Twentyfour neonates with sepsis, clinical sepsis and pneumonia had significantly raised serumlevels of all six mediators compared to noninfected neonates (all : Blood samples were collected at admittance from 165 neonates who were suspected to have asevere bacterial infection and serum concentrations of the six inflammatory mediators were determined. Weanalysed the mediators, either isolated or in combination, as diagnostic parameters by multiple logisticregression, receiver-operator characteristic plots and predictive value theory (sensitivity and specificity.: To study C-reactive protein (CRP, interleukin-6 (IL-6, soluble tumor necrosis factor receptors(TNFR p55 and p75 and the adhesion molecules ICAM-1 and E-selectin in the early diagnosis of neonatalsepsis.The value of inflammatory mediators in the . Nor J Epidemiol 1997; 7 (1: 73-78.IL-6 i kombinasjon med CRP synes å være en verdifull parameter ved utredning

  9. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  10. Multivariat analyse av 18F-FDG PET av tre brystkreft-xenografter i mus

    OpenAIRE

    Skappel, Ingvild

    2015-01-01

    Denne masteroppgaven tar utgangspunkt i et studie hvor man har analysert bilder innhentet fra dynamisk PET (Positron Emission Tomography) av mus med implanterte menneskelige brystkreft-xenografter, utført ved Oslo Universitetssykehus i mars 2014. 2-deoksy-2-[18F]fluoro-D-glukose (FDG), en glukoseanalog merket med radioaktivt fluor (18F), er benyttet som tracer. Ved dynamisk FDG PET avbildes aktiviteten av 18F i kroppsvevet av interesse ved flere tidspunkt etter injeksjon av tracer. I denne op...

  11. Vidareutveckling av PROFIBUS-modul

    OpenAIRE

    Forsberg, Andreas; Larsson, Christoffer

    2010-01-01

    Denna rapport beskriver ett examensarbete som gjordes på företaget Motion Control i Västerås AB. Rapporten följer projektets utvecklingssteg och beskriver hur arbetet med att ta fram elektronik och inbyggd programvara för en kommunikationsmodul har framskridit. Kommunikationsmodulen ska fungera som en länk mellan en styrenhet och en I/O-enhet.   De inledande delarna av rapporten tar upp undersökningar på kommunikationsprotokollen PROFIBUS och PROFINET som är vanliga kommunikationsmetoder inom...

  12. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  13. Förpackning av keramiska substrat

    OpenAIRE

    Karlsson, Jan

    2008-01-01

    Detta examensarbete handlar om forpackning av keramiska substrat. Canning ar det universella namnet pa forpackning av keramiska substrat. Keramiska substrat kan vara katalysatorer eller partikelfilter som anvands som ett efterbehandlingssystem i bensin och Diesel applikationer. Examensarbetet genomfordes hos Scania CV AB. I installationsprocessen sveps en keramisk fibermatta runt det keramiska substratet. Substratet inkapslas sedan med ett metalholje. Rapporten inleds med att beskriva olika i...

  14. Efficient Software HEVC to AVS2 Transcoding

    Directory of Open Access Journals (Sweden)

    Yucong Chen

    2016-09-01

    Full Text Available The second generation of Audio and Video coding Standard (AVS is developed by the IEEE 1857 Working Group under project 1857.4 and was standardized in 2016 by the AVS Working Group of China as the new broadcasting standard AVS2. High Efficient Video Coding (HEVC is the newest global video coding standard announced in 2013. More and more codings are migrating from H.264/AVC to HEVC because of its higher compression performance. In this paper, we propose an efficient HEVC to AVS2 transcoding algorithm, which applies a multi-stage decoding information utilization framework to maximize the usage of the decoding information in the transcoding process. The proposed algorithm achieves 11×–17× speed gains over the AVS2 reference software RD 14.0 with a modest BD-rate loss of 9.6%–16.6%.

  15. Felleskapsmonografier Bringebærblad og Svarthyllbær

    OpenAIRE

    Sabouni, Mitra

    2012-01-01

    Bakgrunn EUs vitenskapelige komité for plantebaserte legemidler (HMPC- Herbal Medicinal Products Committee) sin hovedoppgave er å utarbeide monografier. Utarbeidelse av monografier blir utført av medlemmer av MLWP (Working Party on samfunn monografier og samfunn List) som rapportører og deres tilgjengelige eksperter. MLWP er en arbeidsgruppe under HMPC. Fellesskapsmonografiene gir en harmonisert tilnærming til vitenskapelig bedømmelse av plantebaserte legemidler i EU/EØS-området, og kan...

  16. Arctic Visiting Speakers Series (AVS)

    Science.gov (United States)

    Fox, S. E.; Griswold, J.

    2011-12-01

    The Arctic Visiting Speakers (AVS) Series funds researchers and other arctic experts to travel and share their knowledge in communities where they might not otherwise connect. Speakers cover a wide range of arctic research topics and can address a variety of audiences including K-12 students, graduate and undergraduate students, and the general public. Host applications are accepted on an on-going basis, depending on funding availability. Applications need to be submitted at least 1 month prior to the expected tour dates. Interested hosts can choose speakers from an online Speakers Bureau or invite a speaker of their choice. Preference is given to individuals and organizations to host speakers that reach a broad audience and the general public. AVS tours are encouraged to span several days, allowing ample time for interactions with faculty, students, local media, and community members. Applications for both domestic and international visits will be considered. Applications for international visits should involve participation of more than one host organization and must include either a US-based speaker or a US-based organization. This is a small but important program that educates the public about Arctic issues. There have been 27 tours since 2007 that have impacted communities across the globe including: Gatineau, Quebec Canada; St. Petersburg, Russia; Piscataway, New Jersey; Cordova, Alaska; Nuuk, Greenland; Elizabethtown, Pennsylvania; Oslo, Norway; Inari, Finland; Borgarnes, Iceland; San Francisco, California and Wolcott, Vermont to name a few. Tours have included lectures to K-12 schools, college and university students, tribal organizations, Boy Scout troops, science center and museum patrons, and the general public. There are approximately 300 attendees enjoying each AVS tour, roughly 4100 people have been reached since 2007. The expectations for each tour are extremely manageable. Hosts must submit a schedule of events and a tour summary to be posted online

  17. Situasjonsbestemt ledelse av studentgrupper i friluftsliv

    Directory of Open Access Journals (Sweden)

    Odd Lennart Vikene

    2014-05-01

    Full Text Available Artikkelen gir et praktisk eksempel på hvordan ulike studentgrupper i forbindelse med bygging av nødbivuakk i vinterfjellet opplevde min situasjonsbestemte ledelse som veileder. Teorigrunnlaget viser til situasjonsbestemte ledelsesmodeller og hva som kjennetegner god veiledning i friluftsliv. Datainnsamlingen bygger på kvantitative data fra et spørreskjema og benyttes til å analysere studentenes opplevelse av veileders ledelse ut i fra rangeringsmetoden Visuell Analog Skala (VAS. Fra samme spørreskjema var det også et åpent spørsmål som benyttes til refleksjon over studentenes opplevelse av sikkerhet i undervisningssituasjonen. Resultatene viser at studentgruppene opplevde klare ledelsesforskjeller gjennom de ulike fasene som ledelsen ble delt opp i, men at ledelsesatferden varierte lite i forhold til gruppenes erfaringsgrunnlag. Resultatene tyder på at jeg som veileder i stor grad har blitt påvirket av mine tidligere erfaringer og den potensielle risikoen som ligger ved aktiviteten. Selv om den situasjonsbestemte ledelsen varierte lite mellom de tre gruppene, viser resultatenes store standardavvik at de ulike smågruppene opplevde at ledelsen varierte. Dette tyder på at jeg som veileder til en viss grad har evnet å benytte situasjonsbestemt ledelse i praksis. På grunn av studentgruppenes relativt like oppfatning av ledelsen i de ulike fasene, viser resultatene også noe av vanskelighetene veileder har i forhold til å gjøre en korrekt vurdering av gruppens evner og erfaring i relasjon til læringssituasjonene som oppstår. Sentralt for ledelsen er likevel at studentgruppene opplevde ledelsen som betryggende, noe som gir studentene et godt grunnlag for senere opplevelser i tilknytning til vinterfriluftsliv og bygging av nødbivuakk.

  18. Introduksjon til bruk av prosessimuleringsprogrammet Aspen Plus

    OpenAIRE

    Sjøvik, Torbjørn Eig

    2013-01-01

    Denne masteroppgaven er en introduksjon i bruk av prosessimuleringsprogrammet Aspen Plus, med tanke på framtidig bruk i prosessfagene ved institutt for matematiske realfag og teknologi ved Universitetet for Miljø og Biovitenskap. Målet var å finne ut om programmet er egnet å bruke i undervisning av prosessfag. For å løse problemstillingen ble simuleringer i Aspen Plus satt opp og løst, med økende grad av vanskelighet. Dette resulterte i en brukerveiledning, som kan hjelpe nye brukere i å k...

  19. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  20. Fortid nr. 3/2008. Ringvirkninger av Israels opprettelse

    OpenAIRE

    2008-01-01

    Leder (s. 5) Korttekster: Mindre nasjon. Mer teori. Av Geirr Olav Gram (s. 7-8) Historiefaget i all sin bredde. Av Maria Halle (s. 8-9) Tema: Ringvirkninger av Israels opprettelse Al-Nakba 1948 - 60 år siden katastrofen. Av Jørgen Jensehaugen (s. 9-10) "Et folk som alle andre": Norsk-jødiske perspektiver på opprettelsen av Israel. Av Vibeke Kieding Banik (s. 12-19) Remembering Al-Nakba 60 years later. Av Ahmad H. Sa'di (s. 20-26) Israel and the exodus of the Jews of ...

  1. Opplevelse av luksus : en konformativ og eksplorativ analyse av luksusbegrepet mot smarttelefoner og nettbrett.

    OpenAIRE

    Akimov, Sergej Aleksandrovitsch

    2011-01-01

    Formålet med denne studien var å undersøke luksusopplevelsen til smarttelefoner og nettbrett, med utgangspunkt i underliggende luksusmotiver. Den fastsatte problemstillingen var todelt. For det første skulle jeg identifisere graden av luksus på smarttelefoner av to ulike merker og hvilke motiver som var de mest fremtredende for disse produktene. Den andre delen av problemstillingen fokuserte på hvorvidt det eksisterer forskjeller i opplevd luksus på ett merke, på tvers av to produktkategorier...

  2. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    OpenAIRE

    John Olav Bjørnestad; Anne Valen-Senstad Skisland; Olle Söderhamn

    2010-01-01

    Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatning...

  3. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  4. Konstruktion av hisslås

    OpenAIRE

    Lundin, Christian; Dalstam, Robert

    2010-01-01

    Examensarbetet ”Konstruktion av hisslås” som utförts på avdelningen för maskinteknik vid Blekinge Tekniska Högskola i samarbete med Nami lift AB i Tollarp. Dagens hisslås köper Nami av en leverantör som nu blivit uppköpta av Namis konkurrent. Därför vill de undersöka om det finns en möjlighet att tillverka egna lås till ett billigare pris. Önskemålet var att låset skulle vara en elektromekanisk konstruktion som drivs av en solenoid och låset måste uppfylla de säkerhetskrav som finns för hissa...

  5. Distributed Trust Management and Rogue AV Software

    Science.gov (United States)

    2010-06-10

    Software Secured Order 0 WIN PC® Defender 6 Months License SubsaiJtjon indudes ~ version updates, definition updates, standart rustomer support... standart customer support for 1 year. Only today limited ollerwith special discount~ $69.99. Q Lifetime UNUMITED LlceMt, Best Cholet ! WIN PC...2010 Basic Business Model • Rogue AV basic: $0 • Rogue AV full: $30-$100 • Multi-year licensing: ~$20 more • Bundling other applications: ~$20 more

  6. Konformasjonsanalyse og teoretiske beregninger av morfin

    OpenAIRE

    Syvertsen, Linda

    2013-01-01

    Master i biomedisin Morfin og morfinderivater er de beste smertestillende medisinene vi har i dag. Dessverre har disse medikamentene en mørk bakside i form av alvorlige bivirkninger som blant annet eufori, avhengighet og respirasjonsundertrykkelse. Til tross for omfattende forskning, har man hittil ikke klart å utvikle morfinderivater med like god smertestillende effekt, men med færre alvorlige bivirkninger. Mye forskningsarbeid har blitt utført i forbindelse med fremstilling av ulike deri...

  7. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  8. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  9. Mönsteranalys av inomhusluft. Undersökning av luftkvaliteten i sjuka hus med flytspackelproblem

    OpenAIRE

    Bornehag, Carl-Gustaf

    1994-01-01

    Den hälsomässiga effekten som rapporteras i samband med sjuka-hus syndromet (SBS), vars orsak är okänd, kan betraktas som ett mönster av icke specifika symptom såsom irritationer i ögon, näsa och mun, upplevelser av torra sletnhinnor och hud, hudrodnad, mental trötthet och upplevelse av svag men ihållande lukt. Aven exponeringar i inomhusluften kan beskrivas som ett mönster av en mängd olika ämnen, exempelvis VOC, partiklar, sporer m. m. Detta innebär att en av svårigheterna med att undersöka...

  10. Läs med flyt! : - en studie av elevers tidiga utveckling av avkodning

    OpenAIRE

    Bryne, Camilla

    2013-01-01

    Syftet med detta arbete är att studera elevers tidiga utveckling av förmågan att avkoda text och attbeskriva huvudtyper av olika utvecklingsvägar. Frågor som besvaras är vilka steg som kanidentifieras i utvecklingen av förmågan av avkoda text i den tidiga läsutvecklingen i årskurs ettoch två samt vilka huvudtyper av utvecklingsvägar som kan identifieras. För att svara på dessafrågor har 46 elevers tidiga läsning analyserats vid tre tillfällen under ett år. Vid läsningenanalyseras fyra olika a...

  11. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2016-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  12. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2015-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  13. Veileder for kravspesifikasjon for leie av kontorarealer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne

    Investorer og leietakere blir stadig mer interessert i helse- og miljøkvaliteter. Men kunnskapen er lav hos de fleste om hva de skal etterspørre og hvordan slike kvaliteter kan dokumenteres. Meglere har en viktig rolle som formidler av kvaliteter. Grønn Byggallianse har i samarbeid med blant annet...... Norsk Eiendom, Enova og NGBC utarbeidet en mal for standard kravspesifikasjon for leie av kontorlokaler. Målet med malen er å bidra til at leietager får det produktet han trenger til riktig pris og at man unngår unødig miljøbelastning. Målet er videre at å bidra og stimulere til, at innleie....../utleie prosesser startes med en dialogbasert prosess. Standarden er tenkt som et hjelpemiddel til en systematisk gjennomgang av, og diskusjon av hvilke kvaliteter som har prioritet, høy, middel eller lav prioritet for leietaker. Resultatet av dialog og diskusjon fastlegger endelige krav til kvalitet og...

  14. Utprøving av metodikker for modellering av overvann i et urbant område ved bruk av ArcGIS, MIKE21 og MIKE FLOOD

    OpenAIRE

    Johansen, Jarle Andre; Moldekleiv, Hans Jakob Saxe

    2016-01-01

    I de siste århundrene har det blitt registrert forandringer i klimasystemet. Det er sannsynlig at dette er en konsekvens av menneskers forbruk av fossilt brennstoff. Klimaendringene vises i en høynet middeltemperatur for store deler av jordkloden. I Norge blir klimaendringene synlige i form av at det har blitt mer nedbør og at nedbørshendelsene har blitt mer intense. Denne tendensen blir av de fleste forskere framskrevet til å vedvare. Samtidig med klimautviklingen har samfunnet blitt forandr...

  15. IAS 41 - Värdering av skog

    OpenAIRE

    Hellsten, Fredric; Thorsson, Johan

    2006-01-01

    Införandet av standarden IAS/IFRS i Sverige är en effekt av den internationalisering som skett de senaste åren. En stor skillnad märks bland de företag som nu måste redovisa tillgångar till verkliga värden istället för som tidigare till historiska värden. Skogskoncernerna ställs inför ett sådant faktum. Effekten blir att en mer rättvisande bild av skogens värde uppkommer. De intervjuade företagen, Bergvik Skog AB, Holmen, SCA, Sveaskog och Öhrlings PricewaterhouseCoopers håller med om att dol...

  16. Dicty_cDB: FC-AV21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV21 (Link to dictyBase) - - - Contig-U15736-1 FC-AV21E (Li...nk to Original site) - - - - - - FC-AV21E 635 Show FC-AV21 Library FC (Link to library) Clone ID FC-AV21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV21Q.Seq.d/ Representative seq. ID FC-AV2...1E (Link to Original site) Representative DNA sequence >FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq....ignments: (bits) Value FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq.d/ 573 e-162 VHK407 (VHK407Q) /CSM/VH/V

  17. Dicty_cDB: FC-AV22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV22 (Link to dictyBase) - - - Contig-U16260-1 FC-AV22Z (Li...nk to Original site) - - FC-AV22Z 672 - - - - Show FC-AV22 Library FC (Link to library) Clone ID FC-AV22 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV22Q.Seq.d/ Representative seq. ID FC-AV2...2Z (Link to Original site) Representative DNA sequence >FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq....ignments: (bits) Value FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq.d/ 1281 0.0

  18. Bioseguridad en granjas avícolas

    OpenAIRE

    Sandra L. Ricaurte Galindo

    2005-01-01

    La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extr...

  19. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  20. Utforming av innendeltaker-design grafer i Microsoft Excel 2007

    OpenAIRE

    Strømgren, Børge; Løkke, Gunn; Olsen, Fie; Løkke, Jon Arne

    2010-01-01

    I artikkelen gis det beskrivelser av hvordan grafer for framstilling av innendeltaker tilba-ketrekkingsingsdesign (reversering), multielementdesign og multippel basislinjedesign kan konstrueres i Microsoft Excel 2007 for Windows. Det gis tips om hvordan ferdige grafer kan overføres fra Excel til andre relevante programmer. Forutsetning for bruk av framstillingen er korrekt installert Microsoft Excel 2007 for Windows. Beskrivelsene er tenkt å gi utfyllende informasjon om konstruksjon av innend...

  1. Institusjonelle felt og forståelser av evaluering

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Furubo, Jan-Eric

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av refo...

  2. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  3. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  4. Smertelindring av opioidavhengige pasienter. En oppgave om sykepleieres holdninger og kunnskaper om smertelindring av opioidavhengige pasienter

    OpenAIRE

    Selvig, Katrine Magelssen

    2013-01-01

    Hensikten med oppgaven var å belyse sykepleieres holdninger og kunnskap om smertelindring av opioidavhengige pasienter.Det viste seg at sykepleierne oppfattet å ikke ha tilstrekkelig kunnskap om smertelindring til opioidavhengige pasienter. Det å utvikle en tillitsfull relasjon var nødvendig for å yte god pleie. Holdninger ble identifisert som den viktigste faktoren som påvirket sykepleiernes intensjon om å yte pleie av høy kvalitet.

  5. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  6. Forskere i norske avisers dekning av skole

    Directory of Open Access Journals (Sweden)

    Emilia Andersson-Bakken

    2015-10-01

    Full Text Available Skolen er stadig i medienes søkelys, og i denne artikkelen ser vi nærmere på hvordan forskere bidrar med sine fagkunnskaper i skoledebatten i mediene. Den problemstillingen vi ønsker å besvare, er: Hvilken rolle har forskere i norske avisers dekning av skole? For å svare på dette har vi gjort en analyse av samtlige artikler om skole i VG, Bergens Tidende og Aftenposten i 2013. Resultatene viser at det forekommer en navngitt forsker i ca. 12 % av avisenes artikler om skole (209 av 1712 artikler. Det er imidlertid forskjell mellom avisene, og i VG opptrer det forskere i ca. 24 % av artiklene om skole, mens andelen både i Aftenposten og BT er ca. 11 %. Undersøkelsen viser videre at det er mange forskere som får mulighet til å uttale seg om skole i disse tre avisene, men det store flertallet av disse uttaler seg kun én gang. Vi fant også at forskere ofte uttaler seg om rammene for skolens undervisningsvirksomhet, og sjelden om det som foregår i klasserommene. Resultatene av vår empiriske undersøkelse stemmer i stor grad overens med hovedtendensene i tidligere studier av forskere i media, noe som indikerer at forskernes rolle i norske avisers skoledekning ikke skiller seg markant ut fra den rollen forskere har i media generelt. Våre resultater peker imidlertid på én viktig forskjell: Forskere ser ut til å være uvanlig godt synlige i norske avisers dekning av skole.Nøkkelord: skoleforskning, media, forskningsformidlingAbstractSchool is a frequently debated topic in the media, and this article investigates how researchers contribute with their knowledge in this media debate. The research question is: What characterizes researcher participation in Norwegian newspaper coverage of school? To answer this question we have analyzed all articles about school in the Norwegian newspapers VG, Bergens Tidende and Aftenposten during 2013. The results show that there is a named researcher in about 12 % of the newspaper articles about school

  7. Samhandling på tvers av lokasjoner ved hjelp av videokonferanse : Casestudie av virtuelle møter innenfor driftsorganisasjonen i Det norske oljeselskap

    OpenAIRE

    Volden, Helene

    2016-01-01

    Globaliseringen de siste årene har bidratt til endringer av samfunnet og organisasjonslivet. Arbeid skjer til alle døgnets tider og man befinner seg på ulike steder. Teknologien tillater å kunne gjennomføre møter på tvers av lokasjoner, og antall virtuelle møter er spådd en økning fremover. Olje- og gassindustrien er de mest erfarne brukerne av videokonferanse i norsk næringsliv. Denne studien skal belyse hvordan virtuelle møter kan bli mer effektive i arbeidet på tvers av loka...

  8. Bokanmeldelse: "Freakonomics : a rogue economist explores the hidden side of everything" / Steven D. Levitt and Stephen J. Dubner

    OpenAIRE

    Sommervoll, Dag Einar

    2006-01-01

    Artikkelen er gjengitt med tillatelse fra Samfunnsøkonomenes Forening. Bokanmeldelse av: Levitt, Steven D. & Dubner, Stephen J. (2005): "Freakonomics : a rogue economist explores the hidden side of everything", [New York]: Harper Collins Inc.

  9. Dimensionering av Södersjukhusets sterilcentral

    OpenAIRE

    Munguia Chang, Daniel; Dahlgren, Emma

    2016-01-01

    I dagsläget pågår en omfattande planering av utbyggnationen samt upprustningen av Södersjukhuset. Byggnationen beräknas preliminärt vara i bruk under mars 2018. I och med förändringen kommer sjukhuset få en helt ny sterilcentral.  Till en sterilcentral anländer kontaminerat medicinskt gods från tillhörande eller externa sjukhus. Efter att ha genomgått diskdesinficering och autoklavering på sterilcentralen kommer godset så småningom ut som sterilt för ytterligare användning.  Det finns idag en...

  10. Exponerade hatkommentarer : En studie av svensk hatkommentarsklassificering

    OpenAIRE

    Johansson, Kim

    2016-01-01

    I detta arbete presenteras hatfulla kommentarer på internet som ett sam- hällsproblem som vi bör göra något åt. Webbplatsen Exponerat.net presenteras som en källa till hatfulla kommentarer. Med hjälp av ett förenklande antagande om att de kommentarer som finns på Exponerat kan utgöra en god representation för hatfulla kommentarer på internet konstruerar vi en klassificerare. Klassificeraren utvärderas i två steg; det ena med hjälp av tiofaldig korsvalidering och det andra manu...

  11. Studenters opplevelse av egen og andres bruk av bærbar datamaskin i forelesninger

    Directory of Open Access Journals (Sweden)

    Halgeir Leiknes

    2014-02-01

    Full Text Available Denne studien har sett nærmere på studenters bruk av egen bærbar datamaskin (heretter kalt PC i en forelesningssituasjon. Vi har sett på studenters begrunnelse for bruk og faktiske anvendelse av PC. Studien ble gjennomført i to omganger med fire års mellomrom, der både PC-brukere og de som ikke brukte PC (ikke-brukere svarte.Studenters bruk av PC fremstår som et bevisst valg, og flertallet av studenter velger å ikke benytte PC. Andelen som bruker PC har økt noe, men økningen kan i stor grad forklares med økt tilgjengelighet av egen PC fra 2007 til 2011.Vi ser en klar tendens til at brukerne og ikke-brukerne har ulik oppfatning av andelen faglig og ikke-faglig bruk av PC. Forskjellen består i at ikke-brukerne rapporterer langt mer ikke-faglig aktivitet. Resultatene indikerer at ikke-brukerne forstyrres langt mer av underholdningsrelatert PC-bruk enn av faglig bruk og at de er svært sensitive for slik ikke-faglig bruk.SummaryThis study examined students’ use of their own laptop computer (hereafter called PC in a lecture setting. We have looked at students’ actual use of the PC, as well as their reasons for doing so. The study was conducted in two rounds, separated by four years, with both PC users and non-users (those who did not use a computer responses.Students’ use of PC appears to be a conscious choice, and the majority of students choose not to use a PC. The proportion using a PC increased slightly, but this increase can be largely explained by the increased availability and affordability of PCs from 2007 to 2011.We see a clear tendency for users and non-users to have different perceptions of the proportion of professional and non-professional use of the PC; non-users report far greater non-professional activities. The results indicate that non-users are disrupted far more by entertainment-related PC use than professional use and that they are very sensitive to such non-professional use.

  12. "Come as You Are" : En undersøkelse av fansens sakralisering av Kurt Cobain.

    OpenAIRE

    Winding-Sørensen, Anne

    2011-01-01

    I denne oppgaven tar jeg bruker jeg populærkulturen for å vise hvordan religiøse uttrykk kommer til synes gjennom fansens sakralisering av deres idol. For å vise hvordan ulike subkulturer i samfunnet bruker kjendiser for å skape en identitet og tilhørighet til andre mennesker har jeg brukt Kurt Coabin som eksempel på hvordan grungebevegelsen ikke bare var en musikkstil, men ble også en livsstil som skape rammer og strukturer for den gruppen av mennesker som følte et samhold til andre i denne...

  13. Fylogenetisk analyse av helgenom NGS-data av Bacillus cereus-gruppen

    OpenAIRE

    Simensen, Benedicte Been

    2015-01-01

    Sammenlikning av bakteriers genom er en effektiv måte å kartlegge hva som skiller arter og stammer fra hverandre. For å sammenlikne hele genomer fra bakterier er det vanlig å sekvensere. Utfordringen er dagens sekvenseringsteknologi, som ikke klarer å lese av hele lengden til genom-sekvensen, men kutter DNA-molekylene i kortere fragmenter før avlesning. Resultatet etter sekvensering er et stort antall korte fragmenter som etter sekvensering må pusles sammen til et fullstendig genom. Til dette...

  14. Kossan i sociala medier : Personifiering av kon inom marknadsföring av mejeriprodukter

    OpenAIRE

    Carlsson, Andrea

    2017-01-01

    Syftet med studien var att undersöka porträtterandet av kossan inom marknadsföring av mejeriprodukter i sociala medier. Undersökningens analys utfördes på mejeriföretaget Arlas Instagramkonto @arlasverige. Instagramkontots inlägg som publicerats mellan december månad 2015 till december månad 2016 innehållande en eller flera verkliga kossor analyserades. Metoderna som brukades var kvalitativ bild- och textanalys med kvantitativa inslag. Frågeställningarna undersökningen baserades på var: Hur p...

  15. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  16. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    "Först och främst inte skada" (Primum non nocere) - så lyder ett av buden i den Hippokratiska eden. Men alla medicinska åtgärder kan medföra oönskade effekter. Undersökning och behandling av friska i förebyggande syfte är inget undantag. Ett problem är att negativa effekter och skador av förebygg...

  17. Om implementering av frekvenshopping i OpenBTS.

    OpenAIRE

    Bremseth, Morten

    2011-01-01

    Denne Rapporten gir en forklaring på hva programvaredefinert radio er generelt. Den omtaler en konkret realisering ved hjelp av programvaren GNU Radio og den universale radioenheten USRP (Universal Software Radio Peripheral). GSM forklares slik at leseren får den nødvendige oversikten som trengs for å forstå resten av rapporten. Frekvenshopping forklares generelt og hvordan det er gjort i GSM. Det fremstilles en mulig realisering av frekvenshopping med USRP. Programvaren som benyttes for å o...

  18. Bakteriell produksjon av sulfid for felling av metaller i avløpsvann fra gruver optimalisering og oppskalering av prosessen

    OpenAIRE

    Nygaard, K.; Christensen, B

    1995-01-01

    Det er gjennomført forsøk i laboratorieskala og i liten pilotskala for å vurdere om bakteriell sulfat-reduksjon kan utnyttes til å produsere hydrogensulfid for felling av tungmetaller i sur avrenning fra nedlagte kisgruver. Det ble tilført etanol som vekstsubstrat for bakteriene. I laboratorieforsøkene ble det påvist sulfatreduksjonsaktivitet allerede etter få dager, mens det i pilotforsøkene tok ca 7 uker å få i gang prosessen. Metaller ble fjernet fra vannfasen som metallsulfider. Effektivi...

  19. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  20. Barndom på nett - En kvalitativ analyse av mammabloggeres fremstilling av egne barn på Internett

    OpenAIRE

    Sinding-Larsen, Helene

    2015-01-01

    Master i sosialt arbeid Denne studien tar for seg et relativt nytt og lite utforsket tema, nemlig fremstillinger av barn i mammablogger. Mammablogger kan forstås og utforskes som en slags personlig dagbok på Internett, hvor bloggeren deler fortellinger fra seg og sine barns hverdagsliv. Jeg har, gjennom et sosialkonstruksjonistisk perspektiv og inspirert av diskursteori, rettet fokus mot hvordan et utvalg av norske mammabloggere fremstiller sine barn. De ulike fremstillingene jeg har funne...

  1. Betydning av fruktose for kostrelaterte helseproblemer

    OpenAIRE

    Kolderup, Astrid

    2013-01-01

    Synet på sukker som næringsmiddel har endret seg de siste ti-årene. Tidligere antakelser, som blant annet at sukker ikke virker fetende, er i dag erstattet med kunnskap om klare sammenhenger mellom sukkerinntak og sykdom. Fruktoses rolle i denne sammenhengen er fortsatt noe uklar. Målet med denne litteraturgjennomgangen er å beskrive kroppens håndtering av fruktose, samt diskutere fruktoses rolle i kostrelaterte helseproblemer, med fokus på blodglukosehomeostase, fedme og karsykdom. På gr...

  2. Diskursordning och hegemoni : Representationer av en skola

    OpenAIRE

    Öhman, Anna

    2012-01-01

    Den här artikeln utforskar, genom en mångperspektivistisk diskursanalys, tidningsartiklar, en vetenskaplig artikel, ett myndighetsbrev, bloggar och ett reportage skrivna om en specifik grundskola i Sverige, som har blivit känd för sitt lyckade utvecklingsarbete med elevernas studieresultat. Enligt denna artikel är bilden som förmedlas genom media mycket positiv tills en artikel följd av en blogg, förändrade diskursordningen på ett hegemoniskt sätt. Den här artikeln beskriver den diskursiva fö...

  3. Påvirkning av personlighetstrekk på klageprosesser, og effekten av kausal prosess på hindsight bias

    OpenAIRE

    Iqbal, Quddos

    2010-01-01

    Hindsight bias er et begrep som omhandler en persons evne til å føle på forhånd hva resultatet blir. Et begrep som ser på folks følelse av å vite at hendelses utfall ble som forventet. Grad av self monitoting forteller om en persons handlinger er refleksjoner av han og hans meninger, eller av andres forventninger. Avhandlingen tar for seg self monitoring i interaksjon med hva slags klagetype en er (påfører selvforskyldt skade på mobil telefon, eller produktfeil), og hva slags klagebehandling ...

  4. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  5. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  6. AV Rising: Demand, Budgets, and Circulation Are All Up.

    Science.gov (United States)

    Oder, Norman

    1998-01-01

    A survey of 486 public libraries found that audiovisual (AV) budgets have increased 53% in the last five years. Provides data on average size of AV collections; budget break downs; circulation; audiobook, video, and music CD purchases; popular authors and titles in abridged and unabridged audiobooks; and problems with audiobook, video, and music…

  7. Bochdalek Hernia As A Cause Of Intermittent AV Block.

    Science.gov (United States)

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-09-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  8. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  9. EST Table: AV398806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398806 NV060303 11/12/09 GO hit GO:0005488(binding)|GO:0005515(protein binding)|G... aa gnl|Amel|GB16637-PA 10/09/10 74 %/237 aa gi|91092680|ref|XP_971368.1| PREDICTED: similar to AGAP009538-PA [Tribolium castaneum] AV398806 NV06 ...

  10. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  11. Förstudie till implementering av Electronic Flight Bag

    OpenAIRE

    Löfgren Bengtson, Erik

    2013-01-01

    Flygbranschen har på senare år blivit överrumplad av den snabba expansionen av Electronic Flight Bags (EFB) och introduktionen av bärbara läsplattor har öppnat upp för ett mer ekonomiskt alternativ till fast installerad utrustning. Med anledning av detta har NextJet beslutat sig för att genomföra en förstudie för att se om det går att implementera EFB i bolaget på ett säkert och kostnadseffektivt sätt. Den här studien visar att implementering av Electronic Flight Bag inte kunde påvisa några d...

  12. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  13. Cofactor requirement of HpyAV restriction endonuclease.

    Science.gov (United States)

    Chan, Siu-Hong; Opitz, Lars; Higgins, Lauren; O'loane, Diana; Xu, Shuang-Yong

    2010-02-05

    Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M) systems in microorganisms. We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++). The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  14. Når kontakter betyr alt : En studie av bruken av nettverksmediet LinkedIn

    OpenAIRE

    Blaalid, Maren Hyvang

    2012-01-01

    LinkedIn er et av de mest populære sosiale mediene i Norge og tiltrekker seg stadig flere medlemmer. I denne masteroppgaven studerer jeg bruken av LinkedIn for å undersøke hva som er det særegne ved dette nettverksmediet. Jeg har utført en spørreundersøkelse blant 280 brukere for å få innsikt i hvem de er, hvorfor de bruker LinkedIn og hvordan de gjør det. Funnene fra analysen viser at brukerne kjennetegnes ved at de er selvstendige og formålsrasjonelle, som bruker LinkedIn strategisk for å n...

  15. Framtagning av en Maintenance Organisation Expositon

    OpenAIRE

    Vukasinovic, Zoran; Mehmeti, Adnan

    2012-01-01

    För att få bedriva underhållsverksamhet på flygplan över 5700kg så måste underhållsorganisationen i fråga vara godkänd av Transportstyrelsen samt följa EU:s flygsäkerhetsmyndighet EASAs Part 145 regelverk. För att berörda myndigheter ska få sig en insikt i hur underhållsorganisationera ser ut och fungerar så måste dessa skriva en verkstadshandbok som beskriver verksamheten och processer. Detta är ett krav som finns beskrivet i Part 145 regelverket. Uppgiften blev att skriva ett förslag på kap...

  16. A case of pancreatic AV malformation in an elderly man.

    Science.gov (United States)

    Gupta, Vipin; Kedia, Saurabh; Sonika, Ujjwal; Madhusudhan, Kumble Seetharama; Pal, Sujoy; Garg, Pramod

    2018-02-05

    A 60-year-old man presented with recurrent abdominal pain and weight loss for 6 months. Abdominal imaging showed a large vascular lesion in the head and neck of pancreas suggestive of arteriovenous malformation (AV malformation). Endoscopic ultrasound was done which showed features of AV malformation with no evidence of pancreatic malignancy. Surgery was planned for definitive treatment of malformation. Digital subtraction angiography with angioembolization was done prior to surgery to reduce vascularity of the lesion. He recovered after a pylorus preserving pancreaticoduodenectomy. Histopathology of the resected specimen confirmed the pancreatic AV malformation. There has been no recurrence at 2 years of follow-up.

  17. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger. Oslo vann og avløpsverk (OVA)

  18. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger.

  19. Compositional mapping of Vesta quadrangle Av-10

    Science.gov (United States)

    Tosi, F.; Palmer, E.; De Sanctis, M. C.; Nathues, A.; Pieters, C.; Ammannito, E.; Capaccioni, F.; Frigeri, A.; Palomba, E.; Zambon, F.; Jaumann, R.; Le Corre, L.; Preusker, F.; Stephan, K.; Raymond, C. A.; Reddy, V.; Russell, C. T.

    2012-04-01

    The Dawn spacecraft entered orbit around asteroid 4 Vesta in mid-July 2011. Since then, the Visible and InfraRed Imaging Spectrometer (VIR) acquired hyperspectral images of Vesta's surface in the overall wavelength range from 0.25 to 5.1 μm. During the Approach and Survey mission phases (23 July through 29 August 2011), VIR obtained resolved images of Vesta with spatial resolution between 1.31 km and 0.68 km/pix. More than 65% of the surface, from the South Pole up to ˜40°N, was observed under different illumination conditions and local solar elevations. Further data were acquired in the subsequent HAMO and LAMO phases. Based on this datasets, the Dawn Team is conducting mineralogical mapping of Vesta's surface in the form of 15 quadrangle maps. In this work we present the results of the spectroscopic analysis carried out for the quadrangle Av-10 ("Oppia"), spanning Vesta's latitude 22S° - 22N° and longitude 288° - 360°. Vesta is known to have a basaltic surface from visible/near-infrared reflectance spectroscopy. Although pyroxenes' spectral signatures at about 0.9 and 1.9 µm are ubiquitous on Vesta and largely dominate its surface composition, significant variability in slope, strength and wavelength position of the center of these features can be measured, which indicate multiple physical surface processes. Absorption band depth is sensitive to abundance, texture and multiple scattering effects. On the other hand, the position of the band centers is sensitive to Calcium and Magnesium abundance in pyroxenes, which is crucial to establish a link with Howardite, Eucrite and Diogenite meteorites' clan (HEDs). On the basis of several spectral indices, the surface of Vesta can be divided into different terrain types, which are mostly related to specific geological units or morphological surface features. By combining VIR channels and ratios into colour images, the presence and abundance of these materials can be revealed. Among the terrain types identified on

  20. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  1. Knihovna Sociologického ústavu AV ČR

    Czech Academy of Sciences Publication Activity Database

    Hesová, Nela

    2017-01-01

    Roč. 7, č. 3 (2017) E-ISSN 1805-2800 Institutional support: RVO:68378025 Keywords : library Subject RIV: AF - Documentation, Librarianship, Information Studies https://www.lib.cas.cz/casopis-informace/knihovna-sociologickeho-ustavu-av-cr/

  2. Navy AV-8B Crash Survivable Flight Incident Recorder (CSFIR)

    National Research Council Canada - National Science Library

    1998-01-01

    ...) met at the Naval Air Weapons Development Center, Building P302, China Lake, CA for a Program Review I Technical Interchange Meeting in support of the AV-8B Crash Survivable Flight Incident Recorder System (CSFIR...

  3. Porträtt - bilder av människan

    OpenAIRE

    Fagerholm, Tanja

    2016-01-01

    Mitt examensarbete är nödvändigtvis inte ett slutresultat av mina visuella arbeten under studietiden utan snarare resultatet av en ständigt pågående process i att hitta min plats inom konsten. En frågeställning jag brottats med under studiernas gång är begreppet konstnär. Vad är en konstnär? Vad är konst? För att närma mig förväntningarna på hur en riktig konstnär bör vara har jag gått tillbaka till en klassisk form av måleri, nämligen avbildning av människor. Istället för att använda mi...

  4. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  5. EST Table: AV403989 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403989 pg--0306 10/09/28 100 %/137 aa ref|NP_037751.1| Q protein [Enterobacteria ...phage HK97] gb|AAF31144.1| Q protein [Enterobacteria phage HK97] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404408 pg-- ...

  6. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  7. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  8. EST Table: AV399879 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399879 NV120899 10/09/28 100 %/196 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  9. EST Table: AV399317 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399317 NV120063 10/09/28 100 %/262 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  10. EST Table: AV399810 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399810 NV120810 10/09/28 69 %/173 aa ref|YP_002884353.1| PP34 [Bombyx mandarina n...ucleopolyhedrovirus] gb|ACQ57304.1| PP34 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399543 NV12 ...

  11. EST Table: AV399857 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399857 NV120871 10/09/28 88 %/122 aa ref|YP_002884320.1| ODV-E25 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57271.1| ODV-E25 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399408 NV12 ...

  12. EST Table: AV399758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399758 NV120722 10/09/28 100 %/229 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  13. EST Table: AV399854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399854 NV120868 10/09/28 86 %/123 aa ref|YP_002884262.1| BRO-A [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57213.1| BRO-A [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399449 NV12 ...

  14. EST Table: AV399743 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399743 NV120679 11/12/09 n.h 10/09/28 84 %/219 aa ref|NP_047426.1| ARIF-1 [Bombyx... mori NPV] gb|AAC63695.1| ARIF-1 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399743 NV12 ...

  15. EST Table: AV404219 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404219 pg--0716 10/09/28 88 %/150 aa ref|YP_002928933.1| Host specificity protein... J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404050 pg-- ...

  16. AVS (Application Visualization System) user`s guide

    Energy Technology Data Exchange (ETDEWEB)

    Masuko, Kenji; Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Gorai, Kazuo; Yamazaki, Kazuhiko

    1996-03-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS for image processing software and an animation processing system (video, frame scan converter). This report summarizes the information to use AVS and to develop and maintain computer and network environment for image processing. (author).

  17. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  18. EST Table: AV403342 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403342 msgV0350 11/12/09 GO hit GO:0004867(serine-type endopeptidase inhibitor ac...erpin-28 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403342 msgV ...

  19. EST Table: AV399322 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399322 NV120068 10/09/28 86 %/174 aa ref|NP_047489.1| VP39 [Bombyx mori NPV] gb|A...AC63758.1| VP39 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  20. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  1. Konstruktionen av hälsa på Instagram : En studie av unga människors uppfattning av hälsa genom bild och text

    OpenAIRE

    Danielsson, Jennifer

    2014-01-01

    Unga människor är idag väl insatta användare av olika former av sociala medier - det är ofta en självklar del i deras vardag. Det sociala mediet Instagram har blivit oerhört populärt bland såväl barn som vuxna och används dagligen via mobilen för att förmedla ögonblicksbilder till omvärlden. I den här studien kommer Instagram - utifrån begrepp som hälsa, träning och konsumtion - analyseras med hjälp av teorier om makt och genus. Hälsomedvetenheten bland unga har genom spridningen på Instagram...

  2. Implementeringsstudie : en studie av lederroller ved implementering av LUS ved Berg skole

    OpenAIRE

    Michalsen, Anne Berit; Owren, Laila

    2010-01-01

    I denne masteroppgaven studerer vi en implementeringsprosess. I 2008-2009 skulle Leseutviklingsskjema (LUS) implementeres ved Berg skole, og vi ble bedt om å følge denne prosessen på nært hold. Vi mener at vi gjennom denne oppgaven gir kunnskap om en implementeringsprosess der en ekstern veileder har en sentral rolle i prosessen. Hvordan skolens ledelse og den eksterne veilederen inntar ulike roller gjennom implementeringen er en sentral del av vår studie. Formålet med oppgaven er dels å b...

  3. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  4. Overføring av avløpsvann fra Bekkelagets rensedistrikt til Sentralrenseanlegg Vest, SRV. En vurdering av konsekvensene for forholdene i Indre Oslofjord

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1985-01-01

    Vurderingen legger særlig vekt på oksygenforholdene i Vestfjorden under sprangsjiktet . Det sikreste tiltaket ser ut til å være en ombygging av Bekkelaget R.A.til kjemisk rensing. Overføring til SRV vil gi økt direkte utslipp av oksygenforbrukende stoff til Vestfjorden. For overføring av 1/3 av avløpsvannmengden er det mulig at dette oppveies av minsket belastning fra organisk produksjon i overflaten. Overføringer på 2/3 og 3/3 ser ut til å gi uakseptable konsekvenser for oksygenforholdene i ...

  5. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  6. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  7. Showrooming. -Kvalitativt studie av mindre, uavhengige butikker i klesbransjen.

    OpenAIRE

    Hoel, Beathe

    2016-01-01

    Denne oppgaven har som hensikt å undersøke hvordan showrooming atferd hos kundene påvirker de mindre klesbutikkene som ikke er tilknyttet en kjede. Problemstillingen i denne oppgaven er: Hvordan vurderer mindre, uavhengige butikker i klesbransjen de utfordringene som knyttes til trenden showrooming og hva gjør de for å motvirke eventuelle negative virkninger av slik forbrukeratferd? Studien har som formål å undersøke hyppigheten av showrooming atferd og om dette har noen negativer konsekv...

  8. EST Table: AV399445 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399445 NV120238 11/12/09 n.h 10/09/28 100 %/284 aa ref|YP_002884369.1| IE-1 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  9. Distribusjon av Polonium i fisk, med og uten avleiringshemmer

    OpenAIRE

    Veddeng, Hanne

    2012-01-01

    I forbindelse med utvinning av petroleumsressurser blir det sluppet ut store mengder produsert vann. Produsert vann er formasjonsvann fra reservoaret som følger med ved produksjonen av olje og gass. Når formasjonsvannet kommer i kontakt med sjøvann felles det ut uorganiske salter, som BaSO4. Dette er såkalte scaleavleiringer som utgjør et problem for oljeindustrien da det blant annet tetter igjen produksjonsrørene og gir en mindre effektiv produksjon. Som løsning på problemet tilsetter oljein...

  10. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  11. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  12. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  13. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  14. Analys av Arbetsmiljöverkets tillämpning av enkätverktyget NOSACQ-50

    OpenAIRE

    Andersson, Robin

    2013-01-01

    År 2013 införde Arbetsmiljöverket ett nytt webbaserat enkätverktyg som skall kunna ge ett mått av säkerhetskulturen hos företag och organisationer. Denna enkät baserades på tidigare forskning som tog fram en enkät, NOSACQ-50, för just detta ändamål. Värt att notera är att Arbetsmiljöverkets version är förkortad där vissa påståenden togs bort och vissa skrevs om. Det är detta som analysen behandlar. Hur påverkas resultaten av dessa förändringar som genomfördes av Arbetsmiljöverket? Analysen un...

  15. Visualisering av farmakologiska substanser i levervävnad med hjälp av masspketrometrisk bildtagning

    OpenAIRE

    Mäkinen, Matias

    2017-01-01

    Målet för detta forskningsprojekt var att utveckla en metod med vars hjälp det är möjligt att detektera farmakologiska substanser i levervävnad med hjälp av masspektrometrisk bildtagning, så kallad MALDI-MSI. I litteraturen finns beskrivet tillämpningar av MALDI-MSI med vars hjälp det detekterats till exempel lipider i vävnader eller såsom i denna studie farmkologiska substanser. Arbetet bestod av två delmoment. I den första delen isolerades hepatocyter ur råttlever genom att perfusera k...

  16. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...... for konflikt og hjelpeløshet. Helsefremmende arbeid basert på dialog og tidlig intervensjon kan forhindre at online-spilladferd kommer ut av kontroll....

  17. Open Source AV solution supporting In Situ Simulation and Clinical education

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind; Pociunas, Gintas; Dahl, Mads Ronald

    2015-01-01

    for a portable AV system for VAD. The system would make use of components widely available and easily replaceable. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost and a potential continues improvement and expansion of the AV system. Summary of results...... debriefing in a mobile, in situ simulation environment using an AV system constructed from “off the shelf” components and Open Source software....

  18. Rensing av avløpsvann fra settefiskanlegg med Algas Microfilter

    OpenAIRE

    Ohren, J.A.

    1987-01-01

    Rensing av avløpsvann fra settefiskanlegg er foretatt med Algas Microfilter: Under vanlig drift var avløpsvannets innhold av suspendert stoff, TOC, total nitrogen og total fosfor lavt. Renseeffektene var følgelig også lave. Ved vask av fiskekarene i settefiskanlegget økte ovennevnte innhold av forurensninger i avløpsvannet betydelig. Renseeffektene gjennom silen økte også betydelig. Algas

  19. Undersøkelser av utfordringer og vurdering av tiltak for renseanlegg tilknyttet Orklas produksjonslokaler på Rygge

    OpenAIRE

    Langfeldt, Samson

    2017-01-01

    Bakgrunnen for oppgaven ligger i at avløpsvannet fra produksjon av syltete rødbeter, sylteagurker, surkål m.m. ikke overholder kravene som er gitt i påslippsavtalen med kommunen. Dette kan føre til konsekvenser for fabrikkeierne, og ha negative konsekvenser på avløpsnettet. Denne oppgaven har fokusert på å finne årsaken til disse problemene samtidig som den gjør en teknisk analyse av mulige løsninger som kan fungere for anlegget. På anlegget er det blitt gjort undersøkelser avløpsvannets alka...

  20. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  1. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  2. EST Table: AV401520 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401520 e96h0828 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  3. EST Table: AV398543 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398543 NV021933 10/09/28 92 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 93 %/1

  4. EST Table: AV400552 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400552 br--1440 10/09/28 93 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 94 %/1

  5. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  6. EST Table: AV404642 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404642 prgv0279 10/09/28 81 %/116 aa ref|NP_001091796.1| programmed cell death pr...otein 5-like protein [Bombyx mori] gb|ABJ97180.1| programmed cell death protein 5-like protein [Bombyx mori

  7. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  8. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  9. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  10. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  11. EST Table: AV398357 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398357 NV021720 10/09/28 44 %/103 aa ref|XP_002435218.1| charged multivesicular b...ody protein, putative [Ixodes scapularis] gb|EEC08042.1| charged multivesicular body protein, putative [Ixod

  12. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  13. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  14. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  15. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  16. EST Table: AV399390 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399390 NV120162 11/12/09 n.h 10/09/28 100 %/181 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopol

  17. EST Table: AV399744 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399744 NV120680 10/09/28 98 %/185 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  18. EST Table: AV399272 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399272 NV120003 10/09/28 100 %/126 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus

  19. EST Table: AV399898 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399898 NV120920 10/09/28 86 %/105 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  20. EST Table: AV399551 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399551 NV120385 10/09/28 99 %/123 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  1. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  2. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  3. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  4. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  5. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  6. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  7. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  8. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  9. EST Table: AV402755 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402755 heS30447 10/09/28 32 %/161 aa ref|XP_001988342.1| GH10620 [Drosophila grims...hawi] gb|EDW03209.1| GH10620 [Drosophila grimshawi] 10/08/28 32 %/161 aa FBpp0144526|DgriGH10620-PA 10/08/2

  10. EST Table: AV404071 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404071 pg--0407 11/12/09 n.h 10/09/28 100 %/244 aa ref|YP_002928933.1| Host speci...ficity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW295

  11. EST Table: AV404427 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404427 pg--0966 11/12/09 n.h 10/09/28 91 %/168 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  12. EST Table: AV404050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404050 pg--0381 11/12/09 n.h 10/09/28 99 %/161 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  13. EST Table: AV400190 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400190 br--0867 10/09/28 67 %/134 aa ref|XP_974541.1| PREDICTED: similar to Media...%/108 aa gnl|Amel|GB13317-PA 10/09/10 67 %/134 aa gi|91083293|ref|XP_974541.1| PREDICTED: similar to Media

  14. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  15. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  16. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  17. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  18. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  19. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  20. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  1. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  2. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  3. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  4. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  5. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  6. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  7. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  8. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  9. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  10. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  11. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  12. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  13. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  14. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  15. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  16. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  17. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  18. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  19. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  20. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  1. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  2. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  3. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  4. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  5. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  6. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  7. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  8. Rekonstruering av cyanobakterien Planktothrix sine forekomster i Hålandsvatnet fra 1980 fram til 2014 under påvirkning av den vertsspesifikke parasitten Chytridiomycota

    OpenAIRE

    Westerås, Anne Charlotte

    2016-01-01

    Cyanobakterier har eksistert i ~ 3,5 milliarder år, noe som gir dem en historisk evolusjonær fordel ved tilpasning til enten menneskeskapte eller naturlige endringer. Algene kan danne oppblomstringer som ofte er giftige, hvorpå toksiske forekomster er et resultat av oligopeptid-produksjon. Slike peptider kodes av en meget gammel del av cyanobakterienes genom, og individer innenfor samme algepopulasjon kan ha ulik oligopeptid sammensetning eller profiler. Derfor antas horisontal ge...

  9. Hormoners betydning for kognitiv utvikling : en studie av jenter med adrenogenitalt syndrom (AGS)

    OpenAIRE

    Schjølberg, Katrine Luisa Fernanda

    2010-01-01

    Bakgrunn: Studier av både mennesker og dyr som har vært utsatt for unormale mengder hormonkonsentrasjoner har vist endringer i utviklingen av kognitive ferdigheter. Andrenogenitalt syndrom(AGS) er en tilstand som fører til økt produksjon av androgener i fosterlivet. Denne tilstanden har vist klar sammenheng mellom dennes atypiske hormonnivå og atferd i form av både lekepreferanse og valg av lekepartner. I motsetning er litteraturen uklar på forholdet mellom deres hormonelle miljø og utvikling...

  10. Fremre korsbåndskade og utvikling av sekundær artrose

    OpenAIRE

    Holm, Stine

    2013-01-01

    Oppgaven er en blanding av et litteraturstudie og en kohortestudie. I litteraturstudien har jeg sett på hva fremre korsbånd og artrose er, og hvilke risikofaktorer som kan bidra/progrediere utvikling av artrose hos korsbåndsopererte. I kohortestudien har jeg og veilederen sett på forekomsten av artrose hos korsbåndsopererte- 10-20 år etter ACL rekonstruksjon. Ved hjelp av røntgen og klinisk undersøkelse vurderte vi tidligere korsbåndsopererte og grad av artroseforandringer. Vi så også på hvor...

  11. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  12. Främjandet av kvinnliga entreprenörer

    OpenAIRE

    Palm, Caroline; Lindqvist, Jessica

    2008-01-01

    Trots en ökande trend av antalet kvinnliga entreprenörer är proportionen till manliga entreprenörer fortfarande relativt låg. Anledningen kan bland annat bero på att entreprenörskap definieras efter egenskaper som återfinns bland typiska manliga egenskaper som till exempel riskbenägenhet och en stor självtillit. Med stor sannolikhet är detta en av orsakerna till att få kvinnor kan identifiera sig själva med rollen som entreprenör. Denna studie undersöker vad som i nuläget utförs för att främj...

  13. Energieffektivering av skolfartyget M/S Michael Sars

    OpenAIRE

    Ekebom Oscar, Lindholm Andreas

    2017-01-01

    Syftet med detta examensarbete är att undersöka och utvärdera hur värmeförbrukningen ombord på skolfartyget M/S Michael Sars kan effektiveras. Vi genomförde detta på tre olika sätt. Det första var att undersöka hur en isolering av maskinrummet och dess trapphus kan sänka uppvärmningsbehovet. Vi beräknade värmegenomgången genom skrovet samt hur mycket isoleringsmaterial som behövs. Det andra alternativet för energieffektivering är att undersöka hur ett eventuellt byte av fartygets oljeeldade p...

  14. "Det begynder næsten at bli beboeligt ogsaa i digternes verden" - samtidens resepsjon av Henrik Ibsens Lille Eyolf

    OpenAIRE

    Andersen, Torbjørn

    2010-01-01

    Avhandlingen er en undersøkelse av den skandinaviske samtidsresepsjonen av Henrik Ibsens drama Lille Eyolf (1894), begrenset til bokomtaler (ikke oppsetningskritikk). Artikler av Hans Robert Jauss, Jan Mucařovský og Felix Vodička danner det teoretiske utgangspunktet for arbeidet. I tillegg er Per Thomas Andersens klassifisering av fire hovedtyper kriterier for litteraturkritikk benyttet. Undersøkelsen bygger på et stort utvalg av tradisjonelle avisanmeldelser og tidsskriftartikler fra 1...

  15. EST Table: AV399321 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx manda...rina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  16. EST Table: AV399146 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399146 NV060720 10/09/28 91 %/173 aa ref|YP_002884350.1| GP64/67 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57301.1| GP64/67 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP121286 NV06 ...

  17. EST Table: AV399657 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  18. EST Table: AV399890 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399890 NV120911 10/09/28 83 %/222 aa ref|YP_002884341.1| PIF-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57292.1| PIF-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP120262 NV12 ...

  19. EST Table: AV399458 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884259.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63702.1| LEF-6 [Bombyx mori NPV] gb|ACQ...57210.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399457 NV12 ...

  20. EST Table: AV398266 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV02 ...

  1. EST Table: AV399527 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884325.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63769.1| LEF-5 [Bombyx mori NPV] gb|ACQ...57276.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399374 NV12 ...

  2. EST Table: AV403832 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403832 pg--0107 10/09/28 99 %/175 aa ref|NP_001103774.1| receptor expression enhancing... protein isoform 1 [Bombyx mori] gb|ABD36360.1| receptor expression enhancing protein isoform 1 [Bombyx.../10 56 %/174 aa gi|189239379|ref|XP_971918.2| PREDICTED: similar to receptor expression enhancing protein [Tribolium castaneum] NM_001110304 pg-- ...

  3. EST Table: AV399230 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399230 NV060841 10/09/28 97 %/150 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  4. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  5. EST Table: AV399150 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399150 NV060726 10/09/28 98 %/124 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  6. EST Table: AV399180 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399180 NV060769 10/09/28 57 %/213 aa ref|XP_391845.2| PREDICTED: similar to tout-...:AGAP010388 10/09/10 57 %/213 aa gnl|Amel|GB17343-PA 10/09/10 55 %/209 aa gi|91076108|ref|XP_968944.1| PREDICTED: similar to tout-velu CG10117-PA [Tribolium castaneum] FS931854 NV06 ...

  7. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  8. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  9. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  10. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  11. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  12. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  13. O tornar-se avó no processo de individuação

    Directory of Open Access Journals (Sweden)

    Caroline Dal Ri Kipper

    Full Text Available O tornar-se avó assinala um período de transição no ciclo de vida familiar, marcado por transformações psíquicas significativas para os avós, caracterizando a quarta individuação. Este trabalho teve como objetivo investigar a experiência de tornar-se avó e sua importância no processo de individuação. Foi utilizado delineamento de estudo de caso coletivo. Onze avós maternas, com idades entre 49 e 66 anos, cujas filhas tiveram seu primeiro filho, responderam a uma entrevista semi-estruturada. Todas as avós tinham tido seus primeiros netos e a entrevista referia-se a sua experiência como avós desses netos. Os dados mostraram que o ser avó é uma fonte de renovação e renascimento. O estudo propiciou que as participantes refletissem sobre seus diferentes papéis familiares: avó, mãe, neta e filha. Os dados sugerem que tornar-se avó possibilita que antigos conflitos sejam repensados, renovando antigos vínculos e desejos, o que permite que a avó dê mais um passo rumo à sua individuação.

  14. T-760/15: Nederländerna mot Kommissionen : Analys av kommissionens prövning av selektivitet

    OpenAIRE

    Elofsson, Niklas

    2016-01-01

    I takt med att den ökade globaliseringen av den internationella handeln har möjligheterna för multinationella företag att påverka sin beskattning ökat. Företags olika upplägg för att minska sina skattekostnad har bekämpats allt eftersom de har växt fram. Under 2010-talet uppdagades att multinationella företag har fått minskade skatte-kostnader genom tillämpning av APA:or med medlemsstater. Kommissionen har påbörjat ett nitiskt arbete för att stoppa och återvinna dessa skattelättnader. Kommiss...

  15. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  16. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  17. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  18. Rendyrking av funksjoner i NAV – renere eller mer kaotisk sosialt arbeid?

    OpenAIRE

    Myhre, Tone

    2017-01-01

    Det overordnede temaet for denne oppgaven er sosialt arbeid i NAV. Sosialtjenesten i NAV utgjør en av de største arbeidsplassene for sosialarbeidere i Norge. For å utøve sosialt arbeid i NAV, er det viktig med gode rammebetingelser. I denne oppgaven ønsker jeg derfor å se på hvordan organiseringen av NAV kan påvirke sosialarbeideres utøvelse av det sosiale arbeidet.

  19. Tangofilmer - en genreanalyse : nærstudie av tangofilmgenren som fenomen innen den argentinske filmindustrien

    OpenAIRE

    Hjorteset, Rita

    2007-01-01

    Den argentinske tangoen gjør seg i dag gjeldende både i argentinsk og internasjonal film, noe som har vært utgangspunktet for ideen til denne oppgaven. ”Los muchachos de antes no usaban gomina” (Karene den gang brukte ikke bryl) (1937) regissert av Manuel Romero og ”Tango” (1997) regissert av Carlos Saura representerer to forskjellige eksempler fra tangofilmgenren. I denne oppgaven gjennomgås et korpus av filmer sammensatt av tre kilder i forhold til Rick Altmans 10 påstander om genre i b...

  20. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  1. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  2. Kvällspressen, ledaren och könet : En studie om mediebevakningen av Mona Sahlin och Fredrik Reinfeldt

    OpenAIRE

    Yazdanfar, Sara

    2010-01-01

    Mona Sahlin och Fredrik Reinfeldt har under valet 2010 varit bevakade av medier som statsministerkandidater. Uppsatsen analyserar vilka likheter och skillnader det finns rapporteringen av dem på kvällspressens framsidor, hur genus framställs och vad kvällspressen fokuserar på i rapporteringen av dem. Med hjälp av tabloidformats- och genusteorier av text och bild samt en kritisk diskursanalys och semiotisk analys som metod har slutsatser framkommit. Rapporteringen av dem har inte varit positiv...

  3. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  4. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  5. Norsk fiskeriforvaltning og bærekraft; en studie av forvaltningen av atlantisk laks (Salmo salar) og nordøstarktisk torsk (Gadus morhua)

    OpenAIRE

    Meaas, Anne Christine

    2012-01-01

    Laksefisket og torskefisket er forvaltet av to forskjellige sektorer, og laksefisket er i tillegg sektorovergripende på grunn av laksens anadrome livshistorie. Denne oppgaven har tatt for seg disse to forvaltningene, og sett på disse i lys av bærekraftbegrepet. Resultatene ble funnet gjennom litteraturstudier og personlig kommunikasjon med personer i forvaltningen. Lakseforvaltningen har høy sosial bærekraft, og laksefisket har et stort potensial som mål for turister og fritidsfiskere. Lak...

  6. EST Table: AV403753 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403753 pg--0010X 11/12/09 GO hit GO:0000287(magnesium ion binding)|GO:0004427(inorganic...39 aa ref|NP_290858.1| inorganic pyrophosphatase [Escherichia coli O157:H7 EDL933] ref|NP_313231.1| inorganic... pyrophosphatase [Escherichia coli O157:H7 str. Sakai] ref|NP_418647.1| inorganic... pyrophosphatase [Escherichia coli str. K-12 substr. MG1655] ref|YP_313123.1| inorganic pyrophosphatase [Sh...igella sonnei Ss046] ref|YP_410472.1| inorganic pyrophosphatase [Shigella boydii Sb227] ref|YP_405834.1| inorganic

  7. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  8. Implementering av multivariabel reglering i DCS-miljö

    OpenAIRE

    Winberg, Johan

    2009-01-01

    Inom processindustrin finns en etablerad reglerhierarki där basreglering sker med PID-regulatorer och där avancerad, multivariabel styrning sköts av MPC-programvara. Steget mellan dessa två nivåer kan upplevas som stort. För mindre och snabba multivariabla processer undvikes helst en multivariabel ansats, med försämrad reglering som följd. På Preem AB har detta upplevts som ett problem. Syftet med examensarbetet har varit att utveckla en alternativ, multivariabel styrstrategi för en process m...

  9. En brukbarhetsanalys av avancerad fastighetsautomation under förvaltningsskedet

    OpenAIRE

    Esselin, Frida; Selimovic, Seherzada

    2015-01-01

    Avancerad fastighetsautomation intog marknaden under 2000-talets första år. Visionen var att skapa smarta byggnader där fastighetsövervakning, klimatstyrning och belysning sammankopplades mot en central huvuddator för att eliminera manuell styrning. Syftet med examensarbetet är att undersöka funktionalitet och reell brukbarhet hos ett av de första installationsobjekten, PostNords huvudkontor. Rapporten presenterar fastighetens övergripande funktioner samt analyserar hur systemstyrningen kan o...

  10. Guerrillero Heroico : Alberto Kordas fotografiske portrett av Che Guevara

    OpenAIRE

    Gulljord, Hanne Gudrun

    2010-01-01

    Fotografen Alberto Diaz Gutiérrez (1928-2001), bedre kjent som Alberto Korda, tok i 1960 et snapshot av Ernesto ”Che” Guevara de la Serna (1928-1967). Korda ga senere dette portrettet tittelen Guerrillero Heroico. Portrettet blir omtalt som vår tids mest reproduserte fotografi. Denne oppgaven behandler den visuelle kulturen som har oppstått rundt dette fotografiet, og tar i den sammenhengen utgangspunkt i de historiske kontekstene som synes medvirkende til at Guerrillero Heroico forflytter...

  11. Konservering av et knust vannfilter i steingods : redde et familieklenodium

    OpenAIRE

    Heggtveit, Hilde

    2007-01-01

    Oppgaven gikk ut på å konservere et vannfilter i privat eie som hadde blitt knust under en flytteprosess. Det var ulike problemstillinger som måtte løses for å gi et best mulig resultat for gjenstand og eier. Gjenstanden er i privat eie og det vil dermed bli andre etiske problemstillinger å ta hensyn til enn med en gjenstand som tilhører et museum. Museer har retningslinjer og strenge etiske regler å forholde seg til vedtekter som er vedtatt av styret til museet og internasjonale komitee...

  12. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  13. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  14. Konstruksjon av GaAs MMIC effektforsterker med integrert linearisering

    OpenAIRE

    Kippernes, Frank Åge

    2009-01-01

    Denne oppgaven tar for seg linearisering av GaAs MMIC effektforsterkere. Det er brukt en pHEMT-prosess og senterfrekvensen ligger på 2,45 GHz. Effektforsterkerne som er konstruert kan levere utgangseffekter i størrelsesorden 1 W. Agilent Advanced Design System (ADS) ble brukt til konstruksjon og simulering. Moderne modulasjonsteknikker med varierende envelope krever lineære forsterkere for å fungere. Ulinearitetene i forsterkeren vil forvrenge signalet og skape støy både i og utenfor båndet...

  15. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  16. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  17. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  18. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p < 0.001, for optimized AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p < 0.001), while HR and BP remained unchanged. At follow-up, the improvement in CO remained stable (4.9 ± 1.3 l/min, p = 0.09), while SV slightly, but significantly, decreased (to 65.1 ± 17.6, p < 0.01). AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  19. InterProScan Result: AV402889 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402889 AV402889_3_ORF1 82B713D3A4F3515D SUPERFAMILY SSF103473 MFS general substra...te transporter 2.6e-13 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  20. InterProScan Result: AV404113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404113 AV404113_2_ORF2 F3297275DB9590B8 PRODOM PD020518 Q8X5H1_ECO57_Q8X5H1; 9e-3...3 T IPR004195 Bacteriophage lambda head decoration protein D, HDPD Cellular Component: viral capsid (GO:0019028) ...

  1. InterProScan Result: AV399408 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399408 AV399408_2_ORF1 5D6D9219C673BB29 PFAM PF05274 Baculo_E25 1.3e-78 T IPR007938 unintegrated Cellular... Component: viral envelope (GO:0019031)|Cellular Component: host cell nucleus (GO:0042025) ...

  2. Temporal dynamics of AVS and SEM in sediment of shallow freshwater floodplain lakes

    NARCIS (Netherlands)

    Griethuysen, van C.; Lange, de H.J.; Heuij, van der M.; Bies, S.C.; Gillissen, F.; Koelmans, A.A.

    2006-01-01

    Acid volatile sulfide (AVS) is an operationally defined sulfide fraction, which is considered important for trace metal fate in reduced sediments. Understanding AVS formation rates is important for the management of metal polluted sediment. However, little lis known about the fate and dynamics of

  3. InterProScan Result: AV399344 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399344 AV399344_1_ORF2 5604F45CA0D42E5E PFAM PF05314 Baculo_ODV-E27 1.4e-47 T IPR007978 Baculovirus occlus...ion-derived virus envelope EC27 Cellular Component: viral envelope (GO:0019031) ...

  4. InterProScan Result: AV405377 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405377 AV405377_1_ORF1 5614E1377E837F70 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.1e-06 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  5. AVS/Express (application visualization system) user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-09-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS/Express for image processing software and Stereo viewing system. This report summarizes the information to use AVS/Express efficiently in the computer environment for image processing. (author)

  6. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001), whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  7. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease

    Directory of Open Access Journals (Sweden)

    Christian Paech

    2015-01-01

    Full Text Available Aim: Junctional ectopic tachycardia (JET is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV block and the occurrence of JET. Materials and Methods: Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. Results: The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001, whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56. temporary third degree AV block did not suffer from JET. Conclusions: A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  8. InterProScan Result: AV399409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 429 Baculovirus LEF-11 Biological Process: viral infectious cycle (GO:0019058)|Biological Process: regulation of transcription (GO:0045449) ... ...AV399409 AV399409_1_ORF2 07DC81A7C7B2FA42 PFAM PF06385 Baculo_LEF-11 3e-33 T IPR009

  9. InterProScan Result: AV399297 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ulovirus p35, apoptosis preventing protein Biological Process: anti-apoptosis (GO:0006916)|Molecular Function: caspase inhibitor activity (GO:0043027) ... ...AV399297 AV399297_3_ORF2 F5C6B0DD046B3A9D PFAM PF02331 P35 5.2e-107 T IPR003429 Bac

  10. InterProScan Result: AV401371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401371 AV401371_2_ORF2 4E899180012BEB2A GENE3D G3DSA:3.30.465.10 no description 7...e-07 T IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 Molecular Function: catalytic

  11. InterProScan Result: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 AV404903_2_ORF1 4CB4FF124EAAC1C5 PFAM PF05187 ETF_QO 1.7e-14 T IPR007859 Electron transfer flav...oprotein-ubiquinone oxidoreductase Molecular Function: electron-transferring-flavoprote

  12. Systemisk psykoterapi och affektiv neurobiologi : en studie av psykoterapeuters upplevelse av sitt arbete på en dagverksamhet kopplat till aktuell evidensbaserad forskning

    OpenAIRE

    Rizzo, Michelangelo

    2015-01-01

    Studien har sin bakgrund i systemisk psykoterapeutisk teori och aktuell affektiv neurobiologi enligt Jaak Panksepps evidensbaserade forskning. Syftet är att undersöka psykoterapeuters beskrivning och erfarenhet av att arbeta systemiskt psykoterapeutiskt och analysera huruvida arbetet ligger i linje med systemisk teori och affektiv neurobiologisk forskning. Studien genomförs vid dagverksamheter av typen behandlingsskolor för barn och ungdomar med stora skolbekymmer och intervjuer har genomfört...

  13. Samtalegrupper for personer med Aspergers syndrom. En kvalitativ studie av hva fagpersoner forteller om planlegging, gjennomføring og effekt av samtalegrupper for personer med Aspergers syndrom

    OpenAIRE

    Jensen, Øyvind

    2014-01-01

    Denne oppgaven er skrevet ut fra problemstillingen: Hvordan beskriver fagpersoner planlegging, gjennomføring og effekt av samtalegrupper for personer med Aspergers syndrom? Den belyser teori om Aspergers syndrom, effekt av samtalegrupper samt andre viktige forhold i tilknytning til samtalegruppe, som kommunikasjon, veiledning og psykoedukasjon. Fire informanter fra nettverket «Nasjonalt fagutviklingsnettverk om psykoedukative grupper for personer med Aspergers syndrom» ble intervjuet, ...

  14. Hvem vet best? Om styringen av grunnopplæringen under Kunnskapsløftet

    Directory of Open Access Journals (Sweden)

    Petter Aasen

    2010-12-01

    Full Text Available Emnet for artikkelen er iverksettingen av Kunnskapsløftet som styringsreform. Kunnskapsløftet ble av nasjonale utdanningsmyndigheter introdusert som en reform der forutsetningen for å lykkes innebar et systemskifte i styringen av norsk grunnopplæring. Klare nasjonale mål, kunnskap om resultater, tydelig ansvarsplassering, lokal handlefrihet og et godt støtte- og veiledningsapparat skulle være bestanddelene. Artikkelens problemstilling er denne: Hva var statlige myndigheters uttalte intensjoner med systemskiftet, og hvordan oppfatter og vurderer skoleeiernivået den nye styringsmodellen for grunnopplæringen? Artikkelen bygger på prosjektet Evaluering av Kunnskapsløftet - Forvaltningsnivåenes og institusjonenes rolle. Prosjektets datamateriale inkluderer alle forvaltningsnivå (sentralstat, regionalstat, skoleeiere, skoler, lærebedrifter og rommer både kvalitative og kvantitative data. I denne artikkelen bygger fremstillingen av intensjonene bak systemskiftet på dokumenter i reformforarbeidene. Kommuner og fylkeskommuners forventninger til og vurderinger av det signaliserte systemskiftet avdekkes via kvalitative intervju blant utvalgte skoleeiere, som dermed gir innblikk i oppfatninger av systemskiftet generelt og rolle- og ansvarsfordelingen spesielt. Spørreskjemadata fra skoleeiernivået synliggjør allmenne vurderinger av styringsreformen og sier noe om de kvalitative funnenes utbredelse. Funnene våre tyder på at Kunnskapsløftets signaliserte systemskifte ikke virker etter hensikten. Blant skoleeierne er det generelt uklart hva systemskiftet innebærer. Det er heller ingen utbredt oppfatning av at det faktisk skjer endringer i styringer av grunnopplæringen i den retningen reformen la opp til. I vår analyse av forholdet mellom forvaltningsnivåene har vi lagt særlig vekt på spørsmålene om tydelig ansvarsplassering og lokal handlefrihet. Skoleeierne erfarer ikke stor lokal handlefrihet. Fristillingen følges og begrenses

  15. Vurdering av andrespråksinnlærere - en utfordring i skolen

    Directory of Open Access Journals (Sweden)

    Kirsten Palm

    2014-06-01

    Full Text Available Vurdering av andrespråkselevers språkkompetanse og språkutvikling er en sentral del av læreres arbeid, og forskning har vist at dette er en utfordring for skolene. Det er stor variasjon i vurderingsformer, og skolene mangler ofte vurderingskompetanse. På bakgrunn av dette utarbeidet Utdanningsdirektoratet i 2007 vurderingsverktøyet Kartleggingsmateriell. Språkkompetanse i grunnleggende norsk for språklige minoriteter. Materiellet er utarbeidet blant annet med referanse til Common European Framework of Reference for Languages (CEFR. I artikkelen redegjør vi for en undersøkelse der målet var å finne ut hvorvidt dette kartleggingsmateriellet er hensiktsmessig for å vurdere andrespråkselevers språkkompetanse. Hoveddataene er innhentet gjennom kasusstudier ved tre grunnskoler, der vi intervjuet skoleledelse og lærere samt observerte kartleggingssituasjoner og klasseromsundervisning. Kasusstudiene ble senere fulgt opp av to spørreundersøkelser, én til de samme skolene, og én til et større antall skoler for å få bredere innsikt i kartleggingspraksis og skolers oppfatninger av denne formen for vurdering. Undersøkelsen viser at flere av informantene mener verktøyet kan bidra til mer tilpasset og systematisk andrespråkopplæring og bedre vurdering av andrespråkselevenes språkkompetanse. Samtidig er det utfordringer knyttet til å bruke vurderingsverktøyet, dette skyldes blant annet mangelfull kompetanse i skolen når det gjelder andrespråkstilegnelse og vurdering av elevenes språkkompetanse. Det er ikke tidligere forsket på bruk av et slikt konkret kartleggingsverktøy i norsk grunnskole. Undersøkelsen kan gi et bidrag til økt kunnskap om vurdering av andrespråkskompetanse og tilpasset undervisning for andrespråksinnlærere.

  16. Apolipoprotein AV does not contribute to hypertriglyceridaemia or triglyceride lowering by dietary fish oil and rosiglitazone in obese Zucker rats

    NARCIS (Netherlands)

    Dorfmeister, B.; Brandlhofer, S.; Schaap, F. G.; Hermann, M.; Fürnsinn, C.; Hagerty, B. P.; Stangl, H.; Patsch, W.; Strobl, W.

    2006-01-01

    AIMS/HYPOTHESIS: Apolipoprotein AV (apoAV) is a recently discovered apolipoprotein with a triglyceride-lowering effect in genetically modified mice. Transcription of the human gene encoding apoAV (APOA5) is suppressed by insulin and stimulated by fibrates. Our goal was to study the expression of

  17. "La viljen din skje på jorden slik som i himmelen" : kan en analyse av ordet "thelema" i Matteusevangeliet kaste lys over forståelsen av Fadervårs tredje bønn?

    OpenAIRE

    Medhaug, Sveinar

    2011-01-01

    Tolkninger av Fadervår og den tredje bønnen finner vi bevitnet allerede fra oldkirken av. Interessen for Fadervår har ikke stilnet siden den gang. Bare det siste tiåret har det kommet flere bidrag til forskningen. Noen av disse er gjengitt i min presentasjon av nyere forsknings-historie til Fadervårs tredje bønn. Slik Raymond E. Brown poengterte det allerede i 1965, er hovedproblemstillingen i tolkningen av den tredje bønnen spørsmålet om bønnens logiske subjekt. Er dette en bønn om at Gud se...

  18. Effect of Digoxin on A-V Conduction

    Science.gov (United States)

    Spurrell, R. A. J.; Harris, A. M.; Howard, M. R.

    1971-01-01

    The effect of digoxin on A-V conduction in 19 patients with known disease of their conduction tissue was studied while a demand pacing system was in position. Fifteen had transient complete heart block after myocardial infarction and four had chronic intermittent complete heart block. The patients were studied on return to sinus rhythm. In no instance was a return to either second- or third-degree heart block precipitated in these patients despite therapeutic levels and, in some cases, high serum level of digoxin for a period of seven days. The duration of complete heart block after myocardial infarction was 4·3 days in those taking digoxin while in heart block and 3·3 days in those who started digoxin only after return to sinus rhythm. PMID:5106313

  19. Det sociala ansvaret i skapandet av skönhetsidealen

    OpenAIRE

    Koleva, Teodora

    2014-01-01

    Kandidatarbetet undersöker och diskuterar frågeställningen "Vilket socialt ansvar har jag som grafisk formgivare i skapandet av skönhetsidealen?". Kandidatarbetet fokuserar på att skapa en diskussion kring ämnet skönhetsideal, hur dessa påverkar unga kvinnor samt vilka möjligheter det finns för att bryta samhällsnormer och göra en förändring, en större skillnad. Utifrån mitt forskringsresultatet kring skönhetshistorian och dess utveckling under åren, har jag skapat en produktion i f...

  20. American AV: Edgar Dale and the Information Age Classroom.

    Science.gov (United States)

    Acland, Charles R

    2017-01-01

    This article demonstrates how the influential scholar Edgar Dale, alongside a generation of educational technologists, helped build an essential place for AV materials and pedagogical methods in the American classroom. It also shows that, for decades, the Payne Fund philanthropy supported multimedia research agendas that shaped ideas about teaching and technology, far beyond involvement in their famed studies on motion pictures and children in the 1930s. With his writings and research programs, Dale advanced concepts of media experience and systematicity, which came to be understood as common sense to the information society. In so doing he was a leading contributor to the discursive and ideological structure of our age of technological and informational abundance.

  1. Developing a computational model of human hand kinetics using AVS

    Energy Technology Data Exchange (ETDEWEB)

    Abramowitz, Mark S. [State Univ. of New York, Binghamton, NY (United States)

    1996-05-01

    As part of an ongoing effort to develop a finite element model of the human hand at the Institute for Scientific Computing Research (ISCR), this project extended existing computational tools for analyzing and visualizing hand kinetics. These tools employ a commercial, scientific visualization package called AVS. FORTRAN and C code, originally written by David Giurintano of the Gillis W. Long Hansen`s Disease Center, was ported to a different computing platform, debugged, and documented. Usability features were added and the code was made more modular and readable. When the code is used to visualize bone movement and tendon paths for the thumb, graphical output is consistent with expected results. However, numerical values for forces and moments at the thumb joints do not yet appear to be accurate enough to be included in ISCR`s finite element model. Future work includes debugging the parts of the code that calculate forces and moments and verifying the correctness of these values.

  2. EST Table: AV404292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404292 pg--0798 10/09/28 100 %/131 aa pdb|3FZB|A Chain A, Crystal Structure Of Th...e Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|B Chain B, Crystal Structure Of The Tail Termi...nator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|C Chain C, Crystal Structure Of The Tail Terminator Protei...n From Phage Lambda (Gpu-Wt) pdb|3FZB|D Chain D, Crystal Structure Of The Tail Te...rminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|E Chain E, Crystal Structure Of The Tail Terminator Pro

  3. UTVÄRDERING AV UTVALDA SD-WAN PRODUKTER

    OpenAIRE

    Åkerblom, Jacob

    2016-01-01

    Denna jämförelsestudie ämnar att undersöka marknadens leverantörer av nätverksutrustning de- finierade som Software Defined Wide Area Networks(SD-WAN). SD-WAN är en innovativ teknik som applicerar virtualisering och Software defined networking koncept i Wide Area Networks (WAN) för att skapa kostnadseffektiva nätverk. Studien har utförts på företaget Curitiba som idag arbetar med konsulttjänster inom utvalda WAN-optimering och SD-WAN-produkter. Arbetets syfte är att utvärdera SD-WAN-lösningar...

  4. Stöttning av skrivande i ett digitalt diskussionsforum

    Directory of Open Access Journals (Sweden)

    Stina Hållsten

    2017-07-01

    Full Text Available Vi vet att studenter ofta upplever akademiskt skrivande som svårt. Att skrivandet dessutom förläggs till en digital lärplattform underlättar kanske inte alltid. Större studentgrupper och minskade resurser, parallellt med ett större utbud av distanskurser, gör att digitala lärplattformar blir än viktigare inom högre utbildning. Forskning visar dock att vi i första hand använder lärplattformar i administrativt syfte, trots möjligheter till en mer pedagogisk användning, exempelvis genom mer interaktion och ett större fokus på skrivandet. Hur kan lärplattformens design och användning utvecklas pedagogiskt, närmare bestämt med ett genrepedagogiskt upplägg?Empirin för artikeln är en distanskurs i kriminologi, där all kursaktivitet skedde över utbildningens lärplattform. Kursdesignen och lärarnas aktivitet (instruktioner, responsgivande och annan stöttning analyserades tillsammans med ett mindre antal studenters användande av lärplattformen i arbetet med uppgiften Lärandedialogen. Vilka genrepedagogiska drag uppvisas redan i kursdesignen, och vilka skulle kunna förstärkas? Genrepedagogiken tar fasta på den muntliga dialogen kring text och innehåll. Därför diskuteras även hur man kan se den skriftliga, asynkrona diskussionen som något liknande det muntliga seminariesamtalet.

  5. Mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet

    Directory of Open Access Journals (Sweden)

    Sven B Eriksson

    2013-01-01

    Full Text Available Det pedagogiska ledarskapet inom högre utbildning fokuseras allt mer. Det understryks genom att flera lärosäten föreskriver såväl att pedagogiska ledare ska finnas på olika nivåer, som vilka övergripande uppgifter dessa ska ha. Denna artikel är ett resultat av en fallstudie av hur de tillägnade kunskaperna och färdigheterna från kursen Pedagogiskt ledarskap, en kurs för målgruppen studierektorer/pedagogiskt ansvariga eller motsvarande arrangerad av Universitetspedagogiskt centrum, har bidragit till deltagarnas professionalisering av det pedagogiska ledarskapet ett år efter kursens slut. Fallstudien genomfördes genom gruppintervjuer. Respondenterna uttryckte att de fått ett stärkt självförtroende i rollen som pedagogiska ledare samt att kursen bidrog till en professionalisering av rollen som pedagogiska ledare genom att stärka identiteten, att skapa en början till en handlingsetik bestående av delvis delade värderingar kring det pedagogiska ansvaret samt ge utbildning och träning i färdigheter som har sin grund i teoretisk kunskap. Kursen Pedagogiskt ledarskap ger därmed ett stöd i en process mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet.

  6. Metals sediment toxicity: Chemical approach by SEM/AVS ratio. Application on Seine estuary sediments

    Science.gov (United States)

    Clarisse, O.; Ouddane, B.; Fischer, J. C.; Wartel, M.

    2003-05-01

    Within the framework of environmental quality criteria for certain heavy metals in sediment, Acid Volatile Sulphides (AVS) has been proposed as the primary standardisation parameter in combination with the amount of simultaneously extracted metals (SEM) [1]. AVS, comprising essentially iron monosulphides in sediments, are available for binding divalent cationic metals through the formation of insoluble metal-sulphide complexes, thereby controlling the metal bioavailability and subsequent toxicity for benthic biocommunities. AVS is operationally defined as the amount of sulphides that can be volatilised during a cold acid extraction. The AVS-bound metals, with environmental concern (usually Cd, Cu, Ni, Pb and Zn), are extracted at the same time and are called simultaneously extracted metals (SEM). The ratio or the difference between AVS and SEM gives an indication of the potential sediment toxicity. Such problems on extraction procedure appears: for AVS hydrochloric acid 6 mol.dm^{-3} is current1y used [2-3] even so for SEM use of hydrochloric acid 1 mol.dm^{-3} is advised [4-5]. To investigate the influence of acid strength, sulphides and metals extractions are realized on anoxic sediments from seine estuary. SEM/AVS ratio for different acid was calculated and toxicity associated is discussed.

  7. A 2:1 AV rhythm: an adverse effect of a long AV delay during DDI pacing and its prevention by the ventricular intrinsic preference algorithm in DDD mode.

    Science.gov (United States)

    Minamiguchi, Hitoshi; Oginosawa, Yasushi; Kohno, Ritsuko; Tamura, Masahito; Takeuchi, Masaaki; Otsuji, Yutaka; Abe, Haruhiko

    2012-07-01

    A 91-year-old woman received a dual-chamber pacemaker for sick sinus syndrome and intermittently abnormal atrioventricular (AV) conduction. The pacemaker was set in DDI mode with a 350-ms AV delay to preserve intrinsic ventricular activity. She complained of palpitation during AV sequential pacing. The electrocardiogram showed a 2:1 AV rhythm from 1:1 ventriculoatrial (VA) conduction during ventricular pacing in DDI mode with a long AV interval. After reprogramming of the pacemaker in DDD mode with a 250-ms AV interval and additional 100-ms prolongation of the AV interval by the ventricular intrinsic preference function, VA conduction disappeared and the patient's symptom were alleviated without increasing unnecessary right ventricular pacing. ©2011, The Authors. Journal compilation ©2011 Wiley Periodicals, Inc.

  8. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  9. Miljöbelastning vid förtida utbyte av enstegstätad putsfasad : Orsakad av fuktskador

    OpenAIRE

    Sundström, Olle; Sundström, David

    2012-01-01

    När en konstruktion blir fuktskadad påverkas de ingående materialen på olika sätt och i vissa fall uppstår så kallad mikrobiell tillväxt som kan påverka människans hälsa. Det finns studier om hur människor reagerar på sådan mikrobiell tillväxt, hur materialen påverkas av olika fuktbelastningar och hur mycket pengar det kostar att byta ut denna konstruktion. Vad som inte finns är hur miljön påverkas att i förtid behöva byta ut en fuktskadad konstruktion. Utifrån ovan nämnda har detta examensar...

  10. Betydningen av drektige reinsimlers ernæring for kalvers vekst, klimatiske toleranse og overlevelse

    OpenAIRE

    Arne Rognmo; Karl Annar Markussen; Endre Jacobsen; Arnoldus Schytte Blix

    2013-01-01

    Forsøkene (viste) at tilleggsforing av underernærte simler i siste del av drektighetsperioden kun synes å ha effekt på fødselsvekten for kalvene forutsatt at simlene får høyverdig ernæring etter kalving. Den forskjellige ernæringsbakgrunn før kalving synes således ikke å innvirke på melkeproduksjon/kvalitet, da vektutviklingen for alle grupper av kalver i dette forsøket gikk parallelt i de tre førs...

  11. "Klubben er vår livsforsikring!" Evaluering av arbeidet i Familieklubbene i Norge

    OpenAIRE

    Fyrand, Live

    2007-01-01

    Bakgrunn for rapporten er ønske om utvikling av evalueringsverktøy og evaluering av Familieklubbene i Norge. Familieklubbene i Norge startet opp i 1999. De første klubbene ble etablert i 2000 og stiftet som egen organisasjon mars 2005. Diakonhjemmets Høgskole ved 1. amanuensis, dr. philos Live Fyrand har gjennomført evalueringen på oppdrag fra Familieklubbene i Norge. Rapporten bygger på dokumentstudier og en bruker undersøkelse gjennomført ved utvikling og bruk av spørreskjema til a...

  12. Middelalderkeramikk : en synkron og diakron analyse av keramikkmaterialet fra Oslogate 6

    OpenAIRE

    Bueklev, Ann Monica Jensen

    2006-01-01

    Denne avhandlingen tar for seg keramikk materialet fra utgravingen på feltet Oslogate 6 i Gamlebyen, Oslo. Under utgravinger i byer med røtter i middelalderen er keramikk en av de vanligste funngruppene. Så vidt vites har man ikke hatt en egen produksjon av keramikk her til lands under middelalderen, trolig er det meste av keramikken importert. Dette har ført til at man tradisjonelt har brukt keramikk til å belyse spørsmål rundt handelskontakter og variasjoner innen denne. Keramikk har også o...

  13. Jämförelse av vertikala accelerationer av järnvägsbroar för höghastighetståg.

    OpenAIRE

    Shoaibi, Martin

    2014-01-01

    Under de senaste decennierna parallellt med klimatdiskussionen har det vuxit fram ett stort intresse för höghastighetståg och en förbättrad infrastruktur i Sverige. I delar av Europa men speciellt i Kina och Japan har utvecklingen av höghastighetståg fått ett enormt lyft. Ett problem vid höjda tåghastigheter är att broarna vid en kombination av låg massa och låg egenfrekvens riskerar att orsaka resonans och höga accelerationsnivåer vid passage. Ballastspår är namnet för det traditionella järn...

  14. Overføring av avløpsvann fra Bekkelaget rensedistrikt til Sentralrenseanlegget Vest (SRV). Noen vurderinger av VA-tekniske konsekvenser. VA 12/85

    OpenAIRE

    Vråle, L.

    1985-01-01

    Undersøkelsen viser at en overføring av 1/3 part av avløpsvannet fra Bekkelaget rensedistrikt til SRV, vil redusere utslippet fra Bekkelaget vesentlig og totalbelastningen fra de to renseanleggene til fjorden fra 113 tonn P/år i 1984 til 46 tonn P/år med alt. høy rensegrad ved SRV. Oksygenbehovet i utslippet vil reduseres lite, fra 14.000 tonn O/år til 13.000 tonn O/år. Ved overføring av alt avløpsvann til SRV viser beregningene at fosforutslippene kan reduseres til 48 tonnP/år med alt. høy r...

  15. Patientens upplevelse av oro i samband med den preoperativa omvårdnaden : En litteraturstudie

    OpenAIRE

    Hellman, Kelly; Zhao Chen, Lijun

    2016-01-01

    Bakgrund: Oro drabbar de flesta patienter inför operation. Det finns många faktorer som påverkar patientens upplevelser av oro både inom vården och det liv patienten befinner sig i. Det är av stor vikt att få en ökad förståelse av hur den preoperativa omvårdnaden kan minska patientens oro och lidande utifrån patientens perspektiv.  Syfte: Att beskriva patientens upplevelse av oro i samband med den preoperativa omvårdnaden.  Metod: En deskriptiv litteraturstudie baserad på kvalitativa artiklar...

  16. Neurofibromatosis with vertebral artery A-V fistula and cervical meningocele -a case report-

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yong Joo; Suh, Kyung Jin; Kim, Tae Heon; Kang, Duk Sik; Park, Yeun Mook; Park, June Sik [College of Medicine, Kyungpook National University, Daegu (Korea, Republic of)

    1988-06-15

    Arteriovenous fistula is a rare abnormality in patient with neurofibromatosis. A review of English-language literature revealed only 3 reported cases. We report a case of neurofibromatosis with vertebral artery A-V fistula and cervical meningocele.

  17. Förändringar av arbetssätt vid implementering av BIM : En kvalitativ studie av två traditionella projekteringars arbetssätt och tid- och resursplanering samt vilka förändringar som är nödvändiga vid implementering av BIM

    OpenAIRE

    Jansson, Magnus; Knutsson, Kristian

    2012-01-01

    I en rapport från 2005 framtagen av FoU-Väst i samverkan med Centrum för management i byggsektorn (CMB) konstateras att en betydande del av allt slöseri i byggsektorn är kopplat till fel och konsekvenserna av dessa, med andra ord felkostnader. Studien visar att felkostnader står för cirka 10 % av ett projekts produktionskostnad.   Byggsektorn står nu, år 2012, inför förändringar i sitt arbetssätt för att minska antalet fel, öka kvaliteten och effektiviteten. BIM – Building Information Modelin...

  18. Språklige og verdimessige utfordringer ved innføring av klassifikasjonssystemet NANDA

    Directory of Open Access Journals (Sweden)

    Lisa Øien

    2009-02-01

    Full Text Available Artikkelen setter fokus på sykepleielederes opplevelse av språk og innhold i kodeverket NANDA (North American Nursing Diagnoses Association, et klassifikasjonssystem for sykepleiediagnoser. Funnene som presenteres er framkommet gjennom semistrukturerte intervju med tre sykepleieledere fra tre ulike avdelinger innen samme helseforetak. Det er brukt fenomenologisk hermeneutisk metode i analysen. Studien viser at språket oppleves som fremmed og stigmatiserende, og at det derfor finnes motstand mot å ta klassifiseringsverktøyet i bruk. Det foreligger en verdikonflikt mellom sykepleierens humanistiske grunnsyn og den grunnlagstenkningen sykepleieren opplever i møte med NANDA. Funnene blir viktige med tanke på utvikling og videreutvikling av klassifikasjonssystemer for bruk av sykepleiere i Norge. Videre arbeid med standardisering av sykepleiedokumentasjon må ta hensyn til at klassifikasjonssystemer ikke er verdinøytrale.

  19. Postprandial increase of plasma apoAV concentrations in Type 2 diabetic patients.

    Science.gov (United States)

    Pruneta-Deloche, Valérie; Ponsin, Gabriel; Groisne, Laure; Fruchart-Najib, Jamila; Lagarde, Michel; Moulin, Philippe

    2005-08-01

    Postprandial hypertriglyceridemia is considered as a risk factor for cardiovascular disease in Type 2 diabetes. However, little is known about the underlying mechanisms. Since the recently discovered apolipoprotein (apo) AV was identified as a modulator of triglyceride (TG) metabolism, the aim of the study was to determine the postprandial apoAV profile of Type 2 diabetic patients. We compared data from 11 patients with Type 2 diabetes mellitus to that of 12 non-diabetic normolipidemic subjects following the ingestion of a lipid-rich cream. Postprandial apoAV was elevated in diabetic patients but no correlation was observed either with plasma TG concentration or with the intensity of lipoprotein lipase-dependent lipolysis. These data obtained in human subjects suggest that plasma apoAV concentration does not play an acute or a direct role in the regulation of plasma TG in the postprandial state.

  20. Påvisning av nye biomarkører i plasma-proteomet

    Directory of Open Access Journals (Sweden)

    Jens P. Berg

    2009-10-01

    Full Text Available Svar på laboratorieanalyser er av avgjørende betydning for ressursbruk i helsevesenet i forbindelse med utredning, behandling og oppfølgning av pasienter. Undersøkelser fra USA viser at ca. 70% av alle beslutninger som foretas i helsevesenet i stor grad er basert på resultater fra laboratoriene (1. Størst betydning for bruk av ressurser og folkehelse har laboratorieanalyser som kan brukes til å identifisere personer med økt risiko for sykdom som kan forebygges eller kureres. De mest dramatiske eksempler på dette finner man for noen dominant arvelige kreftformer hvor en enkelt genetisk undersøkelse kan påvise personer som trenger ekstra oppfølgning og i enkelte tilfeller profylaktisk kirurgisk behandling. Blod utgjør det viktigste materialet for laboratorieundersøkelser. I denne artikkelen vil vi beskrive noen av mulighetene som finnes i letingen etter nye biomarkører i form av proteiner og peptider i plasmaproteomet som betegner det totale uttrykket av proteiner i plasma. Utviklingen av immunometriske og massespektrometriske metoder har åpnet nye muligheter til å finne nye sykdomsmarkører både som ”nye” proteiner og i form av modifikasjoner som er dannet etter at proteinet er syntetisert (post-translasjonelle modifikasjoner. Effektiv testing av kombinasjoner av flere titalls markører gjør det mulig å lete etter sykdomsspesifikke ”fingeravtrykk” i proteomet. Plasma-proteomet karakteriseres imidlertid også av at bare noen få proteiner utgjør kvantitativt det meste av proteomet og av store konsentrasjonsforskjeller mellom de ulike proteinene. God tilgang på godt karakteriserte kliniske materialer er helt nødvendig for å kunne validere nytten av en ny biomarkør. Et effektivt samarbeid mellom metode-utviklere og biobanker er derfor av avgjørende betydning for hvor raskt en ny biomarkør kan bli en diagnostisk eller prognostisk faktor.Determination of new biomarkers in the plasma proteome. Decision making and use

  1. FabAV antivenin use after copperhead snakebite: clinically indicated or knee-jerk reaction?

    OpenAIRE

    Gale, Stephen C.; Peters, Jo Ann; Allen, LaDonna; Creath, Robert; Dombrovskiy, Viktor Y

    2016-01-01

    Abstract Background Crotalidae Polyvalent Immune Fab (Ovine) (FabAV) antivenin is commonly recommended after pit viper snakebites. Because copperhead envenomations are usually self-limited, some physicians are reluctant to use this costly treatment routinely, while others follow a more liberal approach. We hypothesized that, in practice, only patients with evidence of significant (moderate or severe) copperhead envenomation [those with snakebite severity score (SSS) > 3] receive FabAV and e...

  2. Et sosiologisk blikk på mobbing. En teoretisk studie av paradigmet og fenomenet mobbing

    OpenAIRE

    Stemland, Linn

    2007-01-01

    Mobbing er et tema som har fått stadig mer oppmerksomhet i samfunnsdebatten. Det er gjort lite sosiologisk forskning omkring fenomenet mobbing. Forskningsfeltet mobbing er i dag konstruert og dominert av psykologiens begreper og forståelse. I denne oppgaven prøver jeg å nærme meg en sosiologisk forståelse av begrepet og fenomenet mobbing.

  3. [F-18]-AV-1451 binding correlates with postmortem neurofibrillary tangle Braak staging.

    Science.gov (United States)

    Marquié, Marta; Siao Tick Chong, Michael; Antón-Fernández, Alejandro; Verwer, Eline E; Sáez-Calveras, Nil; Meltzer, Avery C; Ramanan, Prianca; Amaral, Ana C; Gonzalez, Jose; Normandin, Marc D; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-06-13

    [F-18]-AV-1451, a PET tracer specifically developed to detect brain neurofibrillary tau pathology, has the potential to facilitate accurate diagnosis of Alzheimer's disease (AD), staging of brain tau burden and monitoring disease progression. Recent PET studies show that patients with mild cognitive impairment and AD dementia exhibit significantly higher in vivo [F-18]-AV-1451 retention than cognitively normal controls. Importantly, PET patterns of [F-18]-AV-1451 correlate well with disease severity and seem to match the predicted topographic Braak staging of neurofibrillary tangles (NFTs) in AD, although this awaits confirmation. We studied the correlation of autoradiographic binding patterns of [F-18]-AV-1451 and the stereotypical spatiotemporal pattern of progression of NFTs using legacy postmortem brain samples representing different Braak NFT stages (I-VI). We performed [F-18]-AV-1451 phosphor-screen autoradiography and quantitative tau measurements (stereologically based NFT counts and biochemical analysis of tau pathology) in three brain regions (entorhinal cortex, superior temporal sulcus and visual cortex) in a total of 22 cases: low Braak (I-II, n = 6), intermediate Braak (III-IV, n = 7) and high Braak (V-VI, n = 9). Strong and selective [F-18]-AV-1451 binding was detected in all tangle-containing regions matching precisely the observed pattern of PHF-tau immunostaining across the different Braak stages. As expected, no signal was detected in the white matter or other non-tangle containing regions. Quantification of [F-18]-AV-1451 binding was very significantly correlated with the number of NFTs present in each brain region and with the total tau and phospho-tau content as reported by Western blot and ELISA. [F-18]-AV-1451 is a promising biomarker for in vivo quantification of brain tau burden in AD. Neuroimaging-pathologic studies conducted on postmortem material from individuals imaged while alive are now needed to confirm these observations.

  4. Kvalitetsutvärdering av biomedicin och närliggande huvudområden

    DEFF Research Database (Denmark)

    Leffler, Hakon; Fex Svenningsen, Åsa; Emgård, Mia

    2014-01-01

    UKÄ:s utvärdering av biomedicinutbildningar visar på en mycket varierad kvalitet. Nio av 21 utbildningar håller toppklass medan mer än hälften bedöms vara bristande. 21 utbildningar inom biomedicin har satts under lupp. Kvaliteten bedöms som vanligt efter en tregradig skala: mycket hög kvalitet, ...

  5. GPS, RT90 og Rikets nät. Om posisjonsbestemmelse av svenske grotter

    OpenAIRE

    Brattli, Tore

    2006-01-01

    Om unøyaktighet i posisjonsbestemmelse ved bruk av Garmin sitt svenske rutenett "Rikets nät". For sentrale deler av Sverige er avviket minimalt (6m i Stockholm), mens det i nord og sør kan være opp til 28m. For nøyaktige posisjoner i Rikets nät på Garmin GPS, skal både datum og rutenett stilles til RT90.

  6. Molecular Analysis and Effectiveness Assay of AV1 Gene in Transgenic Tobacco for Resistance to Begomovirus

    OpenAIRE

    Santoso, Tri Joko; Herman, Muhammad; Hidayat, Sri H; Aswidinnoor, Hajrial; Sudarsono, Sudarsono

    2012-01-01

    Genetic transformationof tobacco plant using AV1 gene was conducted atthe previously experiment and generated transgenic tobaccoplants positively carrying the selectable marker nptII gene.The objectives of this experiment were to (1) analyze thepresence of Begomovirus AV1 gene in T0 generation putativetransgenic tobacco plants using PCR technique with specificprimers and its correlation with resistance phenotype, (2)analyze the integration and copy number of the transgene inT0 generation puta...

  7. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  8. The Galactic NH - AV Relation and its Application to Historical Galactic SNRs

    OpenAIRE

    Tian, Wen-Wu; Su, Hongquan; Xiang, F. Y.

    2013-01-01

    We refine a classic relation between the hydrogen column density (NH) and optical extinction (Av) by employing 39 Galactic Supernova Remnants (SNRs) with X-rays, optical and/or infra-red data available. We find NH = (1.69+/-0.07)*10^21 Av cm^(-2) mag^(-1) . Applying this relation to three Galactic SNRs with good historical records allows us to further constrain either their progenitor's distances or magnitudes, which is independent access to their distances.

  9. ADHD og atypisk hånddominans : en studie av forekomst av atypisk hånddominans hos barn og ungdom med ADHD

    OpenAIRE

    Seim, Ronny

    2008-01-01

    Bakgrunn og formål Formålet med undersøkelsen er å undersøke om det blant barn og ungdom med ADHD forekommer høyere grad av atypisk hånddominans sammenliknet med gjennomsnittsbefolkningen, og å gjennom teori undersøke hva årsakene kan være hvis dette forekommer. Problemstilling og forskningsspørsmål Problemstillingen er formulert slik: Finnes det en høyere forekomst av atypisk hånddominans blant barn og ungdom med ADHD, og hvilke(n) årsak(er) kan dette ha hvis en slik forekomst eksi...

  10. Stop-motion i filmen ”Du som inte fanns” : En processbeskrivning av den visuella stilen och användandet av stop-motion

    OpenAIRE

    Lönnberg, Christer

    2012-01-01

    I mitt examensarbete berättar jag om processen bakom den visuella stilen i dokumentär-filmen ”Du som inte fanns”. Jag behandlar teorierna och bakgrunden till de inspel-ningsmetoder jag valt till filmen. De inspelninsmetoder jag valt för att skapa den visuella stilen grundar sig på stillbilder tagna med stillbildkamera och kallas för stop-motion. Det finns olika typer av stop-motion och i filmen ”Du som inte fanns” använde jag mig av pixilation och timelapse. I detta examensarbete går jag ocks...

  11. First application of the meteorological Mini-UAV 'M{sup 2}AV'

    Energy Technology Data Exchange (ETDEWEB)

    Spiess, T.; Bange, J.; Buschmann, M.; Voersmann, P. [Braunschweig Univ. (Germany). Inst. fuer Luft- und Raumfahrttechnik

    2007-04-15

    The limitations of manned airborne meteorological measurements led to a new unmanned system, the Meteorological Mini-UAV (M{sup 2}AV), recently developed by the Institute of Aerospace Systems, Technical University of Braunschweig. The task was to develop, test and verify a meteorological sensor package as payload for an already available carrier aircraft, the UAV 'Carolo T200'. Thereby the limitations in size and mass had to be respected. The M{sup 2}AV is capable of performing turbulence and wind vector measurements within the atmospheric boundary layer and permits very short measurement cycles as an economic supplement during meteorological campaigns. The article gives details on the technical items. Results from meteorological data sets measured by the M{sup 2}AV are used for data quality assessment. In October 2005 the M{sup 2}AV participated in the meteorological field experiment 'LAUNCH 2005' in Lindenberg near Berlin. The M{sup 2}AV data were compared with lidar and sodar/RASS measurements. Furthermore, an in situ comparison of temperature, humidity and wind vector data with the helicopter-borne turbulence probe Helipod was analysed and gave information about the M{sup 2}AV data quality. (orig.)

  12. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Directory of Open Access Journals (Sweden)

    Kei Inai

    Full Text Available Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM components, versican and hyaluronan (HA, and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  13. ADVANCED VITRIFICATION SYSTEM (RIC AVS) RESEARCH AND DEVELOPMENT PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    J.R. Powell; M. Reich

    2003-06-30

    The objective of this AVS testing program is to use bench-scale test equipment to produce a vitrified product at maximum waste loading from the specified AZ-101 waste simulant and conduct a TTT analysis using laboratory scale melts to show compliance with the DOE Waste Acceptance Product Specifications for Vitrified High-Level Waste Forms (WAPS). The vitrified product complies with the following WAPS. A borosilicate glass with a waste loading of 60.9-wt% was produced from a slurry feed of AZ101 simulant. Glass durability testing, glass characterization testing, and testing methodology were performed in accordance with the Department of Energy approved Test Plan. The glass has two crystalline phases and good uniformity of composition. The Product Consistency Test on the 6 location-specific samples are at least 1 to 2 orders of magnitude below the mean PCT results for the EA glass. Standard deviations were less than 10% of measured values. The glass transition temperature averaged 658 {+-} 9 C. A TTT diagram was produced. There was measured cesium loss of about 2%, and compliance with the Universal Treatment Standards.

  14. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  15. Surgical analysis for 106 cases with A-V patterns strabismus

    Directory of Open Access Journals (Sweden)

    Xi-Lang Wang

    2013-08-01

    Full Text Available AIM: To analyze the causes and evaluate the surgical effect of A-V patterns strabismus.METHODS: Clinical data of 106 caseswith A-V patterns strabismus in our hospital from January 2011 to December 2012 were retrospectively analyzed. Seventy patients with oblique muscle overaction were performed weakening oblique muscle surgery to treat A-V pattern. Twenty-six patients with no abnormality of oblique muscle and superior and inferior rectus muscle, and with >20△ between gaze up 25° and down 25° in V pattern and with >15△ between gaze up 25° and down 25° in A pattern were performed horizontal rectus muscle transposition to half to one muscle tendon. While ten patients with no obvious abnormality of oblique muscle and vertical rectus muscle, and with ≤20△ between gaze up 25° and down 25° in V pattern and with ≤15△ between gaze up 25°and down 25° in A pattern were only performed horizontal rectus muscle surgery.RESULTS: No A-V patterns was defined asnormotopia and A-V patterns >10△ was defined as overcorrection or undercorrection after surgery. In 106 cases, V pattern was corrected in 75 cases, overcorrected in 5 cases, undercorrected in 4 cases. A pattern was corrected in 15 cases, overcorrected in 3 cases, undercorrected in 4 cases. Horizontal strabismus >±10△ was defined as overcorrection or undercorrection after surgery. Eighty-five cases were corrected, 11 cases were undercorrected, and 10 cases were overcorrected.CONCLUSION: A-V patterns strabismus was caused mainly by abnormal extraocular muscle. A-V patterns with abnormal oblique movement were treated by oblique surgery and A-V patterns with normal oblique and vertical rectus movement were treated by horizontal rectus muscle transposition, both which corrected A-V patterns. Patients had good distance and near stereopsis postoperation. Binocular weakening oblique muscle surgery can correct primary ocular position, so surgical design of horizontal deviation about A-V

  16. Universell utforming og den vanskelige avgrensingen av «alle»

    Directory of Open Access Journals (Sweden)

    Lars Christian Risan

    2013-12-01

    Full Text Available Universell utforming er et prinsipp hvor målsetningen er at «utforming av produkter og omgivelser [skal skje] på en slik måte at de kan brukes av alle mennesker, i så stor utstrekning som mulig, uten behov for tilpassing og en spesiell utforming.» (Aslaksen mfl, 1997, den første norske definisjonen I løpet av de siste 15 årene har dette prinsippet blitt fremmet i Norge som et utvetydig fremskritt. Det kan imidlertid være farlig å tro at en ren teknisk løsning kan bygge bro over politiske kontroverser (Imrie 2012, og i denne artikkelen vil vi vise hvordan viktige ideologiske premisser er skjult under paraplyen om universalitet. Vårt empiriske felt er norsk boligpolitikk fra etterkrigstiden og fram til i dag. Innenfor dette feltet ser vi at det har vært argumentert for ulike versjoner av «universell utforming» de siste 40 årene, selv om navnet «universell utforming» er av nyere dato. Vi vil vise hvordan prinsippet har endret seg fra å ha et sosialdemokratisk innhold – før det ble omdøpt til «universell utforming» – for å bli inkorporert i et nyliberalt boligpolitisk paradigme de siste 15 årene. De sosialdemokratiske forgjengerne til «universell utforming» ble til dels formulert som videreutviklinger av en boligpolitikk for sosial rettferdighet og økonomisk likhet. Med innføringen av begrepet «universell utforming» har denne brede sosiale rammen forsvunnet, men under dekke av universalitet og entydig framskrittsoptimisme har denne politiske endringen blitt underkommunisert.[i] [i] Prosjektet er finansiert av Husbanken. Prosjektmedarbeiderne har bestått av NIBR-forskerne Erik Henningsen, Siri Nørve og Lars Risan. Underveis har disse forskerne intervjuet og snakket med en rekke personer innenfor feltene funksjonshemming- og boligpolitikk. Vi takker også Jon Guttu, Olav Rand Bringa, Tore Lange for mange konstruktive innspill. 

  17. Hvor moralsk tenker fotballspillere? – en empirisk studie av toppfotball

    Directory of Open Access Journals (Sweden)

    Lars Tore Ødegård

    2015-11-01

    Full Text Available Det er en utbredt oppfatning at det økende prestasjonskravet i toppfotball fører til en svekkelse av moral og fair play-holdninger. Men hvordan tenker toppfotballspillere i forhold til ulike dilemmaer som oppstår på banen, og er det forskjeller mellom toppfotballspillere og spillere på lavere nivå?  For å avklare dette gjennomførte vi en empirisk undersøkelse der vi intervjuet spillere og trener i én toppklubb og én breddeklubb. Vi var interessert i to hovedproblemstillinger:  1 Hva tenker fotballspillere på ulike prestasjonsnivå om etikk og moralske dilemmaer i fotball? 2 Hvilke faktorer påvirker spillerne, direkte og indirekte, i deres vurderinger og handlinger? Resultatene fra undersøkelsen viser at det er store forskjeller mellom de to prestasjonsnivåene. Spillerne på breddenivået føler generelt et større ansvar for å opptre ærlig på banen enn hva som er tilfelle på toppnivået. Vi fant 4 spesifikke faktorer i toppfotballen som bidrar til umoralsk opptreden. For det første opplever spillerne en forventning om at de prioriterer resultat foran fair play. For det andre bidrar tilstedeværelsen av supportere på kamper til en slik prioritering. For det tredje vil handlinger som er i strid med fair play signaliseres som akseptable internt i miljøet, selv om de ofte signaliseres som uakseptable overfor media og omverdenen. For det fjerde kan spillere oppleve det som vanskelig å gå i mot trenerens oppfordringer til en pragmatisk og resultatfokusert opptreden.Nøkkelord: moral, etikk, fair play, footballEnglish summary: How morally do football players think? – an empirical study of moral dilemmas in elite footballIt is a common view that the increasing focus on achievement and success in elite football leads to a weakening of moral and fair play attitudes. But how do elite players think and what do they think about different dilemmas that appear on the field, and is there a difference between elite players and lower

  18. Left-sided approach of AV junction ablation for drug refractory atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Yoga Yuniadi

    2006-06-01

    Full Text Available AV junction ablation has been proven effective to treat symptomatic atrial fibrillation refractory to antiarrhythmias or fail of pulmonary vein isolation. However, about 15% of conventional right-sided approach AV junction ablation failed to produce complete heart block. This study aimed to characterize His bundle potential at ablation site during conventional or left-sided approach of AV junction ablation. Twenty symptomatic AF patient (age of 60.5 ± 9.28 and 11 are females underwent conventional AV junction ablation. If 10 applications of radiofrequency energy are failed, then the ablation was performed by left-sided approach. Seventeen patients are successfully ablated by conventional approach. In 3 patients, conventional was failed but successfully ablated by left-sided approach. The His bundle amplitude at ablation site was significantly larger in left-sided than correspondence right-sided (16.0 ± 4.99 mm vs. 6.9 ± 4.02 mm respectively, p = 0.001, 95% CI -14.0 to -4.3. ROC analysis of His bundle potential amplitude recorded from right-sided revealed that cut off point of > 4.87 mm given the sensitivity of 81.3% and specificity of 53.8% for successful right-sided approach of AV junction ablation. In case of failed conventional approach, the left-sided approach is effective for AV junction ablation. An early switch to the left-sided approach may avoid multiple RF applications in patients with a low amplitude His-bundle potential (< 4.87 mm. (Med J Indones 2006; 15:109-14Keywords: Atrial fibrillation, AV junction ablation, left-sided approach

  19. Englischsprachige Erweiterung des TIB|AV-Portals: Ein GND-DBpedia-Mapping zur Gewinnung eines englischen Begriffssystems

    OpenAIRE

    Sven Strobel

    2014-01-01

    Die Videos des TIB|AV-Portals werden mit insgesamt 63.356 GND-Sachbegriffen aus Naturwissenschaft und Technik automatisch verschlagwortet. Neben den deutschsprachigen Videos verfügt das TIB|AV-Portal auch über zahlreiche englischsprachige Videos. Die GND enthält zu den in der TIB|AV-Portal-Wissensbasis verwendeten Sachbegriffen nur sehr wenige englische Bezeichner. Es fehlt demnach ein englisches Indexierungsvokabular, mit dem die englischsprachigen Videos automatisch verschlagwortet werden k...

  20. Atrial rate adaptive pacing: what happens to AV conduction?

    Science.gov (United States)

    Linde, C; Nordlander, R; Rosenqvist, M

    1994-10-01

    To investigate if an nonphysiological prolongation of the AV interval is common during activity sensor modulated atrial rate adaptive (AAIR) pacing, 21 patients with sinus node disease treated with fixed rate atrial (AAI) or AAIR pacemakers were examined. Spike-Q intervals were compared at different heart rates obtained by overdrive pacing at rest and during exercise (Study I), measured during exercise at unresponsive (AAI), optimal (AAIR) and over responsive programming (AAIR+) of the activity sensor (Study II), and finally examined by 24-hour Holter recording in AAI and AAIR pacing modes (Study III). Study I: The spike-Q interval increased significantly with increasing heart rate at rest, but not during exercise. At rest the spike-Q interval was significantly higher at all heart rates compared to exercise. There was a significant positive correlation between the maximal spike-Q interval at rest and the maximal spike-Q interval during exercise (r = 0.63). Study II: The spike-Q interval was shortest in the AAI and longest in the AAIR+ mode in all patients. Study III: During AAI or AAIR pacing the spike-Q interval was longest at night and shortest in the morning. The mean spike-Q interval was longer in AAIR than in AAI pacing. No statistical difference between the maximal spike-Q intervals observed during the two modes was, however, found. Variations in spike-Q interval are generally caused by changes in autonomic tone or medication with drugs with antiarrhythmic effect.(ABSTRACT TRUNCATED AT 250 WORDS)

  1. Utfordringer i norsk produksjon av plommer (Prunus domestica L.) og søtkirsebær (Prunus avium L.)

    OpenAIRE

    Kind, Heidi; Olsen, Anne Cecilie

    2016-01-01

    Hensikten med denne studien var å kartlegge mulige årsaker til hvorfor steinfruktavlingene i Norge ikke har økt som følge av omfattende satsing på steinfruktproduksjon. De siste16 år har det vært stort fokus på produksjon av plomme og søtkirsebær. Arealet av steinfrukt har i denne perioden økt betraktelig, uten at fruktmengden har økt tilsvarende. Det er også store årlige variasjoner i avlingsmengde, noe som ofte begrunnes med klima. Interessen for kvalitetsfrukt av søtkirsebær og plommer er ...

  2. Pastorer i trosbevegelsen : en studie av to norske pastorer sin autoritetsforståelse og rolleforståelse

    OpenAIRE

    Bryne, Jarle

    2007-01-01

    Jeg har valgt bevisst et omfattende sammendrag. Sammendraget er utformet med tanke på at det skal være mulig for leseren å få et inntrykk av mine resultater i prosjektet uten at leseren trenger å lese hele prosjektet. Jeg har laget et sammendrag fra hvert kapittel. Kapittel 1: Prosjektet mitt handler om undersøkelser av to sentrale ledere i trosbevegelen. Henholdsvis Åge Åleskjær som er leder av Oslo Kristne Senter på Kjeller og Enevald Flåten som inntil 2006 var leder av Levende Ord Bibel...

  3. Kjøring med mistanke om påvirkning av andre rusmidler enn alkohol

    Directory of Open Access Journals (Sweden)

    Asbjørg S. Christophersen

    2009-10-01

    Full Text Available  SAMMENDRAGStatens rettstoksikologiske institutt har i løpet av de siste år registrert en stor økning av prøver fra bilføreremistenkt for kjøring under påvirkning av andre rusmidler enn alkohol. Antall positive saker økte 42% fra1994 til 1995. De hyppigste påviste stoffer er tetrahydrocannabinol, amfetamin, benzodiazepiner og opiater(morfin/kodein. Bruk av tyngre narkotiske stoffer har blitt mer vanlig i trafikksammenheng og antall positivetilfeller har økt betydelig mer enn totalt antall saker. Fra 1994 til 1995 økte antall positive amfetaminprøvermed 75% (fra 533 til 937 og antall positive prøver som følge av heroininntak økte med 87% (fra 92 til 172.Bruk av flere stoffer samtidig er vanlig, over 60 % av sakene i 1995 var positive på mer enn ett stoff, alkoholikke medregnet. De fleste tilfeller var representert av menn i alderen 25-32 år (37%. Kvinner var representerti ca. 11% av sakene.Christophersen AS, Skurtveit S, Mørland J. Drivers suspected to drive under the influence of drugs otherthan alcohol. Nor J Epidemiol 1996; 6 (1: 45-48.ENGLISH SUMMARYThe National Institute of Forensic Toxicology has registered a large increase in the number of samples fromdrivers suspected to drive under influence of drugs other than alcohol. The number of drug positive casesincreased 42% from 1994 to 1995. The most frequent drugs detected are tetrahydrocannabinol, amphetamine,benzodiazepines and opiates (morphine/codeine. The frequency of hard narcotic drug use has increased morethan the total number of cases. From 1994 to 1995, the number of amphetamine positive samples increased75% (from 533 to 937 and the number of samples positive due to heroin use (detection of the metabolite 6-monoacetylmorphine in urine increased 87%. Multi-drug use is common and more than one drug wasdetected in more than 60% of the cases from 1995, alcohol not included. Most of the cases were representedby men 25-32 years old (37%. Women were represented in about

  4. Context-Aware UPnP-AV Services for Adaptive Home Multimedia Systems

    Directory of Open Access Journals (Sweden)

    Roland Tusch

    2008-01-01

    Full Text Available One possibility to provide mobile multimedia in domestic multimedia systems is the use of Universal Plug and Play Audio Visual (UPnP-AV devices. In a standard UPnP-AV scenario, multimedia content provided by a Media Server device is streamed to Media Renderer devices by the initiation of a Control Point. However, there is no provisioning of context-aware multimedia content customization. This paper presents an enhancement of standard UPnP-AV services for home multimedia environments regarding context awareness. It comes up with context profile definitions, shows how this context information can be queried from the Media Renderers, and illustrates how a Control Point can use this information to tailor a media stream from the Media Server to one or more Media Renderers. Moreover, since a standard Control Point implementation only queries one Media Server at a time, there is no global view on the content of all Media Servers in the UPnP-AV network. This paper also presents an approach of multimedia content integration on the Media Server side that provides fast search for content on the network. Finally, a number of performance measurements show the overhead costs of our enhancements to UPnP-AV in order to achieve the benefits.

  5. Vorticity-divergence semi-Lagrangian global atmospheric model SL-AV20: dynamical core

    Science.gov (United States)

    Tolstykh, Mikhail; Shashkin, Vladimir; Fadeev, Rostislav; Goyman, Gordey

    2017-05-01

    SL-AV (semi-Lagrangian, based on the absolute vorticity equation) is a global hydrostatic atmospheric model. Its latest version, SL-AV20, provides global operational medium-range weather forecast with 20 km resolution over Russia. The lower-resolution configurations of SL-AV20 are being tested for seasonal prediction and climate modeling. The article presents the model dynamical core. Its main features are a vorticity-divergence formulation at the unstaggered grid, high-order finite-difference approximations, semi-Lagrangian semi-implicit discretization and the reduced latitude-longitude grid with variable resolution in latitude. The accuracy of SL-AV20 numerical solutions using a reduced lat-lon grid and the variable resolution in latitude is tested with two idealized test cases. Accuracy and stability of SL-AV20 in the presence of the orography forcing are tested using the mountain-induced Rossby wave test case. The results of all three tests are in good agreement with other published model solutions. It is shown that the use of the reduced grid does not significantly affect the accuracy up to the 25 % reduction in the number of grid points with respect to the regular grid. Variable resolution in latitude allows us to improve the accuracy of a solution in the region of interest.

  6. Güneydoğu Marmara'da Algarna ile Karides Avcılığında Av Kompozisyonu ve Hedef Dışı Av.

    Directory of Open Access Journals (Sweden)

    Yusuf Kenan Bayhan

    2015-12-01

    Full Text Available Bir yıl süre ile yürütülen bu çalışma, Kasım 2000 - Ekim 2001 tarihleri arasında Güneydoğu Marmara’da gerçekleştirilmiştir. Çalışmada, algarna ile avcılıkta hedef tür olan derin su pembe karidesi (Parapenaeus longirostris’in ağırlık ve sayısal miktarları ile bunun dışındaki av kompozisyonu, türlerin boy dağılımları ve toplam av içerisindeki sayısal oranları araştırılmıştır. Yapılan çekimler sonucunda, toplam avın sayısal olarak % 64.5’ni hedef tür olan Parapenaeus longirostris, % 35.5’ini hedef dışı av oluşturmuştur. 50 türün bulunduğu hedef dışı avın % 17.16’sını Kemikli balıklar (Osteichthyes, % 8.58’ini Kabuklular (Crustacea-Decapoda, % 4.94’ünü Derisi Dikenliler (Echinodermata, % 2.53’ünü Yumuşakçalar (Mollusca, % 2.14’ünü Cnidaria ve % 0.13’ünü kıkırdaklı balıklar (Chondrichthyes oluşturmuş, toplam av içerisinde Parapenaeus longirostris’in dışında sayısal olarak en çok yakalanan türlerin başında ise Kaya balığı, Mezgit, Kancaağız pisi, Yengeç, Deniz yıldızı ve Deniz hıyarı’nın geldiği belirlenmiştir

  7. Mineralogic mapping of the Av-9 Numisia quadrangle of Vesta

    Science.gov (United States)

    Frigeri, A.; De Sanctis, M. C.; Ammannito, E.; Buczkowski, D.; Combe, J. P.; Tosi, F.; Zambon, F.; Rocchini, D.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2015-10-01

    In this manuscript we present the mineralogic mapping of the Av-9 Numisia quadrangle of Vesta using the most up-to-date data from the NASA-Dawn mission. This quadrangle is located in Vesta's equatorial zone (22° south to 22° north, 218° to 288° east, in Claudia coordinate system) and takes its name from the impact crater Numisia. The main feature, which dominates the quadrangle, is the Vestalia Terra plateau, a topographic high about 10 km above the surrounding areas. To the south, this region fades into the Rheasilvia basin, while to the north it is bounded by the steep scarp of Postumia basin. The Visible and Infrared mapping spectrometer (VIR) onboard NASA/Dawn provided the main data source for this work, at an unprecedented level of spatial and spectral resolution. In particular we are using spectral parameters to synthesize characteristics of the whole spectra into a single value. Pyroxene-related spectral parameters allow for the detection of lower crust or mantle material (diogenites) and upper crust material (eucrites) in the study area. The combined analysis of albedo from the Framing Camera, the geologic map and the spectroscopic data offer an interesting opportunity to understand better the surface features of this region of Vesta, and their evolution. Numisia, Cornelia, Fabia, Teia and Drusilla are the main craters in the study area, rich in bright and dark material outcrops, pitted terrains and OH-rich materials. Using the spectral parameters we demonstrate that the internal composition of Vestalia Terra is mainly diogenite-rich howardite, as shown by materials excavated by Cornelia and Fabia, and the composition of the slope north of Vestalia Terra. This agrees with the strong positive Bouguer Anomaly observed in the area, indicating a higher density of these features in relation to the surrounding areas. Besides the recently published works based on gravimetric modeling and geologic interpretation, the mineralogic mapping presented herein gives

  8. Testbatteri för talapraxi : Utformning och pilotnormering av ett artikulationstest

    OpenAIRE

    Albinsson, Sophie; Berglund, Julia

    2010-01-01

    Talapraxi är en talmotorikstörning som drabbar planeringen och programmeringen av talet, vilket visar sig som avvikelser i artikulation och prosodi. I dag finns inget svenskt test för utredning av talapraxi. Syftet med studien var därför att utforma ett testbatteri på svenska som är känsligt även för lindriga grader av talapraxi. Detta test pilotnormerades på 50 friska deltagare.  För att kunna studera hur kön, ålder och utbildningsnivå kan inverka på prestationen i testbatteriet, eftersträva...

  9. FastVDO enhancements of the AV1 codec and comparison to HEVC and JVET codecs

    Science.gov (United States)

    Topiwala, Pankaj; Dai, Wei; Krishnan, Madhu

    2017-09-01

    This paper describes a study to investigate possible ways to improve the AV1 codec, in several directions, most particularly in the context of 10-bit HDR video content, and 8/10 bit image content. Applications to SDR video, and 360 content are discussed elsewhere. For HDR content, a data adaptive grading technique in conjunction with the AV1 codec is studied. For image content, lapped biorthogonal transforms for (near) lossless compression is studied. For scalability-type applications, we introduce advanced resampling filters which outperform current ones. It is asserted that useful improvements are possible in each of these categories. In particular, substantial value is offered in the coding of HDR content, very competitive with HEVC HDR10, in a coding framework offering backwards compatibility with SDR. We also provide a rudimentary comparison of AV1 to the standard HEVC as well as the developing JVET codecs.

  10. Amerikanimerad kultur : En kritisk diskursanalys av kulturella värderingar i Inside Out och Minions

    OpenAIRE

    Ragnhage, Lukas; Wendel, Erik

    2016-01-01

    Animerad film har under de senaste 100 åren utvecklats i en snabb takt, från korta tecknade Disney-filmer till dagens datoranimerade långfilmer. Ledande inom denna utveckling är USA som med sina lättsmälta animerade filmer etablerat sig som underhållningsform i många familjers hem världen över. Amerika har med hjälp av företag som Disney och Pixar blivit pionjärer inom genren och dominerar distributionen av animerad film i världen.   Med ett av världens mest inflytelserika länder som största ...

  11. Hockeykjelke - Setebunn og knestøtte: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    Seim, Anders

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndtere pucken. Hyppige retningsforandringer gjør svingresponsen til en...

  12. Replikprovning som metod för prognos av kryplivslängd.

    OpenAIRE

    Hansson, Sofia

    2016-01-01

    Replikprovning är en oförstörande provningsmetod som ofta tillämpas på komponenter i högtemperaturanläggningar i syfte att studera utveckling av krypskador. Metoden går ut på att man i fält tar en kopia, benämnd replik, av stålets ytliga mikrostruktur genom att lägga en plastfilm eller gummimassa på en noggrant preparerad yta. Genom att studera mikrostrukturen i mikroskop kan man på ett tidigt stadium upptäcka krypskador i form av kaviteter, håligheter, i korngränserna och därigenom göra en b...

  13. Editering i Double Indemnity & Body Heat : En analys av klassisk film noir och modern neo noir

    OpenAIRE

    Sandberg, Nicklas

    2015-01-01

    Mitt examensarbete är en analys av två filmers tidsperiodiska skillnader i editeringsstilar. Filmerna som ingår i analysen är Double Indemnity (1944) och Body Heat (1981). Syftet med arbetet är att se hur dessa filmer med liknande berättelser och 30 år mellan varandra använder sig av olika editeringsstilar som är representativa av tidsperioden de är gjorda i. På samma gång vill jag se hur dessa stilar påverkar hur en åskådare upplever filmen. Arbetet är begränsat såvida att jag enbart fokuser...

  14. Multinational evaluation of the interpretability of the iterative method of optimisation of AV delay for CRT.

    Science.gov (United States)

    Raphael, Claire E; Kyriacou, Andreas; Jones, Siana; Pabari, Punam; Cole, Graham; Baruah, Resham; Hughes, Alun D; Francis, Darrel P

    2013-09-20

    AV delay optimisation of biventricular pacing devices (cardiac resynchronisation therapy, CRT) is performed in trials and recommended by current guidelines. The Doppler echocardiographic iterative method is the most commonly recommended. Yet whether it can be executed reliably has never been tested formally. 36 multinational specialists, familiar with using the echocardiographic iterative method of CRT optimisation, were shown 20-40 sets of transmitral Doppler traces at 6-8 AV settings and asked to select the optimal AV delay. Unknown to the specialists, some Doppler datasets appeared in duplicate, allowing assessment of both inter and intra-specialist interpretation. On the Kappa scale of agreement (1 = perfect agreement, 0 = chance alone), the agreement regarding optimal AV delay between specialists was poor (kappa=0.12 ± 0.08). More importantly, agreement of specialists with themselves (i.e. viewing identical sets of traces, twice) was also poor, with Kappa=0.23 ± 0.07 and mean absolute difference in optimum AV delay of 83 ms between first and second viewing of the same traces. Iterative AV optimisation is not executed reliably by experts, even in an artificially simplified context where biological variability and variation in image acquisition are eliminated by use of identical traces. This cannot be blamed on insufficient skills of some experts or discordant methods of selecting the optimum, because operators also showed poor agreement with themselves when assessing the same trace. Instead, guidelines should retract any recommendation for this algorithm. Guideline-development processes might usefully begin with a rudimentary check on proposed algorithms, to establish at least minimal credibility. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  15. Helsekonsekvenser av vektendring - er slanking fordelaktig? En litteraturoversikt

    Directory of Open Access Journals (Sweden)

    Anne Johanne Søgaard

    2009-11-01

    Full Text Available  SAMMENDRAGLangsom vektøkning gjennom livet inntil kroppsmasseindeks (KMI 27 ser ikke ut til å gi særlige negative utfallmht. total dødelighet. En økning på ! 20 kg fra 18 års alder er trolig negativt – det samme er vektøkning ut fra enhøy utgangsvekt. Selv om mange studier finner økt dødelighet hos yngre og middelaldrende personer med KMI > 27,er det foreløpig ingen studier som har vist at vektreduksjon blant friske overvektige personer gir økt levetid. Flerestudier viser tvert imot en assosiasjon mellom vektreduksjon og økt dødelighet. Heller ikke studier som prøver åbegrense analysene til personer med frivillig vekttap, finner redusert dødelighet etter vektreduksjon blant friskeovervektige individer. Noen få studier har vist redusert dødelighet blant overvektige personer med etablertesykdommer eller høy risiko for hjerte-karsykdom og diabetes. Når det gjelder sykelighet har de fleste studier entenikke funnet noen assosiasjon mellom vektreduksjon og sykelighet, eller funnet økt sykelighet. Unntaket er diabetes,der vekttap i enkelte studier samvarierer med redusert sykelighet. Det er i mange studier funnet sammenheng mellomvekttap og økt risiko for lårhalsbrudd og gallesten. De fleste studier har imidlertid vist at moderat vektreduksjon(vekttap på opp til 10% fører til redusert blodtrykk, forbedret glukosekontroll, redusert kolesterolnivå, forbedretdyslipidemi, forbedret lungefunksjon, bedre søvnkvalitet og redusert søvnapnè. Moderat vekttap vil også kunnelindre leddsmerter. Dette tilsynelatende paradoks diskuteres i artikkelen – bl.a. drøftes de metodeproblemer som erinnebygget i mange av studiene. Fordi det har vist seg vanskelig for personer med kraftig overvekt å redusere vektenpermanent – og fordi resultatene mht. helseeffektene av vektreduksjon er usikre, bør hovedinnsatsen settes inn iforhold til å forebygge overvekt/fedme overfor enkeltpersoner med potensielle problemer. Personer med

  16. Saken är biff : En granskning av samförstånd och motsättningar vid införandet av en minskad nötköttskonsumtion

    OpenAIRE

    Molin, Elvira

    2017-01-01

    Svenskarna är ibland de som konsumenterna konsumerar mest nötkött i världen, de äter 26 kg per person och år. Matkonsumtionen generellt står för en tredjedel av de svenska hushållens utsläpp av växthusgaser, och g. Globalt sett står djuruppfödningen till köttproduktion för 14,5 % av utsläppen av alla växthusgaser. Kor är idisslare och deras matsmältning avger metangas vilket bidrar mer till växthuseffekten jämfört med uppfödning av andra djur som inte idisslar. För att minska de utsläppen kan...

  17. Sammenhengen mellom livserfaringer og utvikling av langvarige muskelplager og fibromyalgi; en fenomenologisk livsverdenstudie av 5 kvinners livserfaringer i årene før de fikk diagnosen fibromyalgi

    Directory of Open Access Journals (Sweden)

    Anne Kristin Wanvik

    2011-06-01

    Resultater; En sterk andreorientering og smerter og trøtthet i kroppen og lange perioder med fysisk og psykisk stress i årene før de fikk diagnosen fibromyalgi. Plagene ble forsøkt skjøvet bort og ignorert og symptomene ble verre med årene. En opplevelse av kroppen som noe annet enn ”dem selv”. Konklusjon; Kvinner som utvikler fibromyalgi viser i denne studien en splittelse mellom kroppen og selvet, og at kroppen ofte oppleves som et objekt.  Dette kan sees som en manglende identifisering med og en objektgjøring av egen kropp.  Denne fremmedgjøringen og objektgjøringen av egen kropp synes å ha vært medvirkende til overbelastning av kroppen og utvikling av langvarige muskelplager for kvinnene i studien.

  18. FabAV antivenin use after copperhead snakebite: clinically indicated or knee-jerk reaction?

    Science.gov (United States)

    Gale, Stephen C; Peters, Jo Ann; Allen, LaDonna; Creath, Robert; Dombrovskiy, Viktor Y

    2016-01-01

    Crotalidae Polyvalent Immune Fab (Ovine) (FabAV) antivenin is commonly recommended after pit viper snakebites. Because copperhead envenomations are usually self-limited, some physicians are reluctant to use this costly treatment routinely, while others follow a more liberal approach. We hypothesized that, in practice, only patients with evidence of significant (moderate or severe) copperhead envenomation [those with snakebite severity score (SSS) > 3] receive FabAV and examined a large cohort to determine the relationship between clinical findings and FabAV administration. All data from patients evaluated for copperhead snakebite at a rural tertiary referral center from 5/2002 to 10/2013 were compiled. Demographics, transfer status, antivenin use, and clinical findings were collected; SSS was calculated. The relationships among FabAV use, clinical findings, and SSS were analyzed using t-test, chi-square, and Pearson's coefficient (p copperhead snakebite; 44 (13.8 %) received antivenin. Median dose was four vials (range: 1-10; IQR: 4,6). There were no deaths. Most patients receiving FabAV (63.6 %) were admitted. With regard to demographics and symptoms, only the degree of swelling (moderate vs. none/mild; p  3, indicating moderate or severe envenomation, was only very weakly correlated with antivenin use (r = 0.217; p  3 (65.8 %) did not receive antivenin while most patients who did receive antivenin (70.5 %) had SSS ≤ 3 (indicating mild envenomation). Considerable variation occurs in antivenin administration after copperhead snakebite. Use of FabAV appears poorly correlated with patients' symptoms. This practice may expose patients to the risks of antivenin and increasing costs of medical care without improving outcomes. Guidelines used for treating other pit viper strikes, such as rattlesnake or cottonmouth snakebite may be too liberal for copperhead envenomations. Our data suggests that most patients with mild or moderate envenomation

  19. Kompatibilitetstesting av TPN og legemidler gitt som Y-infusjon til barn

    OpenAIRE

    Iqbal, Herra

    2014-01-01

    Total parenteral ernæring (TPN) inneholder glukose, fett og aminosyrer i tillegg til vitaminer, sporelementer og elektrolytter. TPN er en olje-i-vann emulsjon som er stabilisert med emulgatorer. Parallellinfusjon av TPN og legemidler kan være ønskelig i tilfeller hvor det er mangel på intravenøse innganger. Ved å administrere TPN og legemiddel gjennom et Y-sett kan en muliggjøre administrering av to komponenter parallelt, men det er samtidig en risiko for inkompatibilitet mellom legemidlet og...

  20. Kamerabasert navigasjon ved hjelp av landemerker med ukjent avstand fra kameraplanet

    OpenAIRE

    Engen, Simen Tvedt

    2015-01-01

    Kamerabasert navigasjon er en metode for å estimere posisjon og orientering til en plattform ved hjelp av informasjon fra optiske kamerabilder. Det kan være aktuelt i flere situasjoner. Eksempler på dette kan være der det ikke finnes eller er dårlig GPS dekning som innendørs, i et urbant miljø, under vann eller i situasjoner der hvor GPS signalet blir jammet . Oppgavens mål er å gjøre seg kjent med kamerabasert navigasjon og videre se om implementering av akselerasjon- og vinkelhastighetsmål...

  1. Friluftsliv som del av behandling for sykelig fedme - opplevelser og meninger fra deltagernes perspektiv

    OpenAIRE

    Haugen, Anders Lund; Tangen, Steffen

    2010-01-01

    Begrunnelse for valg av tema: Overvekt og fedme er et økende problem over hele verden, og WHO omtaler dette som en epidemi som må behandles og forebygges. Overvekt og fedme gir forringet livskvalitet for den enkelte og har en betydelig samfunnskostnad med tanke på tapt arbeidskapasitet og sykdomsbehandling. Behovet for å finne behandlingstiltak som fungerer, øker i tråd med utviklingen av problemet. Konservativ behandling har varig livsstilsendring som mål og retter seg mot forhold som kostho...

  2. Friluftsliv som del av behandling for sykelig fedme - opplevelser og meninger fra deltagernes perspektiv

    OpenAIRE

    Haugen, Anders Lund; Tangen, Steffen

    2010-01-01

    En kombinert studie, med innhenting av både kvalitative og kvantitative data. Har som formål å få innsikt i hvordan friluftsliv oppleves blant mennesker som er til behandling for sykelig fedme ved en behandlingssinstitusjon. Begrunnelse for valg av tema: Overvekt og fedme er et økende problem over hele verden, og WHO omtaler dette som en epidemi som må behandles og forebygges. Overvekt og fedme gir forringet livskvalitet for den enkelte og har en betydelig samfunnskostnad med tanke på tapt...

  3. Millennials och baby boomers attityder till fake news : Generationernas upplevelser av nyhetsmediers sanningshalt

    OpenAIRE

    Adolfsson, Claes; Strömberg, Markus; Stenberg, John

    2017-01-01

    Syftet med denna uppsats var att ta reda på generationerna millennials och baby boomers inställning till mediernas sanningshalt och politiska neutralitet. Detta gjordes med hjälp av följande frågeställningar: Vilka attityder och vilken inställning har millennials och baby boomers till nyhetsmediernas sanningshalt? Finns skillnader och likheter kvar när vi väger in variablerna kön och politiskt ställningstagande?   För att definiera generationerna använde vi oss av Cliff Zukins generationsteor...

  4. Betydningen av drektige reinsimlers ernæring for kalvers vekst, klimatiske toleranse og overlevelse

    Directory of Open Access Journals (Sweden)

    Arne Rognmo

    2013-03-01

    Full Text Available Forsøkene (viste at tilleggsforing av underernærte simler i siste del av drektighetsperioden kun synes å ha effekt på fødselsvekten for kalvene forutsatt at simlene får høyverdig ernæring etter kalving. Den forskjellige ernæringsbakgrunn før kalving synes således ikke å innvirke på melkeproduksjon/kvalitet, da vektutviklingen for alle grupper av kalver i dette forsøket gikk parallelt i de tre første ukene etter kalving. Det ble heller ikke på noe punkt funnet signifikante forskjeller gruppene imellom når det gjelder kalvenes klimatiske toleranse. Det er dog bemerkelsesverdig at det var stor dødelighet blant de små kalvene etter unge små simler i GRUPPE L. Dette funn er interessant sett i sammenheng med resultatene fra Røros (se bidrag fra Dag Lenvik, side som viser at avkastningen fra en flokk kan økes markant om man konsentrerte slakteuttaket på små kalver og forhindrer bedekning av små, unge simler gjennom fjerning av eldre, store bukker. Med det forbehold at våre forsøk er utført på dyr i innhegning med et lavt aktivitetsnivå, kan man fra våreforsøk foreløpig konkludere med at tillegsfor ing av simler i siste halvdel av drektighetsperioden har effekt på kalvenes fødselsvekt, men at vektutviklingen for kalven er uavhengig av simlenes ernæringshistorie, om sistnevnte tilbys høyverdig ernæring etter kalving. Da små kalver etter underernærte simler viste høy dødelighet like etter fødselen, vil imidlertid tilleggsforing kunne øke avkastningen om det er mange unge simler i flokken. Resultatene fra Røros tyder imidlertid på at dette resultat normalt kan oppnås uten ekstra omkostninger gjennom et selektivt slakteuttak.

  5. Erfarenheter av att leva med stomi efter kolo-/rektalcancer : En litteraturstudie

    OpenAIRE

    Rydelius, Linn; Proena, Antonia

    2015-01-01

    Erfarenheter av att leva med stomi efter kolo-/rektalcancer Bakgrund: Vanligaste orsaken till att en stomi anläggs är kolorektalcancer. En stomioperation kan orsaka förändringar i personens liv. Det kirurgiska ingreppet har stor inverkan på personens kropp. Personen kan uppleva oro, nedsatt självbild och försämrad livskvalitet. Personen med stomi kan även uppleva förändringar i det sociala livet och sexualiteten. Syfte: Syftet med studien var att belysa personers erfarenheter av att leva med...

  6. Apolipoprotein A-V interaction with members of the low density lipoprotein receptor gene family

    DEFF Research Database (Denmark)

    Nilsson, Stefan K; Lookene, Aivar; Beckstead, Jennifer A

    2007-01-01

    lipoprotein receptor family, the low density lipoprotein receptor-related protein and the mosaic type-1 receptor, SorLA. Experiments using surface plasmon resonance showed specific binding of both free and lipid-bound apolipoprotein A-V to both receptors. The binding was calcium dependent and was inhibited...... by the receptor associated protein, a known ligand for members of the low density lipoprotein receptor family. Preincubation with heparin decreased the receptor binding of apolipoprotein A-V, indicating that overlap exists between the recognition sites for these receptors and for heparin. A double mutant...

  7. Mellom risiko og kontroll - en studie av eksplisitte modelleringsformer i norsk grunnskolelærerutdanning

    Directory of Open Access Journals (Sweden)

    Fride Lindstøl

    2017-12-01

    Full Text Available Å være lærerutdanner skiller seg fra andre stillinger innenfor høyere utdanning: Lærerutdanneren underviser både i fagstoff og i hvordan studentene kan lære bort og adaptere fagstoffet i klasserommet. Det at lærerutdanneren underviser i det å undervise, har implikasjoner for hvordan undervisningen planlegges, gjennomføres og analyseres i lærerutdanningen – undervisningens form blir en del av budskapet. Lærerutdannerens arbeid handler derfor om å utforme, velge og sette i spill aktiviteter og oppgaver som kan adaptere fag, forskning, didaktikk og teori til klasserom og profesjonen. Utforming og montasje av de ulike delene eller episodene i et undervisningsforløp kan betegnes som undervisningsforløpets dramaturgi. I denne artikkelen har jeg gjort en dramaturgisk analyse av tre lærerutdanneres undervisning for å identifisere og beskrive hvordan de bruker eksplisitte modelleringsformer, og hva som skjer når de bruker dem. I etterkant av den dramaturgiske analysen har jeg gjort en konvensjonell innholdsanalyse av intervjudata for å undersøke hvordan lærerutdannerne selv forklarer formålet og erfaringer med å bruke eksplisitt modellering i undervisningen. Analyse av tre lærerutdanneres undervisningspraksis sammenfattes i en modelleringsstige som visualiserer hvordan enkelte former for eksplisitte modelleringsformer tilbyr en egen sirkulær dramaturgi. Studien antyder og drøfter også på hvilken måte modelleringsstigen kan fungere som en dramaturgisk modell, som kan brukes som utgangspunkt for lærerutdanneres planlegging, gjennomføring og analyse av egen undervisning. Studien er et bidrag til å utvikle og forske på hvordan eksplisitte modelleringsformer kan brukes for å skape sammenheng mellom praktisk lærerarbeid og teoretisk metarefleksjon i lærerutdannerens undervisning. Innsamling av data er gjort i profesjonsverksted, som kan forklares som en læringsarena hvor lærerutdannere fra ulike fag samarbeider om

  8. Fortellingens autonomi versus avhengighet til konteksten : en komparativ analyse av to fortelleteoretiske perspektiver

    OpenAIRE

    Knappen, Ingvild Viker

    2004-01-01

    Sammendrag Denne oppgaven handler om en diskusjon mellom Seymour Chatman og Barbara Herrstein Smith om hvordan forstå fortellingens natur. Disse representerer hvert sitt syn på dette. Er fortellingen autonom, og uavhengig mediet det realiseres i, eller er fortellingen avhengig av fortellekonteksten, det vil si at man må ta konteksten i betraktning hvis man skal skjønne hvorfor fortellingen har den form den har. Mitt formål er ikke å avgjøre hvilke av disse teoretiske perspektivene som har...

  9. TRŽENJSKA ANALIZA PRIVLAČNOSTI DRŽAV ČLANIC ASEAN

    OpenAIRE

    Seršen, Natalija

    2010-01-01

    Združenje držav Jugovzhodne Azije (ASEAN) je dandanes na gospodarskem področju zelo aktivno in prinaša pozitivne rezultate glede na učinkovitost. Države ASEAN tako predstavljajo pomemben trg, zato je njihovo poznavanje velikega pomena. Bruto domači proizvod (BDP) teh držav je v nenehnem vzponu in posledično tudi gospodarska rast. Največji delež BDP ustvarjata sekundarni in terciarni sektor, imajo tudi naravna bogastva in stalno naraščajoč izvoz in uvoz, vedno bolj se razvijajo na področj...

  10. Forsøk med planting av lakserogn i nedre Glomma 2011-2012

    OpenAIRE

    Rustadbakken, A.; Lund, E.

    2013-01-01

    Som avbøtende tiltak mot rekrutteringssvikt hos laks i Glomma, ble det vinteren 2011-2012 gjennomført et rognplantingsforsøk. Rogna ble plantet i Whitlock-Vibert-Bokser (WVB) for å kunne evaluere klekkesuksess på fire stasjoner. Det ble totalt satt ut 45 000 rognkorn, hvorav 10 000 stk ble satt ut i kontrollkasser for evaluering av klekkesuksess. I forbindelse med vannføringsøkning i april, mista vi to av de fire kontrollkassene. Rognoverlevelsen ved Papirfabrikken (1) og oppstrøms Grusørene ...

  11. Prevalens av metabolsk syndrom i ulike sosioøkonomiske grupper

    OpenAIRE

    Lien, Ann Helen

    2015-01-01

    Bacheloroppgave folkehelse, 2015 Helse varierer i stor grad mellom ulike sosioøkonomiske grupper og anses som en stor folkehelseutfordring. Livsstilsrelaterte sykdommer er et stadig økende problem, hvor metabolsk syndrom de senere årene har fått mye oppmerksomhet. Formålet med dette litteraturstudiet er å undersøke i hvilken grad prevalensen av metabolsk syndrom følger en sosial gradient. Det vil i noen grad diskuteres årsaksforhold knyttet til utvikling av metabolsk syndrom i ulike sosioø...

  12. Rollspråk i dubbning och undertextning : En analys av rollspråket i den japanska undertextningen och dubbningen av en svensk barnfilm

    OpenAIRE

    Nilsson, Jorunn

    2015-01-01

    I Japan är s.k. rollspråk, dvs. stereotypt språk kopplat till en viss typ av karaktär, vanligt i material riktat till barn, såsom barnfilmer. Trots att rollspråk som forskningsområde är relativt nytt finns ett antal studier som behandlar rollspråk i litterära översättningar, undertextningar och dubbningar till japanska. Få eller inga har dock jämfört hur rollspråket påverkar karaktäriseringen dels i undertexterna, dels i dubbningen av en och samma film. Denna uppsats analyserar japansk undert...

  13. Kvinnliga patienters upplevelse av stød vid traumatiska livshändelser i form av sexuella övergrepp : En litteraturöversikt

    OpenAIRE

    Myhre, Mia; Jasinska, Maja

    2017-01-01

    SAMMANFATTNING  Bakgrund: Sexuella övergrepp ökar i det svenska samhället, vilket kan leda till posttraumatiskt stressyndrom. De kvinnor som utsatts för övergrepp befinner sig i ett stort behov av professionell hjälp och stöd från vårdpersonal under återhämtningsprocessen. Syfte: Syftet med studien var att undersöka hur kvinnor som varit utsatta fören traumatisk livshändelse i form av sexuellt våld upplever det stöd de har fått från vårdpersonalen. Metod: Den metod som valdes var litteraturs...

  14. Mahaim Fiber Accelerated Automaticity and Clues to a Mahaim Fiber Being Morphologically an Ectopic or a Split AV Node

    Directory of Open Access Journals (Sweden)

    Shomu Bohora

    2010-01-01

    Full Text Available Mahaim Fiber tachycardia characteristically causes a wide QRS tachycardia with left bundle branch morphology and left axis deviation, especially in young patients, having no structural heart disease. Mahaim fiber automaticity further cements the proposition of Mahaim fiber, due to its Atrioventricular (AV node like property, being called as an ectopic AV node.

  15. Landing Gear Stroke and Load Predictions for the AV-8B Aircraft and Three Ski Jump Ramp Profiles for the Italian Carrier Andrea Doria

    National Research Council Canada - National Science Library

    Imhof, Gregory

    2004-01-01

    .... The effort was funded through a 90-day contract to use the NAVAIR AV-8B simulation to assess the landing gear stroke and load characteristics of the AV-8B aircraft with three potential ski jump...

  16. Etikk i anvendt idrettspsykologi: en kvalitativ studie av idrettspsykologiske rådgiveres etiske utfordringer i anvendt idrettspsykologi, og håndtering av disse

    OpenAIRE

    Ulltang, Espen

    2015-01-01

    Masteroppgave - Norges idrettshøgskole, 2015 Idrettspsykologi er et fag som arbeider for å utvikle mentale ferdigheter hos utøvere og trenere. De som arbeider med anvendt idrettspsykologi møter en rekke etiske utfordringer i sin praksis, men kunnskap om dette synes mangelfullt i Norge. Internasjonalt er det publisert en rekke essays, artikler, og bøker om etiske utfordringer i anvendelsen av faget, men ingen studier viser hvordan norske idrettspsykologiske rådgivere opplever sl...

  17. Møter med Allah : en undersøkelse av personlig tro og religiøs praksis blant unge norskpakistanere

    OpenAIRE

    Asheim, Marie Toreskås

    2007-01-01

    Denne oppgaven er en religionshistorisk undersøkelse av unge norskpakistaneres forhold til og forståelse av Allah. Oppgaven benytter seg av et utvalg teoretiske perspektiver om personlig tro, gudsopplevelse, bønn og minoritetssituasjonen. Religionspsykologiske perspektiver og teologiske blikk på kristen tro trekkes også inn for å belyse materialet. Teoretiske blikk på sammenhengen mellom livshistorier og tro blir tatt i bruk for å fremme betydningen av de personlige fortellingene. Materia...

  18. Reversing the direction of paced ventricular and atrial wavefronts reveals an oblique course in accessory AV pathways and improves localization for catheter ablation

    NARCIS (Netherlands)

    Otomo, K.; Gonzalez, M. D.; Beckman, K. J.; Nakagawa, H.; Becker, A. E.; Shah, N.; Matsudaira, K.; Wang, Z.; Lazzara, R.; Jackman, W. M.

    2001-01-01

    The purpose of this study was to determine how often accessory atrioventricular (AV) pathways (AP) cross the AV groove obliquely. With an oblique course, the local ventriculoatrial (VA) interval at the site of earliest atrial activation (local-VA) and the local-AV interval at the site of earliest

  19. Den högre utbildningen. Ett fält av marknad och politik

    Directory of Open Access Journals (Sweden)

    Mats Arvidson

    2013-01-01

    Full Text Available Mats Arvidson recenserar:Den högre utbildningen. Ett fält av marknad och politik (2012, Daniel Ankarloo & Torbjörn Friberg (red., Mats Alvesson, Daniel Ankarloo, Ola Fransson, Torbjörn Friberg, Michael Gustavsson, Bengt Göransson, Ylva Hasselberg, Sharon Rider, Steven Sampson, Gidlunds Förlag, isbn: 9178448344

  20. Den högre utbildningen. Ett fält av marknad och politik

    OpenAIRE

    Mats Arvidson

    2013-01-01

    Mats Arvidson recenserar:Den högre utbildningen. Ett fält av marknad och politik (2012), Daniel Ankarloo & Torbjörn Friberg (red.), Mats Alvesson, Daniel Ankarloo, Ola Fransson, Torbjörn Friberg, Michael Gustavsson, Bengt Göransson, Ylva Hasselberg, Sharon Rider, Steven Sampson, Gidlunds Förlag, isbn: 9178448344

  1. Specialized treatment for Avoidant personality disorder (AvPD): Treatment rationales and preliminary results

    DEFF Research Database (Denmark)

    Simonsen, Sebastian

    and preliminary results from a specialized psychotherapy program developed for patients with AvPD treated at Stolpegaard Psychotherapy Centre, Capital Region of Denmark. Methods: Treatment consists of individual therapy based on Metacognitive Interpersonal Therapy (MIT) while group therapy is a modified form...

  2. Impact of e-AV Biology Website for Learning about Renewable Energy

    Science.gov (United States)

    Nugraini, Siti Hadiati; Choo, Koo Ah; Hin, Hew Soon; Hoon, Teoh Sian

    2013-01-01

    This paper considers the design and development of a Website for Biology in senior high schools in Indonesia. The teaching media, namely e-AV Biology, was developed with the main features of video lessons and other features in supporting the students' learning process. Some video lessons describe the production process of Biofuel or Renewable…

  3. RSF governs silent chromatin formation via histone H2Av replacement.

    Directory of Open Access Journals (Sweden)

    Kazuma Hanai

    2008-02-01

    Full Text Available Human remodeling and spacing factor (RSF consists of a heterodimer of Rsf-1 and hSNF2H, a counterpart of Drosophila ISWI. RSF possesses not only chromatin remodeling activity but also chromatin assembly activity in vitro. While no other single factor can execute the same activities as RSF, the biological significance of RSF remained unknown. To investigate the in vivo function of RSF, we generated a mutant allele of Drosophila Rsf-1 (dRsf-1. The dRsf-1 mutant behaved as a dominant suppressor of position effect variegation. In dRsf-1 mutant, the levels of histone H3K9 dimethylation and histone H2A variant H2Av were significantly reduced in an euchromatic region juxtaposed with heterochromatin. Furthermore, using both genetic and biochemical approaches, we demonstrate that dRsf-1 interacts with H2Av and the H2Av-exchanging machinery Tip60 complex. These results suggest that RSF contributes to histone H2Av replacement in the pathway of silent chromatin formation.

  4. A Heart too Drunk to Drive; AV Block following Acute Alcohol Intoxication.

    Science.gov (United States)

    van Stigt, Arthur H; Overduin, Ruben J; Staats, Liza C; Loen, Vera; van der Heyden, Marcel A G

    2016-02-29

    Acute excessive alcohol consumption is associated with heart rhythm disorders like atrial fibrillation but also premature ventricular contractions, collectively known as the "holiday heart syndrome". More rarely but clinically significant are reports of atrioventricular (AV) conduction disturbances in binge drinkers with no underlying heart disease or chronic alcohol consumption. To obtain better insights into common denominators and the potential underlying mechanisms we collected and compared individual case reports of AV block following acute alcohol intoxication in otherwise healthy people. By screening PubMed, Google Scholar, Scopus and JSTOR, fifteen cases were found of which eight were sufficiently documented for full analysis. Blood alcohol levels ranged from 90 to 958 mg/dl (19 to 205 mM). Second and third degree AV block was observed most (6/8) albeit that in two of these patients a vagal stimulus led to deterioration from first into higher order AV block. In all cases, patients reverted to normal sinus rhythm upon becoming sober again. Mildly lowered body temperature (35.9 ± 0.5°C) was observed but can be excluded as a major cause of conduction blockade. We hypothesize that ethanol induced partial inhibition of calcium and potentially also sodium currents in conductive tissue structures may be one of the mechanisms of conduction slowing and block that may become exaggerated upon increased vagal tone. An impairment of gap junction function cannot be excluded as a contributing factor. In conclusion, cases of documented alcohol induced AV block are very rare but events can occur at relatively low serum alcohol levels which should prompt to awareness of this phenomenon in alcohol intoxicated patients.

  5. … en perser och resten flygvärdinnor… : En kvalitativ studie av tågmästarnas upplevelser av företagskultur och yrkesroll i omorganiseringen 2003/2004 vid SJ AB, Stockholm

    OpenAIRE

    Ackelman Thunholm, Josefina; Sobat, Virginia

    2009-01-01

    Denna studie behandlar tågmästarnas upplevelser av företagskultur och yrkesroll i omorganiseringen 2003/2004, vid SJ AB Stockholm. Det empiriska materialet bygger på kvalitativa forskningsintervjuer med sju tågmästare, som arbetade ombord på x2000 under omorganiseringen.I analys av empirin har vi kunnat se indikatorer på att företagskulturen påverkar tågmästarnas upplevelser av omorganisering. Utifrån deras syn på den aktuella omorganiseringen, tolkar vi det som att förändringar som inte över...

  6. Non-physiological increase of AV conduction time in sinus disease patients programmed in AAIR-based pacing mode.

    Science.gov (United States)

    Mabo, Philippe; Cebron, Jean-Pierre; Solnon, Aude; Tassin, Aude; Graindorge, Laurence; Gras, Daniel

    2012-11-01

    The EVOCAV(DS) trial aimed to quantify the paradoxal atrioventricular (AV) conduction time lengthening in sinus node (SD) patients (pts) paced in AAIR-based pacing mode. SD pts, implanted with dual-chamber pacemaker programmed in AAIR-based pacing mode, were randomized in two arms for a 1-month period: the low atrial pacing (LAP; basic rate at 60 bpm, dual sensor with minimal slope) and the high atrial pacing (HAP; basic rate at 70 bpm, dual sensor with optimized slope, overdrive pacing) arm. At 1 month, crossover was performed for an additional 1-month period. AV conduction time, AV block occurrence and AV conduction time adaptation during exercise were ascertained from device memories at each follow-up. Seventy-nine pts participated to the analysis (75 ± 8 years; 32 male; PR = 184 ± 38 ms; bundle branch block n = 12; AF history n = 36; antiarrhythmic treatment n = 53; beta-blockers n = 27; class III/Ic n = 18; both n = 8). The mean AV conduction time was significantly greater during the HAP (275 ± 51 ms) vs. LAP (263 ± 49 ms) period (p AAIR-based pacing in SD pts may induce a significant lengthening of pts' AV conduction time, including frequent abnormal adaptation of AV conduction time during exercise.

  7. Cardiac resynchronization therapy and AV optimization increase myocardial oxygen consumption, but increase cardiac function more than proportionally.

    Science.gov (United States)

    Kyriacou, Andreas; Pabari, Punam A; Mayet, Jamil; Peters, Nicholas S; Davies, D Wyn; Lim, P Boon; Lefroy, David; Hughes, Alun D; Kanagaratnam, Prapa; Francis, Darrel P; Whinnett, Zachary I

    2014-02-01

    The mechanoenergetic effects of atrioventricular delay optimization during biventricular pacing ("cardiac resynchronization therapy", CRT) are unknown. Eleven patients with heart failure and left bundle branch block (LBBB) underwent invasive measurements of left ventricular (LV) developed pressure, aortic flow velocity-time-integral (VTI) and myocardial oxygen consumption (MVO2) at 4 pacing states: biventricular pacing (with VV 0 ms) at AVD 40 ms (AV-40), AVD 120 ms (AV-120, a common nominal AV delay), at their pre-identified individualised haemodynamic optimum (AV-Opt); and intrinsic conduction (LBBB). AV-120, relative to LBBB, increased LV developed pressure by a mean of 11(SEM 2)%, p=0.001, and aortic VTI by 11(SEM 3)%, p=0.002, but also increased MVO2 by 11(SEM 5)%, p=0.04. AV-Opt further increased LV developed pressure by a mean of 2(SEM 1)%, p=0.035 and aortic VTI by 4(SEM 1)%, p=0.017. MVO2 trended further up by 7(SEM 5)%, p=0.22. Mechanoenergetics at AV-40 were no different from LBBB. The 4 states lay on a straight line for Δexternal work (ΔLV developed pressure × Δaortic VTI) against ΔMVO2, with slope 1.80, significantly >1 (p=0.02). Biventricular pacing and atrioventricular delay optimization increased external cardiac work done but also myocardial oxygen consumption. Nevertheless, the increase in cardiac work was ~80% greater than the increase in oxygen consumption, signifying an improvement in cardiac mechanoenergetics. Finally, the incremental effect of optimization on external work was approximately one-third beyond that of nominal AV pacing, along the same favourable efficiency trajectory, suggesting that AV delay dominates the biventricular pacing effect - which may therefore not be mainly "resynchronization". © 2013. Published by Elsevier Ireland Ltd. All rights reserved.

  8. Atorvastatin and fenofibrate increase apolipoprotein AV and decrease triglycerides by up-regulating peroxisome proliferator-activated receptor-α

    Science.gov (United States)

    Huang, Xian-sheng; Zhao, Shui-ping; Bai, Lin; Hu, Min; Zhao, Wang; Zhang, Qian

    2009-01-01

    Background and purpose: Combining statin and fibrate in clinical practice provides a greater reduction of triglycerides than either drug given alone, but the mechanism for this effect is poorly understood. Apolipoprotein AV (apoAV) has been implicated in triglyceride metabolism. This study was designed to investigate the effect of the combination of statin and fibrate on apoAV and the underlying mechanism(s). Experimental approach: Hypertriglyceridaemia was induced in rats by giving them 10% fructose in drinking water for 2 weeks. They were then treated with atorvastatin, fenofibrate or the two agents combined for 4 weeks, and plasma triglyceride and apoAV measured. We also tested the effects of these two agents on triglycerides and apoAV in HepG2 cells in culture. Western blot and reverse transcription polymerase chain reaction was used to measure apoAV and peroxisome proliferator-activated receptor-α (PPARα) expression. Key results: The combination of atorvastatin and fenofibrate resulted in a greater decrease in plasma triglycerides and a greater increase in plasma and hepatic apoAV than either agent given alone. Hepatic expression of the PPARα was also more extensively up-regulated in rats treated with the combination. A similar, greater increase in apoAV and a greater decrease in triglycerides were observed following treatment of HepG2 cells pre-exposed to fructose), with the combination. Adding an inhibitor of PPARα (MK886) abolished the effects of atorvastatin on HepG2 cells. Conclusions and implications: A combination of atorvastatin and fenofibrate increased apoAV and decreased triglycerides through up-regulation of PPARα. PMID:19694729

  9. Novel method of predicting the optimal atrioventricular delay in patients with complete AV block, normal left ventricular function and an implanted DDD pacemaker.

    Science.gov (United States)

    Miki, Yuko; Ishikawa, Toshiyuki; Matsushita, Kohei; Yamakawa, Youhei; Matsumoto, Katsumi; Sumita, Shinichi; Uchino, Kazuaki; Kimura, Kazuo; Umemura, Satoshi

    2009-04-01

    The optimal atrioventricular (AV) delay setting is important for achieving optimal AV synchrony in patients with an implanted DDD pacemaker. Using pulsed Doppler echocardiography is the most common method of predicting the optimal AV delay, but it is a complicated and time-consuming method. Therefore, an automatic optimizing function of the AV delay at different atrial rates is desirable for achieving a favorable hemodynamic state. This study aimed to predict the optimal AV delay using phonocardiography. The amplitude of the first heart sound (S1) recorded on the phonocardiogram was measured with different AV delays in 6 patents with complete AV block, normal left ventricular function and an implanted DDD pacemaker. The correlation between the amplitude of S1 and the length of the AV delay was a cubic curve (y=974.15x(3)-23.084x(2)-8.0074x+0.7495, R2=0.9511). The length of the AV delay at the inflection point of the curve showed a significant positive correlation with the optimal AV delay determined by pulsed Doppler echocardiography (R=0.9254, P<0.01). This study demonstrated a novel simple method of predicting the optimal AV delay using phono-cardiography.

  10. E-læring som pedagogisk virkemiddel for innlæring av anatomi, fysiologi og biokjemi i sykepleierutdanningen

    OpenAIRE

    Meyer, Mona Elisabeth

    2014-01-01

    Utgangspunktet for studien er at naturvitenskaplige fag, særlig anatomi, fysiologi og biokjemi (AFB), oppleves som vanskelig for sykepleierstudentene. Hensikten var å undersøke om læringsverktøyet e-læring, i form av nettester, kan være et effektivt virkemiddel til innlæring av og påvirke læringsutbyttet i AFB.Førsteårsstudentene i bachelorutdanningen i sykepleie ved Høgskolen i Akershus fikk et spørreskjema med 23 spørsmål som ble besvart anonymt.Resultatet av studentundersøkelsen viste at n...

  11. Studier av dyrkningsforhold og mekanismer for nervecellekulturers overlevelse og død i medium med og uten serum

    OpenAIRE

    Khuong, Tu Lilly Thien

    2010-01-01

    Kornceller fra kylling som in vitro-modell til studier av apoptose i CNS ble opprinnelig introdusert av forsøksgruppen ved avdeling for farmasøytisk biovitenskap ved Universitetet i Oslo som en alternativ modell til den veletablerte rottekorncellemodellen. Hittil har kornceller fra begge arter vært dyrket i medium med tilstedeværelse av serum. Erfaring viser at serum vanskelig kan standardiseres, og det introduserer variasjoner i ellers like forsøk. Det har i dette masteroppgavearbeidet lykte...

  12. Pastorer i trosbevegelsen : en studie av to norske pastorer sin autoritetsforståelse og rolleforståelse

    OpenAIRE

    Bryne, Jarle

    2007-01-01

    Masteroppgave i kristendomskunnskap - Universitetet i Agder 2007 Jeg har valgt bevisst et omfattende sammendrag. Sammendraget er utformet med tanke på at det skal være mulig for leseren å få et inntrykk av mine resultater i prosjektet uten at leseren trenger å lese hele prosjektet. Jeg har laget et sammendrag fra hvert kapittel. Kapittel 1: Prosjektet mitt handler om undersøkelser av to sentrale ledere i trosbevegelen. Henholdsvis Åge Åleskjær som er leder av Oslo Kristne Senter på Kjel...

  13. Lukka flaumløp med sidekanal: Utforming av innløp til sjakt / skråtunnel

    OpenAIRE

    Hovland, Ole Håkon

    2013-01-01

    Det har tidlegare vore utført modellforsøk som har studert kapasiteten til sidekanalen i eit lukka flaumløp. Denne oppgåva har til hensikt å fortsetje arbeidet, og fokuserer på kapasiteten i overgangen mellom sidekanal og tunnel.For å kunne undersøke kapasiteten så grundig som mogleg vart det utvikla ein modulbasert modell, som tillet systematisk variasjon av horisontalvinklar, vertikal vinklar og utviding av sidekanal. Alle delar kan stillast inn med stor grad av nøyaktigheit. Med denne grad...

  14. Vad var det som hände? Efterbearbetning av en simulering för utvecklande av professionell kunskap hos polisstudenter

    Directory of Open Access Journals (Sweden)

    David Sjöberg

    2014-11-01

    Full Text Available Att öva för att lära sig att hantera polisiära situationer utgör ett viktigt inslag i polisstudenters utbildning. Lärandet sker genom praktiska övningar t.ex. drillövningar och övningar av specifika moment men även via simuleringar där studenter agerar som polis i mera komplexa situationer. Simuleringar är inte unika för polisutbildning utan utgör ett vanligt inslag i professionsutbildning genom sin koppling till "verkliga" situationer (Peters och Vissers, 2004; Lederman, 1984. Under de senaste årtiondena har simuleringar använts för utbildning inom så skilda professionsfält som medicin och hälsovård, flyg och blåljusverksamhet. Simuleringar kan vara av skiftande karaktär t.ex. fysiska i form av rollspel men även datorbaserade. Simuleringar kan syfta till att utveckla en specifik färdighet (se t.ex. Windsor, 2009; Stefanidis, Acker, och Heniford, 2008; Wallin, Meurling, Hedman, Hedengård, och Felländer-Tsai, 2007, som t ex att lära sig hur man avläser röntgenbilder (se t.ex. Söderström, Häll, Nilsson, och Ahlqvist 2012 eller till att lära hur man ska agera i komplexa situationer (Andersson, Carlström, och Berlin, 2013; Bauman, Gohm och Bonner, 2011, t.ex. vid svåra olyckshändelser med många personer inblandade (se t.ex. McConnell och Drennan, 2006. Simuleringar av komplexa situationer med många inblandade brukar benämnas som fullskaliga (se t.ex. Andersson, Carlström, och Berlin, 2013. Simuleringar antas träna och utveckla professionell kunskap genom att förbereda studenter på att hantera komplexa och ibland farliga situationer som de kan komma att ställas inför i en kommande yrkespraktik. Användningen av simuleringar i utbildningar bygger således på ett antagande om överföring av erfarenheter och kunskaper från ett sammanhang till ett annat (se t.ex. Söderström, Åström, Anderson och Bowles, 2014. I den här artikeln utgår vi från simulering som en utbildningsresurs där deltagarna

  15. Enantioselektiv syntese av metyl-5S-hydroksy-6E,8Z,11Z,14Z,17Z-eikosapentaenoat via katalytisk enantioselektiv jodlaktonisering av eikosapentaensyre

    OpenAIRE

    Kristianslund, Renate

    2014-01-01

    Hovedfokuset i denne oppgaven var å utvikle en metode for organokatalytisk enantioselektiv jodlaktonisering av (5Z,8Z,11Z,14Z,17Z)-eikosa-5,8,11,14,17-pentaensyre (EPA, 20) med forskjellige kvadratsyre-katalysatorer; 3-(((1R,2R)-2-(dipentylamino)sykloheksyl)amino)-4-((4-(trifluorometyl)fenyl)amino)syklobut-3-en-1,2-dion (56), 3-((3,5- bis(trifluorometyl)fenyl)amino)-4-(((1R,2R)-2-(dipentylamino)sykloheksyl)amino)syklobut- 3-en-1,2-dion (57), 3-(((1R,2R)-2-(dipentylamino)sykloheksyl)amin...

  16. [Comparison of echocardiographic findings in AVS patients with and without high IgG, IgM, IgA titers against Chlamydia pneumoniae during 12 months' observation of AVS natural course].

    Science.gov (United States)

    Swierszcz, Jolanta; Dubiel, Jacek S; Krzysiek, Józef; Sztefko, Krystyna; Galicka-Latała, Danuta; Roman, Pfitzner; Podolec, Piotr; Wodniecki, Jan

    2011-01-01

    Comparison of echocardiographic findings in AVS patients with and without high IgG, IgM, IgA titers against Chlamydia pneumoniae during 12 months' observation of AVS natural course. 60 AVS patients who did not agree for operational treatment were divided into group A (30 patients with high IgG titer) group B (30 patients with low IgG titer), group C (22 patients with high IgA titer) group D (38 patients with low IgA titer), group E (7 patients with high IgM titer), group F (53 patients with low IgA titer) Antibodies titers and echocardiographic scans were carried out every 12 months. There were more (p right atrium diameter was higher in group E compared to group F. The results may suggest link between Chlamydia pneumoniae and deterioration of AVS.

  17. "Jag har typ en tallinje i huvudet" : Elevers upplevelse av träning med applikationen Vektor

    OpenAIRE

    Åbonde, Lena; Strömbom, Carina

    2017-01-01

    Syftet med denna studie var att undersöka hur elever i behov av särskilt stöd i matematik beskriver sin upplevelse av träning med applikationen Vektor och om de uttrycker någon förändring av sina grundläggande strategier efter träning. Flera forskare är överens om att arbeta med hjälp av digitala verktyg får effekter på elever både när det gäller kunskap och motivation. Vad det är som gör att de blir motiverade och lär sig mer och om effekterna sitter i, finns det delade meningar om. Åtta ele...

  18. En socialpsykologisk analys av samkönat partnervåld ur ett makt- och normativitetsperspektiv

    OpenAIRE

    von Braun, Thérèse

    2009-01-01

    Uppsatsens syfte var att nå en större teoretisk förståelse av samkönat partnervåld, genom att analysera olika forskningsartiklars narrativa konstruktioner av våldet. De två frågeställningarna var: 1. Hur diskuterar forskningslitteraturen samkönat partnervåld med fokus på temana relationsdynamik, karaktär hos parterna, kön, genus och sexualitet samt betydelsen av social kontext? 2. Hur diskuterar forskningslitteraturen det professionella bemötandet av samkönat partnervåld? De 21 valda primärdo...

  19. Undersökning av varumottagning i en byggvaruaffär

    OpenAIRE

    Forsman, Marc

    2016-01-01

    Karis Järn hör till de ledande järnaffärerna inom Raseborgs region, vilket leder till stora produktströmmar till företaget. Detta ställer krav på hur varumottagningen sköts i företaget. Att lagerhållningen är viktig för ett företag framgår i teorin där focusen ligger på lagerhållning samt dess fördelar. Varumottagningen sköts av företagets varumottagare, men förs in i företagets datasystem av både varumottagaren och kontorspersonal. Syftet med detta arbete är att undersöka ifall det finns bri...

  20. Metodrumsundervisning : En kvalitativ studie av simulering inom vård- och omsorgsutbildning

    OpenAIRE

    Leibring, Ingela

    2015-01-01

    Den här avhandlingen handlar om vårdlärares arbete med simulering av arbetsuppgifter i metodrum Ett metodrum kan ses som en hybrid mellan klassrum och sjukhussal. I denna skolmiljö övas arbetsuppgifter som förekommer inom vård och omsorg. Det saknas patienter att öva på och ibland sjukvårdsmaterial, vilket innebär en utmaning för vårdläraren att skapa en autentisk miljö. Syftet med studien är att undersöka hur vårdlärare arbetar med simulering av arbetsuppgifter i metodrumsundervisning för vu...

  1. Standardiserad lösningsprototyp vid implementation av Microsoft Dynamics CRM

    OpenAIRE

    Westman, Mathias; Larsson, Sara

    2015-01-01

    I arbetet att tillfredsställa kunders behov och stärka relationerna mellan köpare och säljare så använder sig företag av affärsfilosofin Customer Relationship Management (CRM). Stora CRM satsningar görs inom företag och flera olika CRM leverantörer ger stöd åt verksamheterna i form av CRM-system. CRM-systemen levererar ofta funktionalitet för kundtjänsthantering, försäljning och marknadsföring men många företag använder endast försäljningsmodulen i CRM-systemet.   Kentor jobbar idag med suppo...

  2. The Last Expedition of the Siberian A.V. Adrianov (Tuva, 1915–1916

    Directory of Open Access Journals (Sweden)

    Olga B. Belikova

    2014-12-01

    Full Text Available The article presents the results of the examination of archaeological activity of Siberian public figure and scientist A.V. Adrianov (1854–1920 in his last expedition. It took place in the upstream basin of the Yenisei River – in Tuva (Uryankhaysky Kray / Tannu Uryankhay in 1915–1916. The archaeologist could not summarize and publish the results of his successful field research – he died in 1920 due to the unjustified sentence of the Bolsheviks. The expedition prehistory, the content of the archaeological excavations and exploration, the history of the materials deposition to the storage, scientist's last years have been restored. The information, concerning 23 ancient Old Turkic manuscripts, examined by A.V. Adrianov has been identified and summarized. The data on new sources have been introduced into scientific use.

  3. Sydafrika : En studie av två sydafrikanska skolors arbete mot rasism

    OpenAIRE

    Süttenbach, Emma

    2008-01-01

    Examensarbete på lärarprogrammet av Emma Süttenbach, höstterminen 2007. Handledare: Susanne Hansson. ”Sydafrika – En studie av två sydafrikanska skolors arbete mot rasism” Uppsatsens syfte är att undersöka om två sydafrikanska skolor arbetar mot rasism. För att svara på syftet har en forskningsfråga skapats: 1.Hur arbetar lärarna i två sydafrikanska skolor mot rasism? För att besvara på min forskningsfråga utförde jag fem kvalitativa intervjuer med öppna frågor till lärare som representerade ...

  4. Äldre personers upplevelser av att leva med cancer : En litteraturstudie

    OpenAIRE

    Ahlgren, Emilie; Bergenmalm, Pamela

    2012-01-01

    Bakgrund: Cancer drabbar alla ålderskategorier men ses ändå som en åldersrelaterad sjukdom då största delen av de diagnostiserade fallen är personer över 65 år. En äldre person som insjuknar och tvingas leva med cancer ter sig inte på samma sätt som hos en ung människa, då de äldre ofta har ett annorlunda synsätt på sjukdomen än vad yngre personer har. Syfte: Syftet med studien var att belysa äldre personers upplevelser av att leva med cancer. Metod: En litteraturstudie med kvalitativa artikl...

  5. Musiken ler, bilden skriker : En analys av ”anempathetic music” i film

    OpenAIRE

    Torstensson, Erik

    2014-01-01

    Denna kandidatuppsats avhandlar tre stycken analyser av tre stycken filmscener från filmerna A Clockwork Orange, Reservoir Dogs och Watchmen, tre stycken exempel på scener där så kallad anempathetic music används. Denna form av musik kan beskrivas som att den distanserar sig från vad som händer i den rörliga bilden genom att förmedla den motsatta känslan, till exempel om musiken är glad och lättsam medan en våldtäkt sker i bild. Denna uppsats analyserar i dessa tre analysexempel vad sådan fil...

  6. Lærerstudenters kommentatorkompetanse om flerkultur og undervisning av flerspråklige elever drøftet i lys av kritisk multikulturalisme

    Directory of Open Access Journals (Sweden)

    Wenche Elisabeth Thomassen

    2016-01-01

    Full Text Available Grunnskolelærerutdanningen har som mål å utdanne studenter med både aktør- og kommentatorkompetanse. Kommentatorkompetanse innebærer evnen til kritisk refleksjon. Planer, forskrifter og retningslinjer for grunnskolelærer-utdanningene fastslår at studentene skal ha kunnskaper om flerkultur og undervisning av minoritetsspråklige elever. Slik kompetanse er fortsatt etterspurt, også blant nyutdannede lærere.I denne undersøkelsen er “kritisk multikulturalisme” brukt som teoretisk tilnærming for å analysere gruppeintervjuer med lærerstudenter. Drøftingen inkluderer også hvordan begreper fra denne teoretiske tilnærmingen fungerer for å forstå lærerstudentenes kommentatorkompetanse. Kritisk multikulturalisme er opptatt av å gi en analyse av undertrykking og institusjonalisering av ulike maktrelasjoner innen utdanning. Begreper som er særlig framtredende, er systemmakt, definisjonsmakt og avmakt. Empirien er en del av et større forskningsprosjekt ved UiS, som studerer praksis i grunnskolelærerutdanningen.Undersøkelsen viser at lærerstudentene viser oppmerksomhet og grad av kritisk kommentatorkompetanse når det gjelder systemnivå og pedagogiske praksiser, men ikke har nødvendigvis tilstrekkelig kunnskap om lover og regler for opplæringen. De savner mer oppmerksomhet på temaet innen lærerutdanningen, særlig konkret didaktikk. Funn i materialet indikerer at det ville være av betydning med en dypere forståelse og mer faglige begreper som grunnlag for refleksjon.Analysebegrepene fra kritisk multikulturalisme kan bidra til å sette studentenes utsagn inn i en større sammenheng og peke på potensielt diskriminerende diskurser, men fanger ikke alt studentene er opptatt av. Dette er et område som det ikke er mye forskning på i Norge, artikkelen er et bidrag til økt kunnskap om flerkultur i grunnskolelærerutdanningene.Nøkkelord: lærerstudenter, flerkultur, flerspråklige elever, kritisk multikulturalisme Abstract

  7. Apolipoprotein AV Accelerates Plasma Hydrolysis OfTriglyceride-Rich Lipoproteins By Interaction With Proteoglycan BoundLipoprotein Lipase

    Energy Technology Data Exchange (ETDEWEB)

    Merkel, Martin; Loeffler, Britta; Kluger, Malte; Fabig, Nathalie; Geppert, Gesa; Pennacchio, Len A.; Laatsch, Alexander; Heeren, Joerg

    2005-02-22

    Apolipoprotein A5 (APOA5) is associated with differences intriglyceride levels and familial combined hyperlipidemia. In genetically engineered mice, apoAV plasma levels are inversely correlated with plasmatriglycerides. To elucidate the mechanism by which apoAV influences plasma triglycerides, metabolic studies and in vitro assays resembling physiological conditions were performed. In hAPOA5 transgenic mice(hAPOA5tr), catabolism of chylomicrons and VLDL was accelerated due to a faster plasma hydrolysis of triglycerides by lipoprotein lipase (LPL).Hepatic VLDL and intestinal chylomicron production were not affected. The functional interplay between apoAV and LPL was further investigated by crossbreeding a human LPL transgene with the apoa5 knockout, and the hAPOA5tr to an LPL deficient background. Increased LPL activity completely normalized hypertriglyceridemia of apoa5 deficient mice,however, over expression of human apoAV modulated triglyceride levels only slightly when LPL was reduced. To reflect the physiological situation in which LPL is bound to cell surface proteoglycans, we examined hydrolysis in the presence or absence of proteoglycans. Without proteoglycans, apoAV derived either from triglyceride-rich lipoproteins, hAPOA5tr HDL, or a recombinant source did not alter the LPL hydrolysis rate. In the presence of proteoglycans, however, apoAV led to a significant and dose-dependent increase in LPL mediated hydrolysis of VLDL triglycerides. These results were confirmed in cell culture using a proteoglycan-deficient cell line.A direct interaction between LPL and apoAV was found by ligand blotting.It is proposed, that apoAV reduces triglyceride levels by guiding VLDL and chylomicrons to proteoglycans bound LPL for lipolysis.

  8. Undersøkelser av fisk og næringsdyr i Mår og Ringedalsvatnet 2011-2013

    OpenAIRE

    Rognerud, Sigurd; Fjeld, Eirik

    2014-01-01

    Dette er sluttrapporten for fiskeundersøkelsene i reguleringsmagasinene Mår og Ringedalsvatnet i 2011- 2013. Vi har undersøkt standard fiskebiologiske forhold som alder, vekst, kondisjon, kjøttfarge og mageinnhold, men har i tillegg kartlagt endringene i basale produksjonsforhold ved hjelp av stabile isotoper. Kraftig nedtapping i forbindelse med anleggsvirksomhet førte til en betydelig tilslamming av vannmassene i Mår, mens i Ringedalsvatnet skyltes nedtappingen stort behov for E...

  9. Eldre i sykehjem. Hvordan utøve sykepleie som ivaretar beboerens opplevelse av personlig integritet i hverdagen?

    OpenAIRE

    Knutsen, Mari; Røsåsen, Line

    2011-01-01

    NORSK: Hovedfokuset i denne studien er ivaretakelsen av personlig integritet hos eldre beboere i sykehjem. Personlig integritet beskrives som anerkjennelse og respekt for den enkelte beboer, dens unike identitet, selvforståelse og selvbestemmelse. Faktorer som kan krenke den personlige integriteten i hverdagen i sykehjem blir også omtalt. Sykepleien beskrives med fokus på betydningen av at beboere i sykehjem opplever at deres personlige integritet blir ivaretatt. Vi støtter oss til Joyce T...

  10. Onlinespel en upplevelse : en kvalitativ undersökning av ungdomars attityder om onlinespel

    OpenAIRE

    Moradi, Armin

    2010-01-01

    AbstractTitle: Onlinegaming – A qualitative study of young people's attitudes about online gaming(Onlinespel – En Kvalitativ undersökning av Ungdomars attityder om onlinespel)Number of pages: 34 (35 including enclosures)Author: Armin MoradiTutor: Else NygrenCourse: Media and Communication Studies CPeriod: Autumn 2009University: Division of Media and Communication, Department of Information Science,Uppsala UniversityPurpose/Aim: The purpose of my thesis is that from a social perspective to exa...

  11. A Lightweight AV System for Providing a Faithful and Spatially Manipulable Visual Hand Representation

    OpenAIRE

    Pusch, Andreas; Martin, Olivier; Coquillart, Sabine

    2011-01-01

    Session: Developing new tools and technologies - Abstracts to be published in a regular issue of the journal Cyberpsychology, Behavior and Social Networking (indexed in MedLine and PsychInfo): http://online.liebertpub.com/loi/CYBER; International audience; This paper introduces the technical foundations of a system designed to embed a lightweight, faithful and spatially manipulable representation of the user's hand into an otherwise virtual world (aka Augmented Virtuality, AV). A highly intui...

  12. Fra kirkegård til museum : en kulturhistorisk analyse av Norsk Folkemuseums gravminneutstilling

    OpenAIRE

    Seim, Runhild

    2002-01-01

    Norsk Folkemuseum har helt fra starten i 1894 hatt en gruppe gravminner i sin samling av etterreformatoriske kirkesaker. Denne oppgaven tar særlig for seg gravminnene, og følger dem gjennom det kontekstskifte det er å forflyttes fra kirkelig til museal grunn. Hans Aall, initiativtaker til Norsk Folkemuseum, og Harry Fett, senere riksantikvar, var begge ildsjeler i museumsinnsamlingen. Begge hadde en forkjærlighet for det vakre, om enn ikke med de samme preferanser som datidens kunstmuseer...

  13. Internkommunikation på IKEA : En funktionsanalys av IKEA Uppsalas interna kommunikation

    OpenAIRE

    Johansson, Fredrik

    2007-01-01

    Abstract Title: Internal communication at IKEA – A functional analysis of IKEA Uppsalas internal communication (Intern kommunikation på IKEA – En funktionsanalys av IKEA Uppsalas interna kommunikation) Author: Fredrik Johansson Aim: The purpose of this study is to analyze the internal communication at IKEA Uppsala. Are the channels of communication working efficiently? How is the information received by the employees? Finally I will make a few suggestions on how the internal communication can...

  14. A.V. Usova's Contribution to the Field of Concept Learning in Physics Classroom

    Science.gov (United States)

    Yavoruk, Oleg

    2015-01-01

    A.V. Usova (1921-2014) has always been one of the leading figures in Russian physics education. Her theory of physics concept formation was formulated during the 1970s and the 1980s and directly influenced the process of physics education in the 20th and the 21st century. Over the years there have been a lot of theories of concept formation. Her…

  15. Fagkunnskap og pedagogisk tilnærming i samspill – En klasseromsstudie av undervisning i faget Religion, livssyn og etikk

    Directory of Open Access Journals (Sweden)

    Dag Husebø

    2012-06-01

    Full Text Available Artikkelen analyserer tros- og livssynsundervisning gjennomført i lærerutdanningens obligatoriske praksisopplæring ved Universitetet i Stavanger (UiS 2008-2009. Undervisningen inngikk i det ordinære valgemnet Religion, livssyn og etikk (RLE, og var samtidig integrert i FoU-prosjektet Religionsundervisning og mangfold (ROM. Målsetningen i ROM var å prøve ut en bestemt religionspedagogikk med tanke på håndtering av religiøst mangfold i skole og lærerutdanning. I lærerutdanningsdelen av prosjektet etablerte fem lærerstudenter, to praksislærere og to faglærere et praksisfellesskap som arbeidet individuelt og kollektivt i lys av aksjonsforskningsprisipper. Hver deltaker utviklet sitt didaktiske utprøvingsprosjekt med forankring i den valgte teorien, støttet av praksisfellesskapet. Praksisfellesskapets samhandling ble bl.a. dokumentert gjennom bruk av audio- og videoopptak. Spørsmålet som stilles er på hvilken måte den pedagogiske teorien som ble prøvd ut avdekket behov for bestemt fagkunnskap i undervisningen, og hvordan elevene responderte på denne RLE-undervisningen. Funn i videomaterialet som indikerer at valg av religionspedagogisk teori påvirket behovet for bestemt fagkunnskap i undervisningen, analyseres nærmere.

  16. Considerations and code for partial volume correcting [18F]-AV-1451 tau PET data.

    Science.gov (United States)

    Baker, Suzanne L; Maass, Anne; Jagust, William J

    2017-12-01

    [18F]-AV-1451 is a leading tracer used with positron emission tomography (PET) to quantify tau pathology. However, [18F]-AV-1451 shows "off target" or non-specific binding, which we define as binding of the tracer in unexpected areas unlikely to harbor aggregated tau based on autopsy literature [1]. Along with caudate, putamen, pallidum and thalamus non-specific binding [2], [3], we have found binding in the superior portion of the cerebellar gray matter, leading us to use inferior cerebellar gray as the reference region. We also addressed binding in the posterior portion of the choroid plexus. PET signal unlikely to be associated with tau also occurs in skull, meninges and soft tissue (see e.g. [4]). We refer to [18F]-AV-1451 binding in the skull and meninges as extra-cortical hotspots (ECH) and find them near lateral and medial orbitofrontal, lateral occipital, inferior and middle temporal, superior and inferior parietal, and inferior cerebellar gray matter. Lastly, the choroid plexus also shows non-specific binding that bleeds into hippocampus. We are providing the code (http://www.runmycode.org/companion/view/2798) used to create different regions of interest (ROIs) that we then used to perform Partial Volume Correction (PVC) using the Rousset geometric transfer matrix method (GTM, [5]). This method was used in the companion article, "Comparison of multiple tau-PET measures as biomarkers in aging and Alzheimer's Disease" ([6], DOI 10.1016/j.neuroimage.2017.05.058).

  17. Optimal pacing for symptomatic AV block: a comparison of VDD and DDD pacing.

    Science.gov (United States)

    Huang, Max; Krahn, Andrew D; Yee, Raymond; Klein, George J; Skanes, Allan C

    2004-01-01

    VDD pacing provides the physiological benefits of atrioventricular synchronous pacing with the convenience of a single lead system, but is hampered by uncertainty regarding long term atrial sensing and potential development of sinus node disease. To examine the long-term reliability and complication rates of VDD pacing, we compared the outcome of 112 consecutive patients (age 70 +/- 13 years, 59% men) with symptomatic AV block who received a single pass bipolar VDD system, to 80 patients (age 63 +/- 16 years, 70% men) who received DDD pacing for the same indication. All patients were judged to have intact sinus node function based on submitted ECGs and monitoring results at the time of implant. Implant time was reduced in VDD patients compared to DDD patients (63 +/- 20 vs 97 +/- 36 minutes, P DDD patients compared to 3 (3%) VDD patients (P = 0.15). The implant P wave was lower with VDD pacing compared to DDD patients (2.91 +/- 1.48 vs 4.0 +/- 1.7 mv, P DDD patients. Physiological atrioventricular activation was maintained in 94%-99% of beats throughout the follow-up period in the VDD group. VDD pacing is an excellent strategy for treatment of patients with symptomatic AV block. The lower cost, high reliability, and abbreviated implantation time suggest that VDD pacing is a viable alternative to DDD pacing in patients with high degree AV block and normal sinus node function.

  18. Influence of commercial (Fluka) naphthenic acids on acid volatile sulfide (AVS) production and divalent metal precipitation.

    Science.gov (United States)

    McQueen, Andrew D; Kinley, Ciera M; Rodgers, John H; Friesen, Vanessa; Bergsveinson, Jordyn; Haakensen, Monique C

    2016-12-01

    Energy-derived waters containing naphthenic acids (NAs) are complex mixtures often comprising a suite of potentially problematic constituents (e.g. organics, metals, and metalloids) that need treatment prior to beneficial use, including release to receiving aquatic systems. It has previously been suggested that NAs can have biostatic or biocidal properties that could inhibit microbially driven processes (e.g. dissimilatory sulfate reduction) used to transfer or transform metals in passive treatment systems (i.e. constructed wetlands). The overall objective of this study was to measure the effects of a commercially available (Fluka) NA on sulfate-reducing bacteria (SRB), production of sulfides (as acid-volatile sulfides [AVS]), and precipitation of divalent metals (i.e. Cu, Ni, Zn). These endpoints were assessed following 21-d aqueous exposures of NAs using bench-scale reactors. After 21-days, AVS molar concentrations were not statistically different (pprecipitation were not vulnerable to NAs, indicating passive treatment systems utilizing sulfide production (AVS) could be used to treat metals occurring in NAs affected waters. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Performance comparison of AV1, HEVC, and JVET video codecs on 360 (spherical) video

    Science.gov (United States)

    Topiwala, Pankaj; Dai, Wei; Krishnan, Madhu; Abbas, Adeel; Doshi, Sandeep; Newman, David

    2017-09-01

    This paper compares the coding efficiency performance on 360 videos, of three software codecs: (a) AV1 video codec from the Alliance for Open Media (AOM); (b) the HEVC Reference Software HM; and (c) the JVET JEM Reference SW. Note that 360 video is especially challenging content, in that one codes full res globally, but typically looks locally (in a viewport), which magnifies errors. These are tested in two different projection formats ERP and RSP, to check consistency. Performance is tabulated for 1-pass encoding on two fronts: (1) objective performance based on end-to-end (E2E) metrics such as SPSNR-NN, and WS-PSNR, currently developed in the JVET committee; and (2) informal subjective assessment of static viewports. Constant quality encoding is performed with all the three codecs for an unbiased comparison of the core coding tools. Our general conclusion is that under constant quality coding, AV1 underperforms HEVC, which underperforms JVET. We also test with rate control, where AV1 currently underperforms the open source X265 HEVC codec. Objective and visual evidence is provided.

  20. SplicerAV: a tool for mining microarray expression data for changes in RNA processing

    Directory of Open Access Journals (Sweden)

    Garcia-Blanco Mariano A

    2010-02-01

    Full Text Available Abstract Background Over the past two decades more than fifty thousand unique clinical and biological samples have been assayed using the Affymetrix HG-U133 and HG-U95 GeneChip microarray platforms. This substantial repository has been used extensively to characterize changes in gene expression between biological samples, but has not been previously mined en masse for changes in mRNA processing. We explored the possibility of using HG-U133 microarray data to identify changes in alternative mRNA processing in several available archival datasets. Results Data from these and other gene expression microarrays can now be mined for changes in transcript isoform abundance using a program described here, SplicerAV. Using in vivo and in vitro breast cancer microarray datasets, SplicerAV was able to perform both gene and isoform specific expression profiling within the same microarray dataset. Our reanalysis of Affymetrix U133 plus 2.0 data generated by in vitro over-expression of HRAS, E2F3, beta-catenin (CTNNB1, SRC, and MYC identified several hundred oncogene-induced mRNA isoform changes, one of which recognized a previously unknown mechanism of EGFR family activation. Using clinical data, SplicerAV predicted 241 isoform changes between low and high grade breast tumors; with changes enriched among genes coding for guanyl-nucleotide exchange factors, metalloprotease inhibitors, and mRNA processing factors. Isoform changes in 15 genes were associated with aggressive cancer across the three breast cancer datasets. Conclusions Using SplicerAV, we identified several hundred previously uncharacterized isoform changes induced by in vitro oncogene over-expression and revealed a previously unknown mechanism of EGFR activation in human mammary epithelial cells. We analyzed Affymetrix GeneChip data from over 400 human breast tumors in three independent studies, making this the largest clinical dataset analyzed for en masse changes in alternative mRNA processing

  1. Søvndeprivasjon forsterker subjektive smerteskåringer, men demper fremkalte kortikale responser hos friske forsøkspersoner

    OpenAIRE

    Hjelle, Ingri Berild

    2013-01-01

    Bakgrunn: Prevalensen av kronisk smerte i Norge er høy, og inkluderer opptil 30 % av befolkningen. Konsekvensene for enkeltindivider kan være svært alvorlige, og forårsake utestengelse fra arbeidsliv, sosiale utfordringer og psykiske problemer. Grunnet sykefravær, sykehusinnleggelser og medisinbruk, gir den høye prevalensen av kronisk smerte også store samfunnsøkonomiske konsekvenser. Mange smertefulle tilstander kan føre til søvnforstyrrelser, og forholdet mellom smerte og søvn har i flere ...

  2. Pittsburgh Compound B and AV-1451 positron emission tomography assessment of molecular pathologies of Alzheimer's disease in progressive supranuclear palsy.

    Science.gov (United States)

    Whitwell, Jennifer L; Ahlskog, J Eric; Tosakulwong, Nirubol; Senjem, Matthew L; Spychalla, Anthony J; Petersen, Ronald C; Jack, Clifford R; Lowe, Val J; Josephs, Keith A

    2017-12-13

    Little is known about Alzheimer's disease molecular proteins, beta-amyloid and paired helical filament (PHF) tau, in progressive supranuclear palsy (PSP). Recent techniques have been developed to allow for investigations of these proteins in PSP. We determined the frequency of beta-amyloid deposition in PSP, and whether beta-amyloid deposition in PSP is associated with PHF-tau deposition pattern, or clinical features. Thirty probable PSP participants underwent MRI, [ 18 F]AV-1451 PET and Pittsburgh compound B (PiB) PET. Apolipoprotein (APOE) genotyping was also performed. A global PiB standard-uptake value ratio (SUVR) was calculated. AV-1451 SUVRs were calculated for a set of Alzheimer's disease (AD)-related regions and a set of PSP-related regions. Voxel-level analyses were conducted to assess for differences in AV-1451 uptake patterns and MRI atrophy between PiB(+) and PiB(-) cases compared to 60 normal PiB(-) controls. Statistical testing for correlations and associations between variables of interest were also performed. Twelve subjects (40%) showed beta-amyloid deposition. Higher PiB SUVR correlated with older age but not with AV-1451 SUVR in the AD- or PSP-related regions. Higher AV-1451 SUVR in AD-related regions was associated with higher AV-1451 SUVR in PSP-related regions. We found little evidence for beta-amyloid related differences in clinical metrics, proportion of APOE e4 carriers, pattern of AV-1451 uptake, or pattern of atrophy. Beta-amyloid deposition occurs in a relatively high proportion of PSP subjects. Unlike in Alzheimer's disease, however, there is little evidence that beta-amyloid, and PHF-tau, play a significant role in neurodegeneration in PSP. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Operasjonell analyse av Nygårdstangen godsterminal : en inngående beskrivelse av terminalens ytelse, med fokus på operasjonelle måltall

    OpenAIRE

    Espedal, Linn Kristin; Hallaråker, Tomas

    2017-01-01

    Formålet med denne utredningen er å gi en god og detaljert innsikt i Nygårdstangen godsterminal, hvor fokuset er på operasjonell ytelse. Motivasjonen har hele tiden vært å kartlegge den reelle makskapasiteten på Nygårdstangen, og undersøke hvorvidt det er mulig å effektivisere systemet uten å investere i økt kapasitet på jernbanesporene. Gjennom RailCombi, som er én av to terminaloperatører på Nygårdstangen, har vi fått mulighet til å innhente primærdata på de operasjonelle akt...

  4. Detektion av “troll” i Twitterflöden med hjälp av klusteralgoritm : Metod för att detektera personer som sprider desinformation

    OpenAIRE

    Yousef, Andy; Lansner, Erik

    2016-01-01

    Sociala medier har alltid varit en plats där personer kan diskutera fritt om sina åsikter och dela nyheter med många. Lätt spridning av nyheter från alla hörn i världen kan komma vara användbart för att ha möjlighet att få opartiska nyheter. Även om det finns klara fördelar med exempelvis Twitter så kan det vara problematiskt med falska och uppgjorda nyheter. Ryktesspridning eller uppgjorda nyheter förekommer i stor utsträckning fortfarande, här testas metod(er) för att upptäcka vilka som kan...

  5. Värde och upplevelse inom ett logistikföretag : Effektivisering av upplevelsen och värdet genom inverkan av innovation

    OpenAIRE

    Giang, Johnny; Westin, Betty

    2016-01-01

    Frågeställning:   Hur kan DHL Freight i Eskilstuna genom inkrementella innovativa lösningar leverera ett högre kundvärde samt bättre kundupplevelse i den del av logistikprocessen som skapar kundvärde för privatpersoner? Syfte: Syftet med denna undersökning är att undersöka och ge förslag på hur DHL Freight i Eskilstuna kan generera kundvärde och kundupplevelse för DHLs privata kunder genom innovationstänk. Metod: En kvalitativ metod har använts genom studien som också är en samproduktion med ...

  6. Marinøkologisk vurdering av utslippsted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg. Fase 2. Modellkjøringer og vurderinger

    OpenAIRE

    Bjerkeng, B.; J. Magnusson

    1999-01-01

    Rapporten beskriver effekten på oksygenforholdene i indre Oslofjord av ulike utslipps - og innlagringsdyp av renset avløpsvann fra Bekkelaget renseanlegg ved hjelp av en fjordmodell. Resultatene viser at gunstige utslippsdyp for fjorden i helhet og Bekkelagsbassenget er 60 meters dyp, dernest utslipp på 50-55 meters dyp, eventuelt hovedutslipp på 50 meters dyp og med 10 % vann ført ned til 60 meters dyp.

  7. Mulighetsstudie for gjenåpning av Kjøsterudbekken på Åssiden i Drammen. - En naturressurs tilknyttet urbane omgivelser.

    OpenAIRE

    Kristensen, Iren

    2010-01-01

    Denne masteroppgaven tar for seg ulike problemstillinger som kan oppstå ved gjenåpning av Kjøsterudbekken på Åssiden i Drammen. Åpning av bekker krever god planlegging, og det er mange faktorer som spiller inn. En bekk oppe i dagen vil ha en positiv forringende effekt på omgivelsene, derfor har jeg laget et mulighetsstudie for hvordan nedre del av Kjøsterudbekken kan bli synlig i landskapet, samtidig som den vil gi bydelen et løft. En del av bekken ligger i...

  8. Os avós na perspectiva de jovens universitários Grandparents: from a college students` perspective

    Directory of Open Access Journals (Sweden)

    Cristina Maria de Souza Brito Dias

    2003-01-01

    Full Text Available Esta pesquisa teve como objetivo verificar a percepção dos jovens adultos acerca dos seus avós. Dela participaram 100 universitários (50 de cada sexo, com média de idade de 21,63 anos, respondendo a um questionário com questões de múltipla escolha. Os principais resultados são: Os significados mais importantes representados pelos avós foram os de "respeito" e "sabedoria e experiência de vida. O(a avô(a preferido pelos netos foi a "avó materna". O motivo da preferência foi a convivência maior. Quanto à contribuição dada pelos avós à família destacaram-se "a educação dada aos pais" e "ajudam na criação dos netos". A diferença entre os pais e os avós, na opinião dos jovens, foi "a diferença de cultura, valores". Em relação às características de um avô(avó ideal, verificou-se que, para os universitários, eles devem ter "amor/carinho" e "abertura/diálogo/comunicação". Conclui-se que os avós se constituem como pessoas importantes na vida dos netos, embora já crescidos.This research aimed to verify the perception young college students have concerning their grandparents. Participated on the survey 100 college students (50 male and 50 female, 21,63 year-old average, answering a questionnaire with of multiple choice questions. The main results are: The most meaningful representation grandparents bring were the ones of "respect" and "wisdom and life experience". The favorite grandparent figure for them was the grandmother from the mother´s side. The reason for the preference was they see each other more often. Regarding the contribution given by the grandparents to the family prevailed "the education given to the parents" and "their help with grandchildren". The difference between the parents and the grandparents, according to the subjects, was a difference of culture and values. For the surveyed college students, the characteristics of an ideal grandparent was, they should have "love and care" and "be open to

  9. Musikkfaget i norsk grunnskole: Læreres kompetanse og valg av undervisningsinnhold i musikk

    Directory of Open Access Journals (Sweden)

    Jon Helge Sætre

    2016-08-01

    Full Text Available Denne artikkelen presenterer resultater fra en spørreundersøkelse om grunnskolelæreres kompetanse i musikk og deres valg av undervisningsinnhold i musikkfaget i grunnskolen. Dermed bidrar undersøkelsen til å beskrive hva lærere i musikk kan og hva de vektlegger i sin undervisning, og slik også sammenhengen mellom kompetanse og valg av undervisningsinnhold. Utvalget er 135 lærere som underviser musikk på tredje, sjette og niende trinn i fem kommuner på Østlandet. Datamaterialet analyseres gjennom deskriptiv statistikk og variansanalyser (ANOVA. Resultatene viser at de fleste lærere i musikk er allmennlærere med lite formell kompetanse i musikk fra høyere utdanning. Lærere på lave trinn har vesentlig mindre formell kompetanse enn lærere på høyere trinn, og de deltar også i mindre grad i uformell musikalsk læring gjennom musikkpraksis utenfor skolen. Det er også forskjeller i valg av undervisningsinnhold, og disse forskjellene kan ikke forklares av læreplanens beskrivelse av de ulike trinnene alene. Det ser ut til å være klare sammenhenger mellom hva lærere kan og hva de velger å vektlegge i sin undervisning. Likevel er studiens kanskje viktigste bidrag at den antyder at forskjeller i læreres musikkundervisningspraksis påvirkes av flere forhold, og kompetanse (formell og uformell, læreplanforståelse, profesjonell identitet og kjønn ser ut til å være sentrale faktorer.  Nøkkelord: musikk, lærere, kompetanse, undervisningsinnhold, kjønnAbstractThis article presents results from a survey investigating the competence of music teachers in Norwegian primary and lower secondary schools, and their choice of educational content in music lessons. Thus, the survey presents a description of what teachers know, and what they emphasize in their music teaching, and the correspondence between these factors. The sample comprises 135 teachers teaching music in grades three, six and nine in five municipalities. Data is analyzed

  10. Var manglende forståelse av tobakksepidemiens dynamikk en årsak til forsinket tobakksprevensjon?

    Directory of Open Access Journals (Sweden)

    Karl Erik Lund

    2009-10-01

    Full Text Available  SAMMENDRAGMens tobakksmotstanden i Norge i første halvdel av det 20. århundre mest var tuftet på moral med utgangspunkti et religiøst paradigme, kom det i løpet av perioden 1955-61 undersøkelser som ga det tobakksforebyggendearbeidet et sekulært vitenskapsbasert fundament. Den medisinske profesjon var imidlertid noe forbeholden til attobakk kunne representere en alvorlig trusel mot folkehelsen. Den avmålte og reserverte holdningen som førstble inntatt av legestanden må bli forstått i lys av manglende kvalitet på de tidligste epidemiologiske undersøkelsene,at legestanden på 1950-tallet selv hadde en meget høy andel røykere, og at mange leger - som høytutdannende og derfor ofte fordomsfrie mennesker - ønsket å distansere seg fra de religiøse avholdsmoralistenesom lenge hadde ledet det tobakksforebyggende arbeidet på et ikke-medisinsk grunnlag. Også fraværet av endypere innsikt i tobakksepidemiens egentlige natur (konfigurasjon kunne være en årsak. Det spesielle tidsforholdetmellom eksposisjon og sykdomsutbrudd i epidemiens dynamikk - ofte kalt "delay-problemet" - var egnettil å forvirre legene og helsemyndighetene. For å forstå årsakene til datidens forvirring vil det bli presentert enfigur som viser ulike tidsvinduer i tobakksepidemiens forløp slik de blir skissert av Verdens helseorganisasjon.Lund KE. Was a lack of understanding of the dynamics of the tobacco epidemic a reason for delayedtobacco prevention? Nor J Epidemiol 1995; 5 (2: 107-113.  ENGLISH SUMMARYIn the first half of the 20th century, the work against tobacco in Norway was based mainly on ethics and areligious paradigm. During the years 1955-61 several major epidemiological studies were publishedwhich provided a secular and scientific basis for tobacco prevention. However, the medical professionseemed to be sceptical about the claims that tobacco represented an important hazard to public health.The formal and reserved attitudes of the doctors

  11. Intervensjonsstudien "Forebyggelse av lårhalsbrudd". Metode og praktisk gjennomføring

    Directory of Open Access Journals (Sweden)

    Elisabeth Kvaavik

    2009-11-01

    Full Text Available  Bakgrunn  3 kan forebygge brudd blant sykehjemsbeboere. Her beskrivesmetoden og den praktiske gjennomføringen av studien.Metode  mg vitamin D daglig som 5 ml tran og kontrollgruppa fikk 5 ml tran der vitamin D var fjernet. Endepunktenevar lårhalsbrudd og alle ikke-vertebrale brudd. Et enkelt studieopplegg ble vektlagt. På bakgrunnav styrkeberegningen var målsetningen å inkludere ca. 2000 deltakere.Resultater  Konklusjon  The intervention study”Prevention of hip fractures”. Nor J Epidemiol 2000; 10 (1: 79-85.  Background  3 can prevent suchfractures. Here we present the method and the implementation of the study.Method  mg vitamin D daily in 5 ml cod liver oil for 2 years and the control group received 5 ml cod liver oilwithout vitamin D. The endpoints were hip fractures and all non-vertebral fractures. It was consideredimportant to use a trial that the nursing homes would find easy to implement. According to power calculationthe aim was to include about 2000 participants.Results  Conclusion  : The participation was lower than expected as recruiting nursing homes and nursing homeresidents posed considerable difficulty. However, the great majority of the ward staff at the participatingwards did not find the intervention demanding. A total of 1144 was included in the study.: A total of 1144 residents from 51 nursing homes (of 106 invited in Oslo, Lier and Bergen participated.The participation rate at the individual nursing home varied from 3 to 57%. The participants were85 years old and 3/4 were women. Mean calcium intake from cheese and milk was 450 mg/day, more than40% used a vitamin D supplement while only 3% used a calcium supplement. 1/3 of the participants completedthe 2 years intervention, about 1/3 finished the intervention before 2 years because of death and 1/3finished before 2 years of other causes. The great majority of the wards did not find the interventiondemanding.: A randomised, double

  12. Considerations and code for partial volume correcting [18F]-AV-1451 tau PET data

    Directory of Open Access Journals (Sweden)

    Suzanne L. Baker

    2017-12-01

    Full Text Available [18F]-AV-1451 is a leading tracer used with positron emission tomography (PET to quantify tau pathology. However, [18F]-AV-1451 shows “off target” or non-specific binding, which we define as binding of the tracer in unexpected areas unlikely to harbor aggregated tau based on autopsy literature [1]. Along with caudate, putamen, pallidum and thalamus non-specific binding [2,3], we have found binding in the superior portion of the cerebellar gray matter, leading us to use inferior cerebellar gray as the reference region. We also addressed binding in the posterior portion of the choroid plexus. PET signal unlikely to be associated with tau also occurs in skull, meninges and soft tissue (see e.g. [4]. We refer to [18F]-AV-1451 binding in the skull and meninges as extra-cortical hotspots (ECH and find them near lateral and medial orbitofrontal, lateral occipital, inferior and middle temporal, superior and inferior parietal, and inferior cerebellar gray matter. Lastly, the choroid plexus also shows non-specific binding that bleeds into hippocampus. We are providing the code (http://www.runmycode.org/companion/view/2798 used to create different regions of interest (ROIs that we then used to perform Partial Volume Correction (PVC using the Rousset geometric transfer matrix method (GTM, [5]. This method was used in the companion article, “Comparison of multiple tau-PET measures as biomarkers in aging and Alzheimer's Disease” ([6], DOI 10.1016/j.neuroimage.2017.05.058.

  13. Jämförelse av Vuokkoset varumärkets image och profil

    OpenAIRE

    Lindblad, Amanda

    2012-01-01

    Syftet med examensarbetet var att jämföra Vuokkoset produkternas profil och image, samt att utreda hur konsumenten upplever förpackningen. Uppdragsgivaren för arbetet var Delipap Oy, vars varumärke Vuokkoset intimhygienprodukterna är. Företaget hade aldrig tidigare undersökt förpackningarnas funktionalitet på konsumenter. Som teori har använts både elekroniska källor och böcker. Examensarbetet utfördes som en kvalitativ undersökning. Undersökningen gjordes med hjälp av individuella intervj...

  14. Fruktbarhet hos simler: effekter av ernæring og vekst

    OpenAIRE

    Tyler, N. J. C.; Forberedt innlegg v/ Terje Skogland

    1988-01-01

    Tyler's article is published in English in Rangifer 7 (2), 1987: Fertility in female reindeer: the effect of nutrition and growth.Sammendrag: Drektighetsprosenten i ungrein varierer sterkt fra individ til individ og fra flokk til flokk. En høy fruktbarhet i reinflokken er selve grunnlaget for en vellykket reindrift. Overraskende er det derfor at man vet lite om hvilke faktorer som bestemmer om rein skal bli drektig eller ikke. I denne artikkelen blir effekten av ernæring p&a...

  15. Framgång eller förfall? : Utvecklingen, riskerna och potentialen av BYOD

    OpenAIRE

    Berglund, Emil; Facklam, Alexander

    2016-01-01

    Uppsatsen undersöker fenomenet Bring Your Own Device (BYOD), dess för- och nackdelar samt hur riskerna BYOD medför kan hanteras. För att uppnå detta har en litteraturstudie genomförts. Denna kompletteras av en enkätstudie på Stockholms Läns Landsting och tre intervjuer på Uppsala Kommun med målet att se hur dessa organisationer hanterar BYOD. Arbetet ger en djup insikt i BYOD olika aspekter och visar även på hur de risker som uppkommer kan hanteras.

  16. "rand on klaasist ..." = "strondin er av glasi ..." : [luuletused] / T̤roddur Poulsen ; tlk. Arvo Alas

    Index Scriptorium Estoniae

    Poulsen, T̤roddur

    2004-01-01

    Sisu: "rand on klaasist ..." = "strondin er av glasi ..."; "vesi kannab endas ka nukrust ..." = "vatiņ ber eisini sorg ..."; "Nägin unes et olid ..." = "Droymdi at t{250} ..."; "Tulevik kuulub lihale ..." = "Visi̤nin er kjaet ..."; "Ma pole kirjutanud ..." = "Eg har ikki skriva̧ ..."; "Fäärid sinus. Fäärid minus. Fäärid sidrunis. Fäärid ..." = "Faeroyar Í t̆r. Faeroyar Í m̆r. Faeroyar Í citr̤nini. Faeroyar ... "; "Ma ei suuda kirjutada ..." = "Eg kan ikki skriva ..."

  17. Bitcoin: En analyse av Bitcoins implikasjoner og hvordan norske skattemyndigheter utfordres

    OpenAIRE

    Standal, Lene; Hageløkken, Julie H.

    2017-01-01

    Bitcoin er en virtuell og desentralisert valuta som for første gang muliggjør betalinger direkte fra person til person, uten at betalingen må verifiseres av noen sentral, finansiell institusjon. Siden Bitcoin ble introdusert i 2008 har valutaen opplevd en betydelig økning i handelsvolum og vekslingskurs. Ingen tradisjonelle valutaer hadde en sterkere prisstigning enn Bitcoin i 2016, og antall kjøpte og solgte Bitcoin økte fra 40 milliarder euro i 2015 til 370 milliarder euro i 2016. I denne u...

  18. Ett omusikaliskt genombrott : Mottagandet av Elvis Presley i svensk press under rockmusikens etableringsfas 1956-58

    OpenAIRE

    Klang, Kent

    2007-01-01

    Abstract Kent Klang: Ett omusikaliskt genombrott: Mottagandet av Elvis Presley i svensk press under rockmusikens etableringsfas 1956-1958. Uppsala Universitet: Institutionen för musikvetenskap, uppsats för 60p. 2007 När Elvis Presley gjorde sitt stora genombrott i USA i mitten på 1950-talet kom han att angripas hårt i bland annat amerikansk press. Upprördheten hade sin grund i Elvis sexuellt utmanande kroppsrörelser och rhythm and blues betonade musik. De här artistiska stildragen avslöjade o...

  19. Analys av mobilspel : Varför fortsätter vi spela?

    OpenAIRE

    Häggman, Daniel

    2016-01-01

    I det här arbetet behandlas mobilspel och mobilspelsmarknaden. Fokuspunkten har huvudsakligen legat på vad som gör mobilspel beroendeframkallande och den stora mobilspelsmarknaden. Syftet är därför att belysa mobilspelsberoende och lyfta fram faktorer som utvecklare använder för att designa ett mobilspel och göra det beroendeframkallande. Arbetet är en litteraturstudie i kombination med egen kvalitativ undersökning av spelen. Jag har spelat de populäraste spelen på marknaden och undersökt gem...

  20. Mekanisk/hydraulisk utvikling og dimensjonering av rørgate

    OpenAIRE

    Romsaas, Fredrik

    2011-01-01

    Denne oppgaven tar for seg hydraulisk og mekanisk utvikling av en rørgate som skal frakte bensin, jet-A1, fyringsolje 6 og bitumen (asfalt) fra kai til tankanlegg. Distansen er gitt til å være 900m og trykktapet skal ikke overskride 2 bar. Fyringsolje 6 og bitumen er medier som krever relativt høy temperatur for å oppnå egnet viskositet for pumping. Rørgater som frakter slike medier må derfor utformes på en slik måte at temperaturen opprettholdes ellers kan det oppstå størkning og innvendig f...

  1. Plosivane i Bjerkreim. Ein synkron studie av preaspirasjon og klanglause lenes

    OpenAIRE

    Tengesdal, Eirik

    2015-01-01

    På verdsbasis er preaspirasjon eit sjeldant språkljodsfenomen. I Europa finn ein det berre i nord, og det er eit arealfenomen. Ein finn det millom anna i islandsk, færøysk, skotsk-gælisk, sume dialektar i Noreg, Sverige og England, og i flestalle samiske språk. Eitt av hovudfyremåli med denne uppgåva er å granska plosivane til tri informantar frå Bjerkreim kommune (i Rogaland) i mange ulike fonologiske kontekstar for å kunna påvisa at preaspirasjonen er systematisk her. Eit anna hovudfyremål ...

  2. Sextortyr eller frigörelse : Konstruktioner av sadomasochism i svenska dagstidningar 2007-2011

    OpenAIRE

    Ovesson, Charlotte

    2011-01-01

    Denna studie kom till efter att RFSU hade börjat arbeta med frågor om sadomasochism, och efter att Socialstyrelsen tog bort sadomasochism ur sin diagnosmanual. Syftet med studien är att ta reda på vilka diskurser som används när media talar om sadomasochism. Queerteori är det teoretiska fundamentet i studien. Jag utgår även från Michel Foucaults teorier. Min metod är foucauldiansk genealogisk diskursanalys. Analysmaterialet består av 33 tryckta artiklar från svenska dags- och kvällstidningar....

  3. Triumph and Tragedy of People’s Commissar A.V. Lunacharsky

    Directory of Open Access Journals (Sweden)

    Tatiana V. Gryaznukhina

    2014-03-01

    Full Text Available This article examines different stages in the life of A.V. Lunacharsky that allow defining his activity as triumphal, and at the same time, tragic. It demonstrates how his personal qualities, high level of education and encyclopedic knowledge become the basis for his successful activity in the field of Soviet culture. The article analyzes Lunacharsky’s relationship with bourgeois intellectuals, and focuses on contradictions in his world outlook. The article provides arguments in support of the opinion of impossibility to combine ideas of humanism that refuse violence in any form, with Bolshevik ideas that attempt to justify violence.

  4. "Snaprevyen" : en studie av NRKs nyhetsformidling på Snapchat under det amerikanske presidentvalget i 2016

    OpenAIRE

    Restad, Julie Stenset

    2017-01-01

    Nyheter er ikke lenger bare forbeholdt massemediene. Norske nyhetsaktører har den siste tiden for alvor begynt å ta i bruk sosiale medier for å formidle nyheter, også Snapchat. I motsetning til tidligere studier som ser på bruksmåter av Snapchat, vil denne studien se på hvilke grep avsender tar i bruk for å formidle nyheter i applikasjonen. Denne masteroppgaven tar for seg hvordan den norske allmennkringkasteren NRK har tatt i bruk den sosiale medie-plattformen Snapchat til å formidle nyheter...

  5. Fases de la cadena de suministro de las empresas avícolas

    OpenAIRE

    Bertila J. Aponte F.; Abraham J. González; Angel D. González P.

    2013-01-01

    En la cadena de suministro de las empresas avícolas se realiza una gran cantidad de procesos que originan una brecha de tiempo y espacio entre el insumo y el producto final, dificultando el adecuado análisis de sus elementos. Por esto, el objetivo del presente artículo es analizar las fases de la misma, específicamente en lo correspondiente a la producción de pollo. La investigación fue de tipo analítica, no experimental; con un diseño transeccional. La muestra estuvo conformada por 4 e...

  6. En enkel overvåkingsundersøkelse av Hillestadvannet i 1992

    OpenAIRE

    Berge, D.

    1993-01-01

    Overvåkingsresultatene fra Hillestadvannet i 1992 viste at innsjøen hadde et sterkt forurenset preg med hensyn til eutrofiering (overgjødsling). Fosforkonsentrasjonen var i middel 76 µgP/l, konsentrasjonen av total nitrogen var 1125 µgN/l, algemengden gitt som klorofyll a var i middel 53 µg/l, algevolum ble registrert helt opp i 15 000 mm³/m³, og andel blågrønnalger var oppe i 70%. Siktedypet var kun 0.6 m i middel. Innsjøen karakteriseres som hypereutrofi. Klassifisert etter SFTs vannkvalite...

  7. En enkel overvåkningsundersøkelse av Hillestadvannet i 1994

    OpenAIRE

    Berge, D.; Fjeld, E.

    1995-01-01

    Overvåkingen i 1994 viser at Hillestadvannet er meget næringsrikt (høyeutrof). Midlere konsentrasjon av totalfosfor var 63 µg P/l, total nitrogen 1423 µg N/l, Klorofyll-a 48 µg/l og siktedypet var 0.6 m. I henhold til vannkvalitetskriteriene til Statens forurensningstilsyn plasseres Hillestadvannet i høyeste forurensningsklasse. Vannkvaliteten klassifiseres som meget dårlig (klasse 5). Forholdene i 1994 var noe dårligere enn i 1993, men bedre enn i 1991 og 1992. Bedringen kan ses i sammenheng...

  8. Intern benchmarking i detaljhandeln : En analys av upplevelser och kritiska framgångsfaktorer

    OpenAIRE

    Petersen, Elina; Wahlström, Mikaela

    2015-01-01

    Bakgrund Benchmarking är ett populärt styrverktyg men studierhar visat att benchmarking inte anses som ett likaeffektivt förbättringsverktyg som andra styrverktyg,vilka kritiska faktorer som ligger bakom enframgånsrik benchmarking bör då undersökas. Efter en genomgång av tidigare studier fann vi dessutom attbrister finns gällande vetskapen hur användandet avintern benchmarking upplevs. Få studier har gjortsinom detaljhandeln där intern benchmarking tycksvara användbart. Syfte Syftet med studi...

  9. Förekomst av karies och parodontit hos personer med Morbus Crohn

    OpenAIRE

    Johansson, Annika; Olsson, Sara

    2012-01-01

    Syftet med litteraturstudien var att undersöka förekomsten av karies och parodontit hos personer med Morbus Crohn. Metoden som användes var en allmän litteraturstudie. Materialet till litteraturstudien samlades in genom sökning i databaserna Cinahl, PubMed och ScienceDirect. De sökord som användes vid litteratursökningen i samtliga databaser var ”caries”, ”Crohn’s disease”, ”periodontal disease” och ”periodontitis”. Vetenskapliga artiklar som fick ingå i litteraturstudien begränsades till ”En...

  10. Kulturell inverkan pa uppfattning av auktoritet : en jamforelse mellan studenter pa Karlstads och Alicantes universitet

    OpenAIRE

    Linderholm, Anna

    2008-01-01

    Denna studie ämnar undersöka vilka egenskaper chefer besitter som bäst kommer motiverar nästa generations anställda att följa chefers order och beslut och hur detta påverkas av kulturella faktorer. För att uppnå detta syfte har en enkätundersökning utförts bland studenter på ett universitet i Sverige och ett i Spanien, mer specifikt Karlstads och Alicantes universitet. Enkätundersökningen visar hur studenter rangordnar fem faktorer som enligt French och Raven (1959) definierar makt. Responden...

  11. Prediktion av översvämningsrisken vid vägar - En undersökning av två översvämningar i Östersunds kommun 2008.

    OpenAIRE

    Davidsson, Emil; Persson, Erik

    2015-01-01

    Pågående klimatförändringar med påföljande ökad nederbörd ger förhöjd risk för översvämningar. Det är därför viktigt att kunna göra förutsägelser för var översvämning riskerar att ske. Förutsättningarna att göra sådana prediktioner med geografiska informationssystem ökar då Sveriges geografi karteras i allt större utsträckning. Syftet med uppsatsen är att utföra och analysera en modell för kartering av översvämningsrisk av väg. Det görs genom GIS-analys av geografiska data, baserade på platss...

  12. Diseño de un modelo administrativo contable para la gestión de la industria avícola, Empresa Granja Avícola Gaby

    OpenAIRE

    Espinoza Rico, Christian Javier

    2006-01-01

    El presente trabajo ha sido desarrollado para proponer un sistema AdministrativoContable ordenado y básico para la gestión eficiente y eficaz de la Industria Avícola, en un caso particular la empresa Granja Avícola Gabi ubicada en el cantón Cevallos, provincia del Tungurahua. Esta investigación es de tipo Bibliográfica y de Campo, porque se remitió a muchos libros y folletos dedicados al tema, además de visitas de campo para conocer los procesos y funcionamiento de la empresa antes menci...

  13. ”Det är bara så män är” : En kritisk diskursanalys av porträtteringen av män i två livsstilsmagasin för kvinnor

    OpenAIRE

    Fjellstedt, Cornelia

    2017-01-01

    Syftet med denna uppsats har varit att undersöka hur porträtteringen av män sett ut i två livsstilsmagasin för kvinnor, VeckoRevyn och M-magasin. För att undersöka detta har en kritisk diskursanalys tillämpats och analysen har tagit hjälp av dess tre analysnivåer. De teorier och tidigare forskning som använts har handlat om medier, makt, diskurser, genus, heterosexualitet, maskulinitet och stereotyper. Utifrån det empiriska materialet, den kritiska diskursanalysen och teorin samt tidigare for...

  14. Att översätta slang : En jämförelse av översättningen av slanguttryck i John Greens Paper Towns till svenska och nederländska.

    OpenAIRE

    Rosenqvist, Anna

    2016-01-01

    Studien undersöker hur de engelska slanguttrycken och talspråksmarkörerna i ungdomsromanen Paper Towns av John Green översatts till nederländska och svenska. En analys av slanguttrycken och talspråksmarkörerna i romanens första kapitel, utifrån Lambert & van Gorps modell (1985), visar vilka översättningsstrategier som översättarna valt och vilka översättningsnormer dessa är ett uttryck för. Resultatet visar att översättningarnas preliminära data pekar mot en adekvansinriktad översättnings...

  15. En ansträngande aktivitet : En studie om individers upplevelser av att nätdejta

    OpenAIRE

    Johansson, Rebecka; Holmer, Lovisa

    2015-01-01

    I alla tider har människor inlett relationer med varandra men sättet att göra det på har kommit att förändras. Idag har nätdejting vuxit fram som ett internetbaserat forum speciellt designat för att man där skall kunna hitta och kontakta partners. Denna studie undersöker användarnas upplevelser av nätdejtingsprocessen. Den syftar till att beskriva och förstå användarnas upplevelser av att interagera med individer via nätbaserade forum i syfte att utveckla någon form av relation. Det metodolog...

  16. Ski Stopper : Produktutvecklingen av en ny ski stopper anpassad för2000-talets avancerade skidåkare

    OpenAIRE

    Orrgard, Anders

    2011-01-01

    Detta kandidatexamensarbete utmynnar i en ny typ av ski stopper som är avsedd för attfungera vid baklängeslandningar på skidor. Motivet till detta är att nuvarande ski stopperfungerar bristfälligt vid denna typ av landningar och kan orsaka brott på bindningen. Bakgrunden till intresset för en ny typ av ski stopper kommer från den nya formen avskidåkning som bland annat innebär att åka skidor i ”hopparker”. Denna åkform harutvecklats från snowboardåkningen och medförde att skidfabrikanterna sn...

  17. Stability and activity of lactate dehydrogenase on biofunctional layers deposited by activated vapor silanization (AVS) and immersion silanization (IS)

    Science.gov (United States)

    Calvo, Jorge Nieto-Márquez; Elices, Manuel; Guinea, Gustavo V.; Pérez-Rigueiro, José; Arroyo-Hernández, María

    2017-09-01

    The interaction between surfaces and biological elements, in particular, proteins is critical for the performance of biomaterials and biosensors. This interaction can be controlled by modifying the surface in a process known as biofunctionalization. In this work, the enzyme lactate dehydrogenase (LDH) is used to study the stability of the interaction between a functional protein and amine-functionalized surfaces. Two different functionalization procedures were compared: Activated Vapor Silanization (AVS) and Immersion Silanization (IS). Adsorption kinetics is shown to follow the Langmuir model for AVS-functionalized samples, while IS-functionalized samples show a certain instability if immersed in an aqueous medium for several hours. In turn, the enzymatic activity of LDH is preserved for longer times by using glutaraldehyde as crosslinker between the AVS biofunctional surface and the enzyme.

  18. Utvärdering av smarta kläder för användning inom arbetslivet

    OpenAIRE

    Borgström, Dennis; Nummisalo, Linda

    2016-01-01

    Syftet med projekt var att bidra till utvecklingen av smarta kläder. Två smarta tröjor jämfördes mot varandra. Den ena tröjan (Hexoskin-tröjan) var utvecklad av företaget Hexoskin och den andra tröjan (X-shirt) genom ett samarbete mellan KTH och Högskolan i Borås. Signalerna från de smarta tröjorna validerades mot etablerade mätmetoder insamlad med EKG och spirometer utvecklade av företaget ADInstruments. Korrelationen visade sig vara god för både X-shirt och Hexoskin-tröjan. En testperson vi...

  19. AV Reviews.

    Science.gov (United States)

    Hays, Rachel, Ed.

    1989-01-01

    Presents teacher comments on audiovisual materials dealing with: biotechnology applications in immunology, agriculture, and cancer research; efforts to halt the eutrophication of Lake Tahoe; and banana slugs. Availability and costs of materials are included. (RT)

  20. Maillard reaction and enzymatic browning affect the allergenicity of Pru av 1, the major allergen from cherry (Prunus avium).

    Science.gov (United States)

    Gruber, Patrick; Vieths, Stefan; Wangorsch, Andrea; Nerkamp, Jörg; Hofmann, Thomas

    2004-06-16

    The influence of thermal processing and nonenymatic as well as polyphenoloxidase-catalyzed browning reaction on the allergenicity of the major cherry allergen Pru av 1 was investigated. After thermal treatment of the recombinant protein rPru av 1 in the absence or presence of carbohydrates, SDS-PAGE, enzyme allergosorbent tests, and inhibition assays revealed that thermal treatment of rPru av 1 alone did not show any influence on the IgE-binding activity of the protein at least for 30 min, thus correlating well with the refolding of the allergen in buffer solution as demonstrated by CD spectroscopic experiments. Incubation of the protein with starch and maltose also showed no effect on IgE-binding activity, whereas reaction with glucose and ribose and, even more pronounced, with the carbohydrate breakdown products glyceraldehyde and glyoxal induced a strong decrease of the IgE-binding capacity of rPru av 1. In the second part of the study, the effect of polyphenoloxidase-catalyzed oxidation of polyphenols on food allergen activity was investigated. Incubation of rPru av 1 with epicatechin in the presence of tyrosinase led to a drastic decrease in IgE-binding activity of the protein. Variations of the phenolic compound revealed caffeic acid and epicatechin as the most active inhibitors of the IgE-binding activity of rPru av 1, followed by catechin and gallic acid, and, finally, by quercetin and rutin, showing significantly lower activity. On the basis of these data, reactive intermediates formed during thermal carbohydrate degradation as well as during enzymatic polyphenol oxidation are suggested as the active chemical species responsible for modifying nucleophilic amino acid side chains of proteins, thus inducing an irreversible change in the tertiary structure of the protein and resulting in a loss of conformational epitopes of the allergen.

  1. Fruktbarhet hos simler: effekter av ernæring og vekst

    Directory of Open Access Journals (Sweden)

    N.J.C. Tyler

    1988-06-01

    Full Text Available Tyler's article is published in English in Rangifer 7 (2, 1987: Fertility in female reindeer: the effect of nutrition and growth.Sammendrag: Drektighetsprosenten i ungrein varierer sterkt fra individ til individ og fra flokk til flokk. En høy fruktbarhet i reinflokken er selve grunnlaget for en vellykket reindrift. Overraskende er det derfor at man vet lite om hvilke faktorer som bestemmer om rein skal bli drektig eller ikke. I denne artikkelen blir effekten av ernæring på reinsimlenes fruktbarhet diskutert. Undersøkelser indikerer at rein er som andre pattedyr, der fruktbarheten er relatert til kroppsvekten. Forholdet mellom reinens kroppsvekt og fruktbarhet varierer likevel sterkt. Mye tyder på at drektighetsprosenten i ungrein er avhengig av reintettheten. Dette indikerer at ernæringen er en viktig faktor når det gjelder fruktbarhet i ungrein. Vektspesifikk fruktbarhet kan derfor være en brukbar indikator for reinflokkens fortilgang. I prinsippet vil slike fruktbarhetsundersøkelser gi et tidlig varsel om reintallet er for høyt i forhold til beitegrunnlaget før en markert nedgang i slaktevekten observeres. Etter foredraget til Nic. Tyler hadde Terje Skogland et forberedt innlegg som er gjengitt på norsk. Deretter fulgte en lengre diskusjon som også er gjengitt.

  2. Early Warning Systems of natural disasters in the frame of EUNADICS-AV

    Science.gov (United States)

    Brenot, Hugues; Theys, Nicolas; Clarisse, Lieven; Kopp, Anna; Graf, Kaspar; Mona, Lucia; Coltelli, Mauro; Peltonen, Tuomas; Hirtl, Marcus; Virtanen, Timo; Nína Petersen, Guðrún

    2017-04-01

    Aviation is one of the most critical infrastructures of the 21st century. In Europe, safe flight operations, air traffic management and air traffic control are shared responsibilities of EUROCONTROL, national authorities, airlines and pilots. All stakeholders have one common goal, namely to warrant and maintain the safety of flight crews and passengers. Currently, however, there is a significant gap in the availability of real-time hazard measurement and monitoring information for airborne hazards. The main objective of the new Horizon 2020 project EUNADICS-AV (European Natural Airborne Disaster Information and Coordination System for Aviation; http://www.eunadics.eu) is to close this gap in data and information availability, enabling all stakeholders in the aviation system to obtain fast, coherent, and consistent information. Here we report on WP5 of EUNADICS-AV, the objective of which is to develop a prototype multi-hazard monitoring and early warning system. This task includes the development of a service for improved near real-time analyses (delay of a few hours maximum) of observations from satellite and ground-based platforms in order to detect ash and SO2 plumes (at the global scale), as well as desert sand dusts, fire plumes, and radioactive plumes.

  3. Sammenligning av to blodprøver fra samme person analysert ved to laboratorier

    Directory of Open Access Journals (Sweden)

    Aage Tverdal

    2009-10-01

    Full Text Available  INNLEDNINGEpidemiologiske undersøkelser av lipidnivået hosbefolkningen er helt avhengig av at analysemetodeneholder stabilt nivå over flere år. Dette er lettest å oppnåhvis man hele tiden benytter ett laboratorium, oghjerte-karundersøkelsene til Statens helseundersøkelserhar konsekvent benyttet Klinisk kjemisk avdeling,Ullevål sykehus. Ulike hensyn kan likevel tilsi at andrelaboratorier benyttes. Undersøkelsene til Universiteteti Tromsø som har har vært gjennomført fire ganger iperioden 1973-1995, har vært utført ved Kliniskkjemisk avdeling, Regionsykehuset i Tromsø. Helseundersøkelseni Nord-Trøndelag 1995-1997 harbenyttet Sentrallaboratoriet, Innherred sykehus. I dettearbeidet viser vi hvor store forskjellene blir hvisfeltlagene sender prøver fra samme person til ulikelaboratorier. Vi har undersøkt forskjellene mellomRegionsykehuset i Tromsø og Ullevål sykehus, ogmellom Innherred sykehus og Ullevål sykehus.

  4. Dual chamber pacing with optimal AV delay in congestive heart failure: a randomized study.

    Science.gov (United States)

    Capucci, A; Romano, S; Puglisi, A; Santini, M; Pagani, M; Cazzin, R; Zanuttini, D; Mangiameli, S; Moracchini, P V; Neri, R; De Ciuceis, P; Circo, A; Cavaglià, S; De Seta, F

    1999-07-01

    A prospective randomized trial was set up to evaluate contractile parameters and quality of life in patients with congestive heart failure. We describe the results from 38 patients in sinus rhythm and with chronic heart failure due to congestive cardiomyopathy, prospectively randomized to optimal medical therapy (Group 1, 19 patients) or optimal medical therapy plus dual chamber pacemaker programmed to optimal AV delay (Group 2, 19 patients). At a 6 month follow-up, 7/19 patients in Group 1 had died compared with 5/19 patients in Group 2. During follow-up, there were few significant changes in evaluated parameters except for mitral regurgitation time, which was prolonged in Group 1 and shortened in Group 2. The systolic left ventricular diameter shortened significantly only in Group 2. An energy and activity questionnaire showed that the effect of DDD pacing in the latter patient population was beneficial. From these results we may conclude that at the 6 month follow-up DDD pacing with echo-optimized AV interval programming can improve quality of life without affecting survival.

  5. Novel inter and intra prediction tools under consideration for the emerging AV1 video codec

    Science.gov (United States)

    Joshi, Urvang; Mukherjee, Debargha; Han, Jingning; Chen, Yue; Parker, Sarah; Su, Hui; Chiang, Angie; Xu, Yaowu; Liu, Zoe; Wang, Yunqing; Bankoski, Jim; Wang, Chen; Keyder, Emil

    2017-09-01

    Google started the WebM Project in 2010 to develop open source, royalty- free video codecs designed specifically for media on the Web. The second generation codec released by the WebM project, VP9, is currently served by YouTube, and enjoys billions of views per day. Realizing the need for even greater compression efficiency to cope with the growing demand for video on the web, the WebM team embarked on an ambitious project to develop a next edition codec AV1, in a consortium of major tech companies called the Alliance for Open Media, that achieves at least a generational improvement in coding efficiency over VP9. In this paper, we focus primarily on new tools in AV1 that improve the prediction of pixel blocks before transforms, quantization and entropy coding are invoked. Specifically, we describe tools and coding modes that improve intra, inter and combined inter-intra prediction. Results are presented on standard test sets.

  6. "Eg vil ha graut og sjokomelk" : foreldre sine erfaringar med opplæring og bruk av PECS heime

    OpenAIRE

    Sande, Anita

    2006-01-01

    SAMANDRAG Menneske som av ulike årsaker ikkje kan formidle seg via talespråk kan ha nytte av alternativ eller supplerande kommunikasjon (ASK). The Picture Exchange Communication System (PECS) er eit kommunikasjonssystem basert på grafiske symbol, som ei aukande gruppe barn og unge utan talespråk tek i bruk. Det spesialpedagogiske hjelpeapparatet i Norge er i stor grad retta inn mot å rettleie det pedagogiske personalet, i barnehage og skule, som arbeider med barn med særskilde vanska...

  7. Relationship of Serum Apolipoprotein A-V Levels, Oxidative Stress and Inflammatory Biomarkers with Hypertriglyceridemia in Type 2 Diabetes Mellitus.

    Science.gov (United States)

    Sharma, Devesh; Garg, Seema; Mehndiratta, Mohit; V Madhu, S; Puri, Dinesh

    2017-04-01

    Serum levels of triglycerides (TGs) are often found to be raised in type 2 diabetes mellitus (T2DM). TG levels ≥ 2.2 mM, systemic inflammation and oxidative stress (OS) are known to increase the risk of incident cardiovascular disease (CVD) substantially. In recent years, apolipoprotein A-V (Apo A-V protein) has attracted considerably as a modulator of circulating TG levels. The study was conducted in order to evaluate the levels of Apo A - V proteins and markers of inflammation and OS in patients of T2DM with and without hypertriglyceridemia (HTG) and also to assess correlation between them. T2DM patients were categorized into two groups of 40 participants, according to criteria for risk of CVD: group 1/ controls (TG ≤ 1.65 mM, n = 40) and group 2/ cases (TG ≥ 2.2 mM, n = 40). Despite the routine investigations, serum levels of Apo A-V, interleukin-6 (IL-6) and Insulin were estimated using ELISA, free fatty acids (FFA) with fluorometric assay and malondialdehyde (MDA) was measured using a spectrophotometer. Comparison of levels and correlation between variables was carried out with appropriate statistical tools. Serum Apo A-V protein levels were found significantly lower (P = 0.04) and MDA was significantly higher (P = 0.049) in cases. MDA correlated with TG levels positively (P = 0.000) and negatively with high density lipoproteins (HDL) (P = 0.000). However Apo A-V protein levels did not correlate with TG levels (P = 0.819, r = -0.027), IL-6 (r = 0.135, P = 0.269), FFA (r = 0.128, P = 0.277) and MDA (r = -0.217, P = 0.073). IL-6 levels significantly and positively correlated with HOMA-IR (r = 0.327, P = 0.004) in the all patients. In patients of T2DM, low levels of Apo A-V are associated with HTG, indicating that Apo A-V is linked with TG metabolism. Burden of oxidative stress is greater in HTG of T2DM as is evident from MDA levels and its correlation with TG levels. Since oxidative stress is an important patho-physiological basis which increases the risk

  8. Miljøvirkninger av effektkjøring: Kunnskapsstatus og råd til forvaltning og industri

    OpenAIRE

    Bakken, Tor Haakon; Forseth, Torbjørn; Harby, Atle; Alfredsen, Knut; Arnekleiv, Jo Vegar; Berg, Ole Kristian; Casas-Mulet, Roser; Charmasson, Julie; Greimel, Franz; Halley, Duncan; Hedger, Richard; Larsen, Bjørn Mejdell; Leo, Florian; Melcher, Andreas; Puffer, Michael

    2016-01-01

    Bakken, T. H., Forseth, T. & Harby, A. (red.). 2016. Miljøvirkninger av effektkjøring: Kunnskapsstatus og råd til forvaltning og industri. - NINA Temahefte 62. 205 s. Effektkjøring som fenomen (Kapittel 1) Denne boka inneholder en kunnskapsoppsummering av miljøvirkningene i elver med raske og hyppige endringer i vannføring og vannstand, omtalt som effektkjøring. Boka anses også relevant for hendelser som utfall og andre typer planlagt eller ikke-planlagt driftsstans me...

  9. Användning av glas i kontorsbyggnader : Fokus på energi- och koldioxidutsläpp

    OpenAIRE

    Moucho, Mohammadkarim; Farhat, Nader

    2017-01-01

    Syfte: Att undersöka effekterna vid ersättning av större delar av fasader ikontorsbyggnader med glas, där fokus ligger på energianvändning samtkoldioxidutsläpp. Metod: Kvalitativa semistrukturerade intervjuer, litteraturstudier och dokumentanalys. Resultat: En kontorsbyggnad studerades med hänsyn till den specifikaenergianvändningen och koldioxidutsläppen. Glasarean och fasadarea beräknades förden befintliga byggnaden. Sedan utökades glasarean i fasaden från 30 % till 50respektive 70 %. Resul...

  10. Regionale forskningsmidler i Helse Sør-Øst RHF: Evaluering av ressursbruk og habilitet i tildelingsprosessen

    OpenAIRE

    Langfeldt, Liv; Moen, Svein Erik

    2013-01-01

    I denne rapporten gjennomgås søknads- og vurderingsprosessen som benyttes ved tildeling av forskningsmidler i Helse Sør-Øst RHF. Evalueringen er utført på oppdrag fra Helse Sør-Øst RHF og har vekt på habilitetshåndtering og ressursbruk i tildeling av forskningsmidler. Hovedkonklusjonen er at Helse Sør-Østs tildelingsprosess fungerer bra og foregår på en forsvarlig og habil måte: Det er gode og klare rutiner for habilitetshåndtering, tildelinger er klart fundert i faglige vurderinger, og det s...

  11. Kommunikasjonskultur i sosiale medier i Japan og Norge. Sammenlikning av smarttelefon-apper mellom LINE og Facebook Messenger

    OpenAIRE

    Abumi, Asaki

    2015-01-01

    Denne oppgaven analyser hvordan norske og japanske brukere kommuniserer på sosiale medier på smarttelefoner. Analysen er basert på en spørreundersøkelse med 20 deltagere fra Japan som bruker appen LINE, og 20 deltagere fra Norge som bruker Facebook Messenger. Informantene består av unge universitetsstudenter fra 18 til 25 år. Resultatene viser blant annet at japanere foretrekker LINE fordi den har et stort utvalg av søte sticker, som gjør kommunikasjon lettere for japanere som bor i et stort ...

  12. Er selvrapportert fysisk aktivitet egnet til å belyse helsevirkninger av lett fysisk aktivitet?

    Directory of Open Access Journals (Sweden)

    Victoria Telle Hjellset

    2011-08-01

    Full Text Available Fysisk aktivitet kan redusere risikoen for flere kroniske sykdommer, og kan vurderes ved bruk av spørreskjema, eller måles objektivt. I en undersøkelse blant innvandrerkvinner fra Pakistan (n=86 har vi sammenlignet selvrapportert (International Physical Activity Questionnaire, IPAQ og objektivt målt fysisk aktivitet (SenseWear Armband. For å sikre at kvinnene forsto hva det ble spurt om ble det benyttet prosjektmedarbeidere fra Pakistan og India som hjalp deltakerne til å svare på spørreskjemaet, som dessuten var oversatt til urdu, punjabi og engelsk. Vi fant ingen signifikant korrelasjon (Spearman mellom de to målemetodene. Selvrapportert fysisk aktivitet var ikke signifikant korrelert med: alder, BMI, livvidde, HbA1c, fastende og ’2-timers glukose’, fastende insulin, C-peptid, sittende systolisk- og diastolisk blodtrykk, totalkolesterol, LDL-kolesterol og triglyserider. På den annen side fant vi en invers relasjon mellom objektivt målt fysisk aktivitet og nevnte variabler. Sammenhengene holdt seg ved aldersjustering (lineær regresjon. Deltakere med selvrapportert god fysisk form hadde lavere BMI, livvidde, serum insulin, triglyserider og diastolisk blodtrykk. Resultatene tyder på at selvrapportering av fysisk aktivitet ikke alltid gir god nok opplysning til å bedømme graden av fysisk aktivitet, slik det ble funnet ved å bruke spørreskjemaet IPAQ på dette utvalget av innvandrerkvinner. Objektiv måling av energiomsetning kan synes nødvendig for å få gode estimater på fysisk aktivitet og dens gunstige helseeffekter. Hjellset VT, Høstmark AT. Is self-reported physical activity suitable for studying health effects of light physical activity?    Nor J Epidemiol 2011; 20 (2: 135-142.ENGLISH SUMMARYPhysical activity can reduce the risk of many chronic diseases, and may be estimated using questionnaires, or measured objectively. In a group of Pakistani immigrant women living in Oslo, Norway, we found no significant

  13. Geologic Mapping of the Av-9 Numisia Quadrangle of Asteroid 4Vesta

    Science.gov (United States)

    Buczkowski, D.; Wyrick, D.; Capaccioni, F.; Scully, J.; Williams, D.; Hiesinger, H.; Garry, W.; Yingst, R.; LeCorre, L.; Nathues, A.; Schenk, P.; Jaumann, R.; Raymond, C.; Pieters, C.; Roatsch, T.; Preusker, F.; Russell, C.

    2012-04-01

    NASA's Dawn spacecraft arrived at the asteroid 4Vesta on July 16, 2011, and is now collecting imaging, spectroscopic, and elemental abundance data during its one-year orbital mission. As part of the geological analysis of the surface, the Dawn Science Team has begun geologic map-ping of Vesta's surface at the global scale and as a series of 15 quadrangle maps that are being produced based on Framing Camera (FC) images, along with Visible & Infrared Spectrometer data (VIR) obtained during the High-Altitude Mapping Orbit (HAMO). We here concentrate on our geologic analysis and mapping of quadrangle Av-9 Numisia, located in the equatorial region of Vesta, extending from 22˚N - 22˚S and from 216° - 288° E. Clear filter (monochrome) FC HAMO images (~70 m/p) were mosaicked to make a base for this quadrangle. Topography of Av-9, is observed in a colorized Digital Terrain Model (DTM) derived from Survey orbit FC data. Variations in surface composition are revealed by VIR hyperspectral images from Survey (700 m/p) and HAMO (200 m/p) orbits and FC color ratio images (250 m/p) from Survey orbit. Av-9 Numisia is dominated by Vestalia Terra, a distinct, albedo-bright, topographically high region of Vesta bound by steep scarps and crossed by a roughly linear unit of dark material from the northwest to the southeast. This "dark ribbon" is primarily evident in FC color ratio data but is also discernable in clear filter data. The dark material appears to fill a locally low region on top of Vestalia Terra. The ribbon-like feature is cut by Numisia crater, which shows both bright and dark layers in its walls; the dark layers may thus be exposures of subsurface "dark ribbon" material. The origin of the "dark ribbon" material has yet to be determined, but possibilities include impact ejecta flow and/or volcanism. FC color ratio images using standard Clementine ratios [Red (750/430 nm); Green (750/920 nm); Blue (430/750 nm)] show that many of the impact craters in Av-9 have

  14. Frequency-dependent electrophysiological remodeling of the AV node by hydroalcohol extract of Crocus sativus L. (saffron) during experimental atrial fibrillation: the role of endogenous nitric oxide.

    Science.gov (United States)

    Khori, Vahid; Alizadeh, Ali Mohammad; Yazdi, Hamidreza; Rakhshan, Elnaz; Mirabbasi, Abbas; Changizi, Shima; Mazandarani, Masumeh; Nayebpour, Mohsen

    2012-06-01

    The study assessed the hydroalcohol extract effects of Crocus sativus L. (saffron) on (i) the basic and rate-dependent electrophysiological properties of the AV node, (ii) remodeling of the AV node during experimental atrial fibrillation (AF) and (iii) the role of nitric oxide (NO) in the effects of saffron on the AV node. Stimulation protocols in isolated AV node were used to quantify AV nodal recovery, facilitation and fatigue in four groups of rabbits (n = 8-16 per group). In addition, the nodal response to AF was evaluated at multiple cycle lengths and during AF. Saffron had a depressant effect on AV nodal rate-dependent properties; further, it increased Wenckebach block cycle length, functional refractory period, facilitation and fatigue (p saffron on the AV node (p Saffron increased the zone of concealment in experimental AF (p saffron. Saffron increased the AV nodal refractoriness and zone of concealment. These depressant effects of saffron were mediated by endogenous NO. Copyright © 2011 John Wiley & Sons, Ltd.

  15. ApoAV reduces plasma triglycerides by inhibiting very low density lipoprotein-triglyceride (VLDL-TG) production and stimulating lipoprotein lipase-mediated VLDL-TG hydrolysis

    NARCIS (Netherlands)

    Schaap, Frank G.; Rensen, Patrick C. N.; Voshol, Peter J.; Vrins, Carlos; van der Vliet, Hendrik N.; Chamuleau, Robert A. F. M.; Havekes, Louis M.; Groen, Albert K.; van Dijk, Ko Willems

    2004-01-01

    ApoAV has been discovered recently as a novel modifier of triglyceride (TG) metabolism, but the pathways involved are currently unknown. To gain insight into the function of apoAV, adenovirus-mediated gene transfer of murine apoa5 to C57Bl/6 mice was employed. The injection of low doses of Ad-apoa5

  16. "Film med undertext" : - "En studie om tillgänglighet av film för döva och personer med hörselnedsättning."

    OpenAIRE

    Tärnskär, Filip; Jonatan, Helgason

    2016-01-01

    Den här uppsatsen utforskar döva och hörselnedsattas upplevelse av film. Syftet är att undersöka möjligheter i hur man kan öka tillgängligheten av film då man inte längre kan förlita sig på ett ljudberättande. Den undersökande delen av uppsatsen består av två delar. Arbetet med kandidaten inleddes med en enkätundersökning där målgruppen, döva och personer med hörselnedsättning, fick beskriva sin upplevelse av film. Den andra delen av undersökningen bestod av att praktiskt testa resultatet av ...

  17. 76 FR 419 - Airworthiness Directives; 328 Support Services GmbH (Type Certificate Previously Held by AvCraft...

    Science.gov (United States)

    2011-01-05

    ... production line for the Model 328- 300 and for 328-100 aeroplanes with a s/n higher than 3098. For the... Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier Luftfahrt GmbH) Model...: Tom Rodriguez, Aerospace Engineer, International Branch, ANM-116, Transport Airplane Directorate, FAA...

  18. Do acid volatile sulfides (AVS) influence the accumulation of sediment-bound metals to benthic invertebrates under natural field conditions?

    Science.gov (United States)

    De Jonge, Maarten; Dreesen, Freja; De Paepe, Josefina; Blust, Ronny; Bervoets, Lieven

    2009-06-15

    The present study evaluates the influence of acid volatile sulfides (AVS) on accumulation of sediment-bound metals in benthic invertebrates under natural field conditions. Natural sediments, pore water, surface water, and two species of widespread benthic invertebrates (Chironomus gr. thummi and Tubifex tubifex) were collected from 17 historical polluted Flemish lowland rivers and measured for metal concentrations. Different sediment characteristics were determined (AVS, organic matter, clay content) and multiple regression was used to study their relationship with accumulated metals in the invertebrates. Physical and chemical analysis of the field samples indicated low metal concentrations in the water and pore water, but very high metal concentrations in the sediment and the invertebrates, especially for Pb (5.99 micromol/ g). In general, metal accumulation in chironomids and tubificid worms was most strongly correlated with total metal concentrations in the sediment and sediment metal concentrations normalized for organic matter and clay content. Following the results of the linear regression model, AVS did not turn out to be a significant variable in describing variation in metal accumulation. Our study clearly demonstrates that, in addition to the results gained from experiments under lab conditions, benthic invertebrates can accumulate metals from unspiked field sediments even when there's an excess of AVS.

  19. HPCMP CREATE (trademark)-AV Quality Assurance: Best Practices for Validating and Supporting Computation-Based Engineering Software

    Science.gov (United States)

    2015-09-30

    executables - which include the GUI, solver, and any accompanying utilities for use on Linux workstations, (2) HPC executables - located in cenn·alized...Orlando, FL, 2015. [22] E. Reed and A. T. Egolf, "Coaxial Rotor Wake and Prop Induction Impact on a Horizontal Tail Using HPCMP CREATE™-AV

  20. Transcriptomic differences of genes in the avian target of rapamycin (avTOR) pathway in a divergent line of meat-type chickens selected for feed efficiency.

    Science.gov (United States)

    Lee, J; Aggrey, S E

    2016-06-30

    Avian target of rapamycin (avTOR) is a highly conserved serine-threonine kinase that serves as an intracellular energy and nutrient sensor and regulates cell division, growth, and apoptosis. The role of avTOR in mediating feed intake and growth in poultry is unknown. We studied avTOR signaling activities in duodenum and liver tissues at days 35 and 42 in chickens divergently selected for low (LRFI) or high (HRFI) residual feed intake. The differential expression of genes involved in the avTOR pathway was assayed using real-time polymerase chain reaction. In the duodenum, avTOR was up-regulated in the LRFI chickens at both time points as compared with the HRFI chickens. Other genes found to be differentially expressed at day 35 included v-akt murine thymoma viral oncogene homolog, eukaryotic translation elongation factor 2, eukaryotic translation initiation factor 4E binding protein 1, 3-phosphoinositide dependent protein kinase-1, ribosomal protein S6 kinase, 70 kDa, polypeptide 1 (RPS6KP1), avTOR associated protein, LST8 homolog, ghrelin, phosphoinositide-3-kinase (PI3K), forkhead box O1, and p53 E3 ubiquitin protein ligase homolog (MDM2). At day 42, there was no change in the expression of the avTOR target RPS6KP1 or MDM2. In the liver, changes in the expression of components of the avTOR pathway primarily occurred at day 42, and differential gene expression suggests that avTOR complex 1 (avTORC1) affects feed efficiency at day 42. avTORC1 may be activated in the duodenum of feed-efficient birds to increase nutrient mobilization to other peripheral tissues. Furthermore, activation of avTOR in relation to feed efficiency may be tissue specific and may depend on the tissue's need for growth and nutrient transport. Genetic markers in key genes involved in the avTOR/PI3K pathway could be developed to improve feed efficiency in meat-type chickens.

  1. E-Læring som pedagogisk virkemiddel for innlæring av anatomi, fysiologi og biokjemi i sykepleierutdanningen

    Directory of Open Access Journals (Sweden)

    Mona Elisabeth Meyer

    2014-02-01

    Full Text Available Utgangspunktet for studien er at naturvitenskaplige fag, særlig anatomi, fysiologi og biokjemi (AFB, oppleves som vanskelig for sykepleierstudentene. Hensikten var å undersøke om læringsverktøyet e-læring, i form av nettester, kan være et effektivt virkemiddel til innlæring av og påvirke læringsutbyttet i AFB.Førsteårsstudentene i bachelorutdanningen i sykepleie ved Høgskolen i Akershus fikk et spørreskjema med 23 spørsmål som ble besvart anonymt.Resultatet av studentundersøkelsen viste at nettoppgavene ble mye brukt, og at studentene mente de ga et godt læringsutbytte. Nettoppgaver med umiddelbar feedback gir stor studentaktivitet og «time-on-task». Testene kan tette hullet mellom det studentene forventes å kunne og det de faktisk kan, og egner seg til faktafag som m å pugges og forstås. E-læring kan gi god hjelp til studenters strukturering av tid, læringsstrategier og selvregulering.Læringsutbyttet av nettester diskuteres i lys av nytten av umiddelbar feedback i et pedagogisk perspektiv.AbstractThe starting point of the study is that the natural sciences, particularly anatomy, physiology and biochemistry (collectively known as APB, are often difficult subjects for nursing students. The aim was to investigate whether e-learning tools, in terms of web services, can be an effective educational tool and affect learning outcomes in APB.First year students in the Bachelor's degree program in nursing at Akershus University College of Applied Sciences received a questionnaire with 23 questions, which were answered anonymously.The results of the student survey showed that online tasks were widely used, and that students felt they resulted in good learning outcomes. Online training with immediate feedback shows great student activity and “time-on-task.” These tests can close the gap between what the students are expected to know and what they actually do, and is suitable for factual subjects requiring both memorization and

  2. Skriveramme som støtte i arbeidet med fagskriving? Studie av 8. klasse elevers tekstskaping i samfunnsfag

    Directory of Open Access Journals (Sweden)

    Anne Kristine Øgreid

    2016-01-01

    Full Text Available Bruk av formmønster blir jevnlig diskutert som støtte i skriveopplæringen. Hensikten med denne studien er å undersøke sammenhengen mellom lærerens undervisning der bruk av skriveramme inngår, og elevtekster i et skriveprosjekt i en 8. klasse i samfunnsfag. Skriveprosessen er studert og beskrevet gjennom observasjonsnotater og video-opptak, og elevenes tekster er samlet inn som sluttprodukt og tolket i lys av prosesssen rundt skriverammen. Med utgangspunkt i måten skriverammen er realisert i elevenes tekster, kan tekstene sorteres i fire kategorier: 1 Rammen er integrert, 2 Rammen er uthevet, 3 Rammen overskrides og 4 Ingen ramme. Gjennom å sammenligne tekster der rammen ikke synes å ha hatt betydning for tekstskapingen, kategori 4, med de andre kategoriene, diskuteres rammens støtte både ut fra skrivepedagogisk og historiefaglig perspektiv. Undersøkelsen av tekstene i de tre første kategoriene tyder på skriverammen har fungert som støtte, ikke bare i forbindelse med tekstoppbygging, men også som en katalysator for innholdsgenerering og faglig forståelse. Bruk av rigide rammer i skriveopplæringen er kritisert for å fremme en instrumentell og sjangerformalistisk skrivepedagogikk kjennetegnet av reproduksjon og imitasjon av tekstmønstre. Dette ser her ut til å motvirkes av lærerens innramming av skriverammen i en skriveprosess som er kjennetegnet av sterk lærerstyring, steg-for-steg-metodikk og gjennomgående dialog mellom lærer og elever.Nøkkelord: fagspesifikk literacy, literacydidaktikk, skriving i samfunnsfag, skriverammeAbstractTeaching form and the use of models are frequently discussed as a means of supporting school writing instruction. This study investigates the relation between teaching which incorporates the use of writing frames and student texts produced in a writing project conducted in a 8th grade Social Studies classes in a Norwegian lower secondary school. The writing process is examined and described

  3. Utveckling av FPGA-baserad lösning för PROFINET

    OpenAIRE

    Eskelinen, Sanna

    2012-01-01

    PROFINET är en öppen standard för industriellt Ethernet, som uppfyller alla behov inom automation. PROFINET gör det möjligt att koppla in det befintliga fältbussystemet, till exempel PROFIBUS utan att det behöver ändras, genom ett så kallat proxy. PROFINET finns i två utförande PROFINET IO och PROFINET CBA, där IO är en decentral lösning och CBA är en komponentbaserad lösning. PROFINET använder sig av tre olika kommunikationskanaler för att skicka och ta emot data. Detta gör att företag succe...

  4. Uma avó e dois netos adolescentes: um "agregado" de problemas

    OpenAIRE

    Carlos Martins

    2000-01-01

    No estudo de uma paciente idosa e do seu agregado familiar encontram-se dificuldades na aplicação de alguns instrumentos de avaliação familiar. À difícil recolha de informação devido à idade avançada da doente, alia-se o facto de não se tratar de um núcleo familiar clássico. O agregado familiar em estudo é constituído por uma avó que vive com dois netos adolescentes. A paciente encontra-se, aos 74 anos, com dificuldades de mobilização, com tendência a agravarem-se e é responsável pela educaçã...

  5. OPERATIV RISK: SKALNING AV EXTERN FÖRLUSTDATA FÖR KAPITALKRAVSBERÄKNING

    OpenAIRE

    Petersson, Jonas; Svensson, Mikael

    2013-01-01

    I februari 2007 beslutade Finansinspektionen att implementera Basel II:s rekommendationer och regleringar som resulterade i införandet av ett kapitalkrav för operativ risk. Internmätningsmetoden är den mest sofistikerade metoden för att beräkna ett kapitalkrav och utgår ifrån faktiska operativa förluster och ämnar att, utifrån dessa, modellera de risker som uppstår i samband med den operativa verksamheten. För att Finansinspektionen ska godkänna en internmätningsmetod kräver de att den inklud...

  6. Optimering av den skandinaviska massbalansmetoden på Storglaciären, Kebnekaisemassivet

    OpenAIRE

    Fahlborg, Hannah; Flodin, Emma

    2017-01-01

    Klimatförändringar har direkt påverkan på glaciärers tillväxt och avsmältning. Genom att studera glaciärers massbalans kan framtida riskbedömningar, för bland annat havsytans stigning, uppskattas. Skillnaden i glaciärens ackumulation och ablation ger den så kallade nettobalansen, som avslöjar om glaciären ökat eller minskat i massa under det gångna året. Storglaciären belägen i Tarfaladalen, öster om Kebnekaise, är en av världens mest välstuderade glaciärer. Här anvä...

  7. Erfarenheter av portfoliometodiken inom nätutbildning – Kritiska reflektioner och ”halleluja moments”

    Directory of Open Access Journals (Sweden)

    Elinor Adenling

    2011-06-01

    Full Text Available Vid Pedagogiska institutionen vid Umeå universitet har nätutbildningen expanderat kraftigt under de senaste två och ett halvt åren, då institutionen började ge fristående helfartskurser i pedagogik via Internet. Vårterminen 2008 läste cirka 60 studenter och inför varje termin har sedan studenttillströmningen ökat, för att under våren 2010 uppgå till 240 studenter. Hösten 2008 infördes, med stöd av interna utvecklingsmedel, examinerande portfoliouppgifter på samtliga nätbaserade kurser med målsättningen att möta de utmaningar som både formen (nätundervisning och den utökade och heterogena studentgruppen innebar. Syftet var att stärka studenternas förmåga att synliggöra sitt eget lärande, samt att minska anonymiteten mellan lärare och student. Uppgifterna var av självreflekterande karaktär där studenterna uppmanades att relatera det egna lärandet till kursinnehållet och att exempelvis identifiera framtida tillämpningsområden inom studier och arbetsliv. Studenterna fick under terminen individuell återkoppling av en och samma lärare. Intentionen med återkopplingen var bland annat att guida och uppmuntra studenterna till att inta ett personligt förhållningssätt till kursinnehållet. I artikeln argumenteras det för att portfoliometodik i flera avseenden kan sägas harmoniera väl med ett rådande synsätt på examination där ett sociokulturellt synsätt på lärande dominerar och livslångt lärande och självständighet framhålls som eftersträvansvärt. Detta medför att, det både utifrån ett student- och ett lärarperspektiv, kan kännas naturlig och relevant att använda portfolio som examinationsform inom nätutbildning. Samtidigt är det viktigt att problematisera och kritiskt reflektera över portfoliometodik som examinationsform och de förhållningssätt och ideal som skapas, vilket görs i artikeln med hjälp av en Foucaultinspirerad tolkningsram. I artikeln presenteras alltså både ett

  8. Biodigestão anaeróbia de efluente de abatedouro avícola

    OpenAIRE

    Arley Borges de Morais Oliveira; Ana Carolina Amorim Orrico; Marco Antonio Previdelli Orrico Júnior; Natalia da Silva Sunada; Stanley Ribeiro Centurion

    2011-01-01

    Objetivou-se, com este trabalho, avaliar o processo de biodigestão anaeróbia no tratamento de efluentes de abatedouro avícola, considerando-se os TRH de 7, 14 e 21 dias, além da adição de enzima lipolítica aos substratos, nas concentrações de 0; 0,5; 1,0 e 1,5 g L-1 de carga adicionada aos biodigestores. A influência dos TRH e da adição de enzima lipolítica aos substratos foi avaliada por meio das produções de biogás e CH4, dos potenciais de produção por DQO, adicionada e removida, bem como p...

  9. Bør man tillate at norske statsborgere benytter seg av surrogati i India?

    Directory of Open Access Journals (Sweden)

    Annelin Haukeland

    2013-11-01

    Full Text Available I Norge er ikke surrogati tillatt, og myndighetene fraråder norske statsborgere å benytte seg av surrogati i utlandet. I denne artikkelen fokuserer vi på kommersiell gestational surrogati og stiller spørsmålet: Bør man tillate at norske statsborgere benytter seg av surrogati i India? De etiske problemstillingene rundt surrogati er mange og sammensatte og blir spesielt utfordrende når tjenesten tilbys i et land med store kulturelle og økonomiske forskjeller både internt og i forhold til Norge. Vi baserer analysen og drøftingen av dette etisk utfordrende spørsmålet på Beauchamps og Childress sin veletablerte metodiske tilnærming innen biomedisinsk etikk. Vi anvender de fire allmennmoralske prinsipper: respekt for autonomi, velgjørenhet, ikke-skade og rettferdighet på sakskomplekset for å synliggjøre spenningene involvert i dette etiske dilemmaet. Med full bevissthet om at det ikke finnes noen lettvinte og omkostningsfrie løsninger på dilemmaer generelt og dette spesielt, konkluderer vi med at interessene til de berørte parter, og spesielt surrogatmødrenes, kan bli bedre ivaretatt om surrogati tillates under omfattende reguleringer. Dersom man velger å gjøre praksisen illegal, vil man også miste mulighetene til å påvirke prosessen og sikre rettighetene til de involverte partene.Nøkkelord: surrogati, Norge–India, utnyttelse, autonomi, regulering av prosessenEnglish summary: Should Norwegian citizens be permitted to use surrogacy in India?Surrogacy is not permitted in Norway, and the government strongly advises against Norwegian citizens travelling abroad to have children through the use of the surrogacy industry. In this article, we focus on commercial gestational surrogacy and debate the question: Should Norwegian citizens be permitted to use surrogacy in India? The ethical concerns regarding surrogacy are complex and are especially challenging when the service is offered in a country with big cultural and economic

  10. Boklördag : Produktion och reproduktion av vithets- och mansnormen i Dagens Nyheters litteraturjournalistik

    OpenAIRE

    Fellman, Emma

    2014-01-01

    Denna framställning utgör en studie av kulturdelens lördagsbilaga i dagstidningen Dagens Nyheter. Uppsatsen har analyserat hur den vita och den manliga normen produceras och reproduceras dels i språkbruket i intervjuer med författare, dels bland representerade författare i Boklistorna. Syftet med uppsatsen är således att ta reda på om och hur de maktförhållanden som råder inom kön och etnicitet i vårt samhälle synliggörs och förstärks i tidningens litteraturbevakning. Detta ...

  11. Analysis of two large functionally uncharacterized regions in the Methanopyrus kandleri AV19 genome

    DEFF Research Database (Denmark)

    Jensen, Lars Juhl; Skovgaard, Marie; Sicheritz-Pontén, Thomas

    2003-01-01

    , analysis of their lengths, codon usage, and Ribosomal Binding Site (RBS) sequences shows that they are most likely true protein coding genes and not random open reading frames.Conclusions: Although these regions can be considered as candidates for massive lateral gene transfer, our bioinformatics analysis......Background: For most sequenced prokaryotic genomes, about a third of the protein coding genes annotated are "orphan proteins", that is, they lack homology to known proteins. These hypothetical genes are typically short and randomly scattered throughout the genome. This trend is seen for most...... of the bacterial and archaeal genomes published to date.Results: In contrast we have found that a large fraction of the genes coding for such orphan proteins in the Methanopyrus kandleri AV19 genome occur within two large regions. These genes have no known homologs except from other M. kandleri genes. However...

  12. Transformering av kunnskap mellom campus og skole i lærerutdanningen

    Directory of Open Access Journals (Sweden)

    Britt Oda Fosse

    2016-04-01

    Full Text Available Til tross for lærerutdanningers mangeårige arbeid med å finne innovative løsninger som skaper gode sammenhenger mellom campuskonteksten og skolekonteksten, etterlyser lærerstudentene fortsatt en bedre sammenheng i studiet. Det som kjennetegner metodene i mange lærerutdanninger er at de bygger på ideen om læring for praksis. Dette innebærer i stor grad forventninger om at studentene transformerer kunnskap fra campus til undervisning og refleksjon i skolen. Mye tyder på at lærerstudentene får lite hjelp i denne prosessen. Studier om koherens – eller sammenheng – i lærerutdanningen knyttes sjelden til at lærerutdanning kan innebære et læringsproblem. Hensikten med denne artikkelen er å undersøke de læringsutfordringer studenter har når kunnskap skal transformeres mellom de to kontekstene. Tanken er at en forståelse for lærerstudenters læring på denne måten kan bidra inn i arbeidet med å videreutvikle metoder i lærerutdanningen som kan lette transformeringsprosessene. Artikkelen er tematisk og drøftes i lys av sosiokulturelle perspektiver på læring og utvikling med vekt på begrepene “overføring” og “transformering”. Videre drøftes problemstillingen i lys av studier av lærerstudenters interaktive læringsprosesser. Nøkkelord: lærerutdanning, lærerstudenters læringsprosesser, transformering av læring.AbstractDespite innovative work on bridging the gap between campus activities and classroom activities, student teachers ask for more coherence in their education. What characterizes the different teacher education innovations is that they are mainly based on the idea that students construct knowledge for practice. In these scenarios, teacher education programmes rely on the students’ ability to transform knowledge from activities at campus into teaching and reflection in their practice schools. The student teachers seem to get little or no help in these transformational processes. When studying

  13. Tillämpning av högpresterande isolering : PIR-isolering - ett effektivt isoleringsmaterial

    OpenAIRE

    Jardemyr, Pernilla; Touma, Sally

    2013-01-01

    Högpresterande isolering är en typ av material som finns tillgängligt men inte används på den svenska marknaden i den utsträckning som de bör göra. I denna rapport kommer det högpresterande isoleringsmaterialet PIR att ligga i fokus och det jämförs främst med det traditionella isoleringsmaterialet cellplast men paralleller dras även till mineralullen. PIR- isoleringen har 40 % bättre värmekonduktivitet än cellplasten och detta innebär att materialet har bättre isoleringsförmåga som bidrar til...

  14. Introduction to COFFE: The Next-Generation HPCMP CREATE-AV CFD Solver

    Science.gov (United States)

    Glasby, Ryan S.; Erwin, J. Taylor; Stefanski, Douglas L.; Allmaras, Steven R.; Galbraith, Marshall C.; Anderson, W. Kyle; Nichols, Robert H.

    2016-01-01

    HPCMP CREATE-AV Conservative Field Finite Element (COFFE) is a modular, extensible, robust numerical solver for the Navier-Stokes equations that invokes modularity and extensibility from its first principles. COFFE implores a flexible, class-based hierarchy that provides a modular approach consisting of discretization, physics, parallelization, and linear algebra components. These components are developed with modern software engineering principles to ensure ease of uptake from a user's or developer's perspective. The Streamwise Upwind/Petrov-Galerkin (SU/PG) method is utilized to discretize the compressible Reynolds-Averaged Navier-Stokes (RANS) equations tightly coupled with a variety of turbulence models. The mathematics and the philosophy of the methodology that makes up COFFE are presented.

  15. Geologic Mapping of the Av-14 Urbinia Quadrangle of Asteroid 4 Vesta

    Science.gov (United States)

    Mest, S. C.; Yingst, R. A.; Williams, D. A.; Garry, W. B.; Pieters, C. M.; Jaumann, R.; Buczkowski, D. L.; Sykes, M. V.; Wyrick, D. Y.; Schenk, P. M.; Russell, C. T.; Raymond, C. A.; Neukum, G.; Schmedemann, N.; Roatsch, T.; Preusker, F.; Ammannito, E.

    2012-04-01

    NASA's Dawn spacecraft is providing unprecedented views of the surface of 4 Vesta since it went into orbit in July 2011. Dawn is actively gathering an abundance of image, spectral and topographic data to characterize the geology, composition, shape and internal structure of the ~560-km-diameter asteroid. Geologic mapping of Vesta's surface is being undertaken at the global and regional scales by subdividing Vesta into 15 quadrangles. Here, we report the mapping results for quadrangle Av-14, the Urbinia quadrangle of Vesta, derived from data acquired during the High Altitude Mapping Orbit (HAMO) and Survey orbit. Base materials for mapping include HAMO-derived monochrome (clear filter) Framing Camera (FC) mosaic (~70 m/pixel and a Digital Terrain Model (DTM) derived from Survey orbit FC data (450 m/pixel). We also use FC color ratio images (~250 m/pixel) from Survey orbit and Visible and InfraRed (VIR) hyperspectral images from Survey (700 m/pixel) and HAMO (200 m/pixel) orbits to provide information on surface composition and refine unit boundaries. The Av-14 Quadrangle covers the region between 21°-66°S latitude and 270°-360°E longitude. The quadrangle is named after crater Urbinia (D=24 km; 30°S, 276°E), which displays an ejecta blanket with moderate albedo and a smooth, lightly cratered surface. The map area is dominated by moderately cratered equatorial terrains and lightly cratered, but highly deformed, southern terrains. The topographic gradient of the map area is declined toward the south from the more elevated equatorial terrain to the relatively lower interior of the Rheasilivia impact basin. Av-14 contains two dominant terrains - (1) intermediately-cratered equatorial terrain bearing flat-floored, E-W-trending troughs, and (2) relatively lightly-cratered south polar terrain, which contains the Rheasilvia impact basin and related terrains. The northern part of the quadrangle is covered by the moderately cratered equatorial ridge-and-trough terrain

  16. The glial cell modulators, ibudilast and its amino analog, AV1013, attenuate methamphetamine locomotor activity and its sensitization in mice

    Science.gov (United States)

    SNIDER, SARAH E.; VUNCK, SARAH A.; VAN DEN OORD, EDWIN J.C.G.; ADKINS, DANIEL E.; MCCLAY, JOSEPH L.; BEARDSLEY, PATRICK M.

    2014-01-01

    Over 800,000 Americans abuse the psychomotor stimulant, methamphetamine, yet its abuse is without an approved medication. Methamphetamine induces hypermotor activity, and sensitization to this effect is suggested to represent aspects of the addiction process. Methamphetamine’s regulation of 3'-5'-cyclic adenosine monophosphate (cAMP) levels may be partially responsible for its behavioral effects, and compounds that inhibit phosphodiesterase (PDE), the enzyme that degrades cAMP, can alter methamphetamine-induced behaviors. Methamphetamine also activates glial cells and causes a subsequent increase in pro-inflammatory cytokine levels. Modulation of glial cell activation is associated with changes in behavioral responses, and substances that oppose inflammatory activity can attenuate drug-induced behaviors. Ibudilast (aka AV411; 3-isobutyryl-2-isopropylpyrazolo-[1,5-a]pyridine), inhibits both PDE and glial pro-inflammatory activity. Ibudilast’s amino analogue, AV1013, modulates similar glial targets but negligibly inhibits PDE. The present study determined whether ibudilast and AV1013 would attenuate methamphetamine-induced locomotor activity and its sensitization in C57BL/6J mice. Mice were treated b.i.d. with ibudilast (1.8-13 mg/kg), AV1013 (10-56mg/kg) or their vehicles intraperitoneally for 7 days, beginning 48 h before 5 days of daily 1-h locomotor activity tests. Each test was initiated by either a methamphetamine (3 mg/kg) or a saline injection. Ibudilast significantly (Pmethamphetamine's locomotor activity without significantly affecting activity by itself. AV1013 had similar anti-methamphetamine effects, suggesting that glial cell activity, by itself, can modulate methamphetamine's effects and perhaps serve as a medication target for its abuse. PMID:22306241

  17. Fra fagarbeider til yrkesfaglærer: Førsteårsstudenters opplevelser av undervisning og veiledning i akademiske skriveferdigheter

    Directory of Open Access Journals (Sweden)

    Marit Lindset

    2017-04-01

    Full Text Available Introduksjon: Yrkesfaglærerstudentene begynner på en utdanning der gode skriveferdigheter er en forutsetning for å klare seg gjennom utdanningen. Som lærerutdannere opplever vi at mange studenter strever med å beherske de kravene som stilles til akademisk skriving i høyere utdanning. Dette var bakgrunnen for at to lærere ved 3-årig yrkesfaglærerutdanningen i Trondheim startet en studie hvor formålet var å utforske hvordan førsteårstudentene opplevde et innføringskurs i skriving av akademiske oppgaver og ulike former for tilbakemelding på oppgaver i studiet (skriftlige, muntlige og digitale.Teori: Studien støtter seg i hovedsak til Illeris sine perspektiver på læring.Metode: Dataene utgjør 24 refleksjonslogger av 12 førsteårsstudenter i perioden 2014 – 2015. Analysene baserer seg på Lindseth og Norbergs fenomenologiske- hermeneutiske fremgangsmåte.Resultat: Studien viser at studentene ser et innføringskurs i akademisk skriving som helt nødvendig og av stor betydning for utvikling av deres skriveferdigheter og for videreutvikling av oppgaver. Konkrete, skriftlige tilbakemeldinger direkte i teksten sammen med en oppsummerende tekst til slutt er en form for tilbakemelding studentene opplever som viktig og nyttig. Muntlige tilbakemeldinger virker oppklarende og motiverende. Sammen med muntlige tilbakemeldinger fremheves digitale tilbakemeldinger som svært viktig for å skape trygghet og motivasjon for å jobbe videre.Konklusjon: Førsteårsstudenter forteller om stor usikkerhet og sårbarhet i skrivearbeidet. De opplever et skrivekurs som vesentlig for å mestre kravene som stilles til akademisk skriving i høyere utdanning og ser kvaliteter ved både skriftlige, muntlige og digitale tilbakemeldinger i arbeidet med å ferdigstille oppgaver i studiet. Skriftlige tilbakemeldinger oppleves som helt nødvendige.

  18. En teoretisk utdyping av rom og materialitet som pedagogisk ressurs i barnehagen

    Directory of Open Access Journals (Sweden)

    Solveig Nordtømme

    2015-07-01

    Full Text Available Abstract: This article is a theoretical exploration with the aim of discussing an ontological basis for space and materiality as educational resources in kindergarten. Attention is directed on children’s play experiences interacting with space and materiality, and how children use and create space. The metaphors front stage, space in between, and backstage (inspired from Erving Goffman, 1969, which form the study's main findings, are used as the backdrop for the issue and analyzes. The empirical material used in this exploration has been collected with an ethnographic methodological approach in two kindergartens. Maurice Merleau-Ponty’s (1962 focus on bodily experience and presence in space, along with concepts from Latour’s (2005 actor-network theory, is used to explore the data. The article contributes with theoretical tools for professionals in kindergarten teaching, to shed light on the importance of space, materiality and play in children's everyday life in kindergarten.Sammendrag: Denne artikkelen diskuterer et ontologisk grunnlag og er en teoretisk utforskning av rom og materialitet som en pedagogisk ressurs i barnehagen. Oppmerksomheten er rettet mot barns lekeerfaringer i samspill med rom og materialitet, og hvordan barn bruker og skaper rom. Metaforene hovedrom, mellomrom, og bakrom (inspirert fra Erving Goffman, 1969, som danner studiens hovedfunn, blir brukt som et bakteppe for problemstilling og analyser av det empiriske materialet fra to barnehager. Maurice Merleau-Ponty publikasjoner The Phenomenology of Perception (Merleau-Ponty, 1962 med sitt fokus på kroppslig erfaring i levd rom, blir brukt sammen med begreper fra Latours aktør-nettverksteori (Latour 2005 til å utforske hvordan rom og materialitet kan være pedagogiske ressurser. Artikkelens kunnskapsbidrag er å presentere et teoretisk verktøy for barnehageprofesjonen og kunnskaper om lekens betydning i barns hverdag i barnehagen.

  19. The Pattern of Brain Amyloid Load in Posterior Cortical Atrophy Using 18F-AV45: Is Amyloid the Principal Actor in the Disease

    Directory of Open Access Journals (Sweden)

    Emilie Beaufils

    2014-11-01

    Full Text Available Background: Posterior cortical atrophy (PCA is characterized by progressive higher-order visuoperceptual dysfunction and praxis declines. This syndrome is related to a number of underlying diseases, including, in most cases, Alzheimer's disease (AD. The aim of this study was to compare the amyloid load with 18F-AV45 positron emission tomography (PET between PCA and AD subjects. Methods: We performed 18F-AV45 PET, cerebrospinal fluid (CSF biomarker analysis and a neuropsychological assessment in 11 PCA patients and 12 AD patients. Results: The global and regional 18F-AV45 uptake was similar in the PCA and AD groups. No significant correlation was observed between global 18F-AV45 uptake and CSF biomarkers or between regional 18F-AV45 uptake and cognitive and affective symptoms. Conclusion: This 18F-AV45 PET amyloid imaging study showed no specific regional pattern of cortical 18F-AV45 binding in PCA patients. These results confirm that a distinct clinical phenotype in amnestic AD and PCA is not related to amyloid distribution.

  20. Evaluating the Effects of Metals on Microorganisms in Flooded Paddy Soils Using the SEM/AVS-Based Approach and Measurements of Exchangeable Metal Concentrations.

    Science.gov (United States)

    Kunito, Takashi; Toya, Hitomi; Sumi, Hirotaka; Ishikawa, Yuichi; Toda, Hideshige; Nagaoka, Kazunari; Saeki, Kazutoshi; Aikawa, Yoshio; Matsumoto, Satoshi

    2017-04-01

    We examined possible adverse effects of heavy metals on microbial activity, biomass, and community composition using the simultaneously extracted metals (SEM)/acid-volatile sulfide (AVS)-based approach and measurements of exchangeable metal concentrations in three paddy soils (wastewater-contaminated soil, mine-contaminated soil, and noncontaminated soil) incubated for 60 days under flooded conditions. Incubation under flooding increased pH and decreased Eh in all samples. AVS increased when Eh decreased to approximately -200 mV for the mine-contaminated and noncontaminated soils, while the wastewater-contaminated soil originally had a high concentration of AVS despite its air-dried condition. Addition of rice straw or alkaline material containing calcium carbonate and gypsum increased AVS levels under flooded conditions. We observed no apparent relationship between soil enzyme activity (β-D-glucosidase and acid phosphatase) and concentrations of SEM, [∑SEM - AVS], and exchangeable metals. Bacterial and fungal community composition, assessed using polymerase chain reaction-denaturing gradient gel electrophoresis (DGGE) analysis targeting rRNA genes, was largely influenced by site of collection and incubation time, but metal contamination did not influence community composition. We observed significant negative correlations between biomass C and [∑SEM - AVS] and between biomass C and ∑SEM, suggesting that [∑SEM - AVS] and ∑SEM might reflect the bioavailability of organic matter to microorganisms in these soils.

  1. ARTISTS - huvudgator för alla : Vägledning för planerare och beslutsfattare vid utformning och ombyggnad av huvudgator

    OpenAIRE

    Svensson, Åse; Marshall, Stephen; Jones, Peter; Hydén, Christer; Draskoczy, Magda; Papaioannou, Panos; Thomsen, Hytte; Boujenko, Natalya

    2004-01-01

    Konventionella guider för utformning och förvaltning av trafikleder och stadsgator har vanligtvis inriktats antingen mot huvudtrafikleder eller mot lokala stadsgator. Det är för närvarande brist på ett tydligt och konsekvent angreppssätt för arbetet med utformning av huvudgator där signifikant genomfartstrafik och lokala funktioner kombineras. Målet är att denna rapport ska avhjälpa den bristen genom att presentera riktlinjer för utformning och förvaltning av huvudgator – med människan i foku...

  2. Formann i motstandsbevegelsen og fremst i hylekoret - eller toppledelsens forlengede arm? : en komparativ studie av mellomlederens betydning for endring i offentlige organisasjoner

    OpenAIRE

    Eriksen, Erik; Worum, Jørgen

    2015-01-01

    Denne avhandlingen er basert på en undersøkelse av offentlige organisasjoner som drives døgnet rundt. Det som er undersøkt er hvilken betydning det har for endring i en organisasjon at det er en leder med personalansvar på jobb samtidig med de ansatte. Undersøkelsen er gjennomført som en komparativ analyse av to caser der det er brukt kvalitativ metode ved intervju av 11 ansatte i Levanger kommune og Oslo politidistrikt. Vi har undersøkt forskjellen mellom en organisasjon der l...

  3. Balansert målstyring i Helse Vest RHF : korleis kan balansert målstyring bidra til betre styring av Helse Vest RHF

    OpenAIRE

    Myklebust, Knut Øyvind

    2008-01-01

    Det har dei siste åra vore mykje debatt omkring økonomisk styring av sjukehussektoren. Denne utgreiinga tek føre seg bruk av balansert målstyring i Helse Vest RHF, og om dette rammeverket kan gi betre styring for organisasjonen. Eg presenterer først teori knytt til balansert målstyring, og gir eit samandrag av dei viktigaste styringsdokumenta for Helse Vest RHF. Vidare koplar eg saman teori og empiri for å sjå om balansert målstyring er mogleg å bruke i denne organisasjonen, og om det vil gi ...

  4. Mentoring og nettverksbygging for høyt utdannede kvinner med flerkulturell bakgrunn - En casestudie av Seema sitt sosialentreprenøriske bidrag

    OpenAIRE

    Bergwitz, Anbjørg Myhra; Røsaasen, Carita Storm

    2016-01-01

    Master i økonomi og administrasjon Mentoring og nettverksbygging er i litteraturen ansett som nyttig. Hvordan disse tiltakene kan være med på å påvirke høyt utdannede kvinner med flerkulturell bakgrunn sitt møte med arbeidslivet vet man derimot mindre om. Tidligere forskning har fokusert på barrierer knyttet til kjønn og etnisitet, men i mindre grad kombinasjonen av disse opp mot betydningen av tiltak som mentoring og nettverk. Gjennom en casestudie av sosialentreprenøren Se...

  5. Marinøkologisk vurdering av utslippsted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg. Fase 2. Modellkjøringer og vurderinger

    OpenAIRE

    Bjerkeng, B.; J. Magnusson

    1999-01-01

    Årsliste 1999 Rapporten beskriver effekten på oksygenforholdene i indre Oslofjord av ulike utslipps - og innlagringsdyp av renset avløpsvann fra Bekkelaget renseanlegg ved hjelp av en fjordmodell. Resultatene viser at gunstige utslippsdyp for fjorden i helhet og Bekkelagsbassenget er 60 meters dyp, dernest utslipp på 50-55 meters dyp, eventuelt hovedutslipp på 50 meters dyp og med 10 % vann ført ned til 60 meters dyp. Oslo vann og avløpsverk (OVA)

  6. Framgångsfaktorer och barriärer vid integrering av klimatanpassning i  kommunal RSA : En undersökning av Värmlands småkommuner

    OpenAIRE

    Davidsson, Åsa

    2016-01-01

    Att klimatet förändras är konstaterat, skulle utsläppen av växthusgaser kraftigt minskas kan de påbörjade klimatförändringarna ändå inte helt förhindras. Förändringarna innebär att extremväder kommer inträffa oftare men med geografiska skillnader. Till seklets slut väntas i Värmland exempelvis nuvarande tioårsregn istället inträffa var femte år. Vänern kommer i och med detta utgöra en av de största översvämningsriskerna. Hur dessa förändringar påverkar samhället varierar beroende på samhället...

  7. [Minna Ahokas. Valistus suomalaisessa kirjakulttuurissa 1700-luvulla. Bidrag till kännedom av Finlands natur och folk 188] / Tuija Laine

    Index Scriptorium Estoniae

    Laine, Tuija, 1964-

    2012-01-01

    Arvustus: Minna Ahokas. Valistus suomalaisessa kirjakulttuurissa 1700-luvulla. Bidrag till kännedom av Finlands natur och folk 188. Diss. Sasatamala : Finska Vetenskaps-societeten. (Suomen Tiedeseura, 2011)

  8. Strategi for opptrapping av kraftfôr etter kjeing for å sikre god produksjon og helse hos norske mjølkegeiter

    OpenAIRE

    Asheim, Karianne Garthus

    2016-01-01

    I Norge har mjølkeavdråtten hos geit økt mye i seinere tid. Etter kjeing er geiter ofte i negativ energibalanse (NEB), og fôring av kraftfôr må balanseres mellom tilførsel av nok energi, og samtidig unngå for mye mobilisering av kroppsreserver og sikre godt vommiljø og grovfôropptak videre i laktasjonen. Formålet med denne oppgaven var å undersøke effekten av forskjellige opptrappingshastigheter for kraftfôr etter kjeing. Et feltforsøk ble utført i 8 besetninger med geitemjølksproduksjon ...

  9. Observation infrastructure for airborne hazards in the framework of the EUNADICS-AV project

    Science.gov (United States)

    Mona, Lucia; Pappalardo, Gelsomina; Stammes, Piet; Lihavainen, Heikki; Paatero, Jussi; Hirtl, Marcus; Schlager, Hans; Graf, Kaspar; Hedelt, Pascal; Theys, Nicolas; Coltelli, Mauro; Vargas, Arturo; Clarisse, Lieven; Nína Petersen, Guðrún; de Leeuw, Gerrit; Papagiannopoulos, Nikolaos; Apituley, Arnoud; Haefele, Alexander; Delcloo, Andy; Wotawa, Gerhard

    2017-04-01

    During the 2010 and 2011 Icelandic volcanic eruptions, the availability of integrated, validated data sets was identified as a major challenge in the effort to gain a rapid situation assessment. These environmental crisis situations may happen again, also from other types ofairborne hazards, like big fires. Currently, the issue is not so much that data and observations do not exist, it is rather the rapid accessibility, the cross-calibration of different sensors, the integration of new platforms and the harmonization of standards and protocols that needs further work and attention. A specific activity is planned within the H-2020 project EUNADICS -AV ("European Natural Disaster Coordination and Information System for Aviation") for addressing this critical issue. In order to achieve the rapid data accessibility, work will be carried out with full consideration of the main European Research Infrastructures, projects and national/international monitoring networks that are able to provide crucial information related to the dispersion of airborne hazards. The integrated data sets are based on satellite and ground-based remote sensing as well as in situ ground-based and aircraft observations. Networks of ground based remote sensing of atmospheric profiles are particularly important, since these will provide the needed height information that cannot be obtained unambiguously from the vast majority of space borne sensors. A new aspect not treated in any project and initiative so far is the integration of special crisis measurements, for example by aircraft or UAV systems. Particularly suited for the purposes of the project are satellite data from operational sensors aboard EUMETSAT and ESA satellites. Improved retrievals are investigated, and the new generation of Sentinel satellites currently being launched under the Copernicus umbrella and their added value are considered. Especially when the ground based and space borne observations are combined, the much needed

  10. Independent effects of apolipoprotein AV and apolipoprotein CIII on plasma triglyceride concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Baroukh, Nadine N.; Bauge, Eric; Akiyama, Jennifer; Chang, Jessie; Fruchart, Jean-Charles; Rubin, Edward M.; Fruchart, Jamila; Pennacchio, Len A.

    2003-08-15

    Both the apolipoprotein A5 and C3 genes have repeatedly been shown to play an important role in determining plasma triglyceride concentrations in humans and mice. In mice, transgenic and knockout experiments indicate that plasma triglyceride levels are negatively and positively correlated with APOA5 and APOC3 expression, respectively. In humans, common polymorphisms in both genes have also been associated with plasma triglyceride concentrations. The evolutionary relationship among these two apolipoprotein genes and their close proximity on human chromosome 11q23 have largely precluded the determination of their relative contribution to altered Both the apolipoprotein A5 and C3 genes have repeatedly been shown to play an important role in determining plasma triglyceride concentrations in humans and mice. In mice, transgenic and knockout experiments indicate that plasma triglyceride levels are negatively and positively correlated with APOA5 and APOC3 expression, respectively. In humans, common polymorphisms in both genes have also been associated with plasma triglyceride concentrations. The evolutionary relationship among these two apolipoprotein genes and their close proximity on human chromosome 11q23 have largely precluded the determination of their relative contribution to altered triglycerides. To overcome these confounding factors and address their relationship, we generated independent lines of mice that either over-expressed (''double transgenic'') or completely lacked (''double knockout'') both apolipoprotein genes. We report that both ''double transgenic'' and ''double knockout'' mice display intermedia tetriglyceride concentrations compared to over-expression or deletion of either gene alone. Furthermore, we find that human ApoAV plasma protein levels in the ''double transgenic'' mice are approximately 500-fold lower than human ApoCIII levels, supporting ApoAV

  11. Videos for Science Communication and Nature Interpretation: The TIB|AV-Portal as Resource.

    Science.gov (United States)

    Marín Arraiza, Paloma; Plank, Margret; Löwe, Peter

    2016-04-01

    Scientific audiovisual media such as videos of research, interactive displays or computer animations has become an important part of scientific communication and education. Dynamic phenomena can be described better by audiovisual media than by words and pictures. For this reason, scientific videos help us to understand and discuss environmental phenomena more efficiently. Moreover, the creation of scientific videos is easier than ever, thanks to mobile devices and open source editing software. Video-clips, webinars or even the interactive part of a PICO are formats of scientific audiovisual media used in the Geosciences. This type of media translates the location-referenced Science Communication such as environmental interpretation into computed-based Science Communication. A new way of Science Communication is video abstracting. A video abstract is a three- to five-minute video statement that provides background information about a research paper. It also gives authors the opportunity to present their research activities to a wider audience. Since this kind of media have become an important part of scientific communication there is a need for reliable infrastructures which are capable of managing the digital assets researchers generate. Using the reference of the usecase of video abstracts this paper gives an overview over the activities by the German National Library of Science and Technology (TIB) regarding publishing and linking audiovisual media in a scientifically sound way. The German National Library of Science and Technology (TIB) in cooperation with the Hasso Plattner Institute (HPI) developed a web-based portal (av.tib.eu) that optimises access to scientific videos in the fields of science and technology. Videos from the realms of science and technology can easily be uploaded onto the TIB|AV Portal. Within a short period of time the videos are assigned a digital object identifier (DOI). This enables them to be referenced, cited, and linked (e.g. to the

  12. Turbulent Fluxes of Sensible Heat Measured by Research UAV 'M2AV Carolo'

    Science.gov (United States)

    Martin, S.; Bange, J.

    2009-09-01

    Research aircraft equipped for turbulence measurements in the atmospheric boundary layer (ABL) are suitable platforms to measure area-representative mean values and statistical moments of second order - like variance, spectral distribution and turbulent fluxes - in situ i.e. without the use of any theoretical assumptions. Since manned research aircraft are expensive the use of small unmanned aerial vehicle (UAV) or mini aerial vehicles (MAV) is attractive. Such research UAV are able to measure vertical profiles of the lower troposphere, for instance. The next, more challenging league is the measurement of the turbulent fluctuations of the wind vector and simultaneously at least one scalar quantity in order to calculate turbulent fluxes using eddy covariance. To do this, fast and accurate sensors are required, with small weight, small dimensions and small power consumption, in order to be operated on a small research UAV. Beside absolute and relative measurement accuracy, the response time of the sensors has to be short (in the order of several 10 Hz) to resolve turbulent eddies also in stable stratification (i.e. sub-metre range). Since light, small and fast sensors for air humidity and trace gases are not available currently, the first step is to measure the vertical flux of sensible heat H. Beside a slow (about 1 Hz) water vapour sensor, the automatically operating meteorological mini aerial vehicles (M2AV) are equipped with two temperature sensors and a wind measurement unit. One of the temperature sensors is slow but offers a high absolute accuracy, while the fast sensor (up to 100 Hz) has a high relative accuracy but is unstable in time. The two signals are blended using a complementary filter. The wind vector can be calculated using the inertial velocity (aircraft speed relative to the earth) and the true airspeed (aircraft speed relative to the airflow). The true airspeed of M2AV is computed from five-hole-probe pressure measurements whereas the aircraft

  13. Ansvarsfulla investeringar på den svenska fondmarknaden : Kartläggning av fonders prestation år 2012

    OpenAIRE

    Olsson, Mikael; Thorselius, Johan

    2013-01-01

    I Sverige är investeringar i fonder en vanlig förekommande sparform. En typ av fonder är SRI-fonder (Socially Responsible Investment-fonder), som strävar efter att göra hållbara placeringar förutom att prestera goda finansiella resultat. Denna rapport ämnar besvara frågan gällande hur bra SRI-fonder i Sverige presterar rent ekonomiskt i jämförelse med konventionella fonder, samt vilka variabler fondernas prestation kan bero av. Att material inom området samlas in och behandlas är viktigt då S...

  14. Utvärdering av marknaden för telemedicinska produkter i hemsjukvården

    OpenAIRE

    Virgin, Jessica; Wester, Malin

    2015-01-01

    Denna rapport utvärderar företag och verksamheter med telemedicinska produkter som finns på den svenska marknaden inom hemsjukvård för områdena Kronisk Obstruktiv Lungsjukdom, neonatalsjukvård samt hjärtsvikt. Även säkerhetsaspekter, verifierad nytta samt områdeskvantifiering för funna produkter behandlas. Detta genomfördes genom en avsökning av marknaden där säkerhetsaspekter och underlag för verifierad nytta undersöktes. Med telemedicin kan sjukhus och patienter trådlöst kommunicera och öve...

  15. Lessons learned about [F-18]-AV-1451 off-target binding from an autopsy-confirmed Parkinson's case.

    Science.gov (United States)

    Marquié, Marta; Verwer, Eline E; Meltzer, Avery C; Kim, Sally Ji Who; Agüero, Cinthya; Gonzalez, Jose; Makaretz, Sara J; Siao Tick Chong, Michael; Ramanan, Prianca; Amaral, Ana C; Normandin, Marc D; Vanderburg, Charles R; Gomperts, Stephen N; Johnson, Keith A; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-10-19

    [F-18]-AV-1451 is a novel positron emission tomography (PET) tracer with high affinity to neurofibrillary tau pathology in Alzheimer's disease (AD). PET studies have shown increased tracer retention in patients clinically diagnosed with dementia of AD type and mild cognitive impairment in regions that are known to contain tau lesions. In vivo uptake has also consistently been observed in midbrain, basal ganglia and choroid plexus in elderly individuals regardless of their clinical diagnosis, including clinically normal whose brains are not expected to harbor tau pathology in those areas. We and others have shown that [F-18]-AV-1451 exhibits off-target binding to neuromelanin, melanin and blood products on postmortem material; and this is important for the correct interpretation of PET images. In the present study, we further investigated [F-18]-AV-1451 off-target binding in the first autopsy-confirmed Parkinson's disease (PD) subject who underwent antemortem PET imaging. The PET scan showed elevated [F-18]-AV-1451 retention predominantly in inferior temporal cortex, basal ganglia, midbrain and choroid plexus. Neuropathologic examination confirmed the PD diagnosis. Phosphor screen and high resolution autoradiography failed to show detectable [F-18]-AV-1451 binding in multiple brain regions examined with the exception of neuromelanin-containing neurons in the substantia nigra, leptomeningeal melanocytes adjacent to ventricles and midbrain, and microhemorrhages in the occipital cortex (all reflecting off-target binding), in addition to incidental age-related neurofibrillary tangles in the entorhinal cortex. Additional legacy postmortem brain samples containing basal ganglia, choroid plexus, and parenchymal hemorrhages from 20 subjects with various neuropathologic diagnoses were also included in the autoradiography experiments to better understand what [F-18]-AV-1451 in vivo positivity in those regions means. No detectable [F-18]-AV-1451 autoradiographic binding was

  16. Prestandautvärdering av Bluetooth och Wi-Fi för en smart hubb

    OpenAIRE

    Wazir, Omerjan; Frantsalis, Ioannis

    2017-01-01

    Examensarbetet har utförts på uppdrag av företaget Seavus som såg ett behov avatt minska kabelanvändning i kontoret. Enhetsanvändning kan effektiviseras medhjälp av en central styrenhet, en så kallad smart hubb.Ett problem är att välja mellan Bluetooth och Wi-Fi för kommunikation mellan an-vändaren och den smarta hubben. Valet kan bero på flera faktorer som exempelvis,bandbredd (datahastighet), jitter (fördröjningsvariation) och paketförluster, vilkaär viktiga parametrar för att bedöma kvalit...

  17. Läckage av koppar från båtbottnar i sötvatten

    OpenAIRE

    Gretzén, Fanny

    2016-01-01

    Båtbottenfärger, eller antifoulingfärger, används för att motverka påväxt i form avexempelvis havstulpaner och alger på båtskrov. Färgerna kan antingen ha en kemisk,biologisk, fysikalisk eller mekanisk verkan på de vattenlevande organismerna. De kemisktverkande biocidfärgerna räknas som bekämpningsmedel och måste godkännas av Kemikalieinspektionen innan de får säljas och användas i Sverige. På grund av den lågasalthalten i Mälaren är problemet med påväxt mindre än på exempelvis Västkusten, oc...

  18. Analys av SWMM-CAT och möjligheten att tillämpa SWMM-CAT i Sverige

    OpenAIRE

    Aronsson, Andreas; Hinders, Niclas

    2015-01-01

    Under det närmaste seklet kommer Sverige att vara med om en klimatförändring med en ökad nederbörd upp mot 40 % i delar av landet. Översvämningar kommer bli vanligare och kraftigare skyfall under kortare perioder är det största hotet mot ett fungerande avrinningssystem. De mängder dagvatten som ska hanteras i stadsbebyggelse kan vara mycket stora på grund av att grönytor har bytts ut mot hårdgjorda ytor.   SWMM-CAT (Storm Water Management Model – Climate Adjustment Tool) är ett program som ka...

  19. Angiographic analysis of animal model aneurysms treated with novel polyurethane asymmetric vascular stent (P-AVS): feasibility study

    OpenAIRE

    Ionita, Ciprian N; Dohatcu, Andreea; Sinelnikov, Andrey; Sherman, Jason; Keleshis, Christos; Paciorek, Ann M; Hoffmann, K R; Bednarek, D. R.; Rudin, S.

    2009-01-01

    Image-guided endovascular intervention (EIGI), using new flow modifying endovascular devices for intracranial aneurysm treatment is an active area of stroke research. The new polyurethane-asymmetric vascular stent (P-AVS), a vascular stent partially covered with a polyurethane-based patch, is used to cover the aneurysm neck, thus occluding flow into the aneurysm. This study involves angiographic imaging of partially covered aneurysm orifices. This particular situation could occur when the vas...

  20. Erfarenhetens och reflektionens betydelse för lärandet av molekylära processer

    Directory of Open Access Journals (Sweden)

    Caroline Larsson

    2015-06-01

    Full Text Available Lärande om molekylära processer kan innebära vissa svårigheter dels för att dessa processer inte går att direkt erfara och dels för att de är dynamiska i sin natur. Ett sätt att överbrygga problematiken är att använda sig av olika representationer, vilket i sig medför ytterligare utmaningar. Studenters förkunskaper och intuitiva idéer som härstammar från vardagserfarenheter kan också ge upphov till svårigheter i meningsskapandet. Syftet med denna artikel är att diskutera erfarenhetens och reflektionens betydelse för undervisning och lärande med representationer av molekylära fenomen i högre utbildning. I artikeln presenteras empiriska resultat från forskningsstudier som ligger till grund för de idéer och resonemang som förs fram. Vi presenterar två exempel där studenter arbetar i grupp med representationer av de molekylära processerna ATP-syntes och självassociation. Grunden för grupparbetet och meningsskapandet är fokuserade frågor där egna tankar och idéer får ta plats. Reflektionen i grupparbetet ger också studenterna möjligheter att generalisera sina erfarenheter (abstrakt tänkande och underlättar förståelsen av tröskelbegrepp.