WorldWideScience

Sample records for samarium 165

  1. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  2. Particle-Size-Induced Valence Changes in Samarium Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Mason, M. G.; Lee, S. -T.; Apai, G.; Davis, R. F.; Shirley, D. A.; Franciosi, A.; Weaver, J. H.

    1981-09-01

    Samarium clusters exhibit mixed-valence behavior which is sensitive to particle size. XPS and UPS data show samarium to be primarily divalent (4f{sup 6} ) at small particle size. The trivalent state (4f{sup 5} ) becomes progressively more abundant with increasing s1ze, becoming the dominant state for the bulk metal. These results are interpreted using a model in which band narrowing, due to reduced surface coordination, is more dominant than surface tension effects in establishing the valence of small samarium clusters.

  3. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  4. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel

    Energy Technology Data Exchange (ETDEWEB)

    Villarim Neto, Arthur; Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Rego, Amalia Cinthia Meneses [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Postgraduate Program in Health Sciences; Azevedo, Italo Medeiros; Medeiros, Aldo Cunha [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. of Surgery; Bernardo-Filho, Mario [State University of Rio de Janeiro, RJ (Brazil). Dept. of Biophysics and Biometry

    2009-01-15

    Purpose: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. Methods: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium) group received docetaxel (15 mg/kg) intraperitoneally in two cycles 11 days apart. The S (samarium/control) group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1 ml of samarium-153-EDTMP via orbital plexus (25 {mu} Ci. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI / g) was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland). Results: On the ninth day after the administration of the second chemotherapy cycle, the rats had a significant weight loss (314.50 +- 22.09 g) compared (p<0.5) to pre-treatment weight (353.66 {+-} 22.8). The % ATI/g in the samples of rats treated with samarium-153-EDTMP had a significant reduction in the right femur, left femur, kidney, liver and lungs of animals treated with docetaxel, compared to the control rats. Conclusion: The combination of docetaxel and samarium-153-EDTMP was associated with a lower response rate in the biodistribution of the radiopharmaceutical to targeted tissues. Further investigation into the impact of docetaxel on biodistribution of samarium-153-EDTMP would complement the findings of this study. (author)

  5. The Basis for Developing Samarium AMS for Fuel Cycle Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Buchholz, B A; Biegalski, S R; Whitney, S M; Tumey, S J; Weaver, C J

    2008-10-13

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of {sup 146}Sm, {sup 149}Sm, and {sup 151}Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  6. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    Optical characteristics of transparent samarium oxide thin films deposited by the radio-frequency sputtering technique. A A ATTA M M EL-NAHASS KHALED M ELSABAWY M M ABD EL-RAHEEM A M HASSANIEN A ALHUTHALI ALI BADAWI AMAR MERAZGA. Regular Volume 87 Issue 5 November 2016 Article ID 72 ...

  7. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3() ZnO(40-)V2O5(60) (where = 0.1–0.5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been calculated.

  8. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Optical properties of samarium doped zinc–tellurite glasses. B ERAIAH. Department of Physics, Karnatak University, Dharwad 580 003, India. Present address: Department of Physics, Bangalore University, Bangalore 560 056, India. MS received 20 March 2006; revised 13 June 2006. Abstract. Glasses with the composition, ...

  9. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: Syntheses, crystal structures, thermal analysis and luminescence study. MUHAMMAD IDIRIS SALEH, MIN YEE CHOO, TAI WEI CHAN and MOHD R RAZALI. ∗. School of Chemical Sciences, Universiti Sains Malaysia, Penang, ...

  10. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 127; Issue 12. Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: ... Muhammad Idiris Saleh1 Min Yee Choo1 Tai Wei Chan1 Mohd R Razali1. School of Chemical Sciences, Universiti Sains Malaysia, Penang, Malaysia ...

  11. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Mechanism of the electrochemical deposition of samarium-based coatings

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, Edgar J. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Ortega-Borges, Raul [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Godinez, Luis A. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Chapman, Thomas W. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Meas-Vong, Yunny [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico)]. E-mail: yunnymeas@cideteq.mx

    2006-11-12

    Samarium-based films have been shown to form from aqueous solutions on the surfaces of metallic substrates such as steel or aluminum, and their presence has been reported to decrease substantially the corresponding corrosion rate of the underlying metallic substrate. Based on previous reports on the deposition of oxides or hydroxides of the closely related element cerium, this work demonstrates that samarium films are formed following a similar mechanism, which involves as the fundamental step an increase in interfacial pH resulting from cathodic oxygen-reduction or hydrogen-evolution reactions. With cyclic voltammetry (CV), electrochemical quartz-crystal microbalance (EQCM) measurements, rotating-disk electrode (RDE) tests, and surface characterization techniques, namely, scanning electron microscopy (SEM) and X-ray surface microanalysis (EDX), the postulated mechanism was verified, and the surface morphology of the resulting films was correlated with the nature of the reduction reaction that triggers film formation.

  13. Samarium Monosulfide (SmS): Reviewing Properties and Applications

    OpenAIRE

    Sousanis, Andreas; Smet, Philippe; Poelman, Dirk

    2017-01-01

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducti...

  14. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  15. Synthesis of nano-pore samarium (III)-imprinted polymer for preconcentrative separation of samarium ions from other lanthanide ions via solid phase extraction

    Energy Technology Data Exchange (ETDEWEB)

    Shirvani-Arani, Simindokht [Center of Excellence in Electrochemistry, Department of Chemistry, University of Tehran, P.O.Box:14155-6455, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ahmadi, Seyed Javad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)], E-mail: sjahmadi@aeoi.org.ir; Bahrami-Samani, Ali [Nuclear Engineering and Physics Department, Amir Kabir University, P.O.Box: 15875-4413, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ghannadi-Maragheh, Mohammad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)

    2008-08-08

    A batch process was developed to separate samarium ions from some lanthanide ions by a novel solid phase which was prepared via the ion-imprinting technique. The samarium (III) ion-imprinted polymer (IIP) particles were synthesized by preparing the ternary complex of samarium ions with 5,7-dichloroquinoline-8-ol (DCQ) and 4-vinylpyridine (VP). Then, thermally copolymerization with styrene (functional monomer, STY) and divinylbenzene (cross-linking monomer, DVB) followed in the presence of 2-methoxy ethanol (porogen) and 2,2'-azobisisobutyronitrile (initiator, AIBN). The imprinted ion was removed by stirring the above particles with 50% (v/v) HCl to obtain the leached IIP particles. Moreover, control polymer (CP) particles were similarly prepared without the samarium ions. The unleached and leached IIP particles were characterized by X-ray diffraction (XRD), infra-red spectroscopy (IR), thermo gravimetric analysis (TGA) and scanning electron microscopy (SEM). Finally, preconcentration and selectivity studies for samarium and the other lanthanide ions were carried out. The preconcentration of the samarium (III) traces was studied during rebinding with the leached IIP particles as a function of pH, the weight of the polymer material, the preconcentration and the elution times, the eluent volume and the aqueous phase volume. These studies indicated that the samarium (III) amount as low as 1 {mu}g, present in 200 mL, could be preconcentrated into 25 mL of 1.0 M HCl.

  16. Ionization of Samarium by Chemical Releases in the Upper Atmosphere

    Science.gov (United States)

    Siefring, C. L.; Bernhardt, P. A.; Holmes, J. M.; Pedersen, T. R.; Caton, R.; Miller, D.; Groves, K. M.

    2014-12-01

    The release of Samarium vapor into the upper atmosphere was studied using during the Air Force Research Laboratory sponsored Metal Oxide Space Cloud (MOSC) rocket launches in May 2009. The Naval Research Laboratory supported these experiments with 3-D photochemical modeling of the artificial plasma cloud including (1) reactions with atomic oxygen, (2) photo excitation, (3) photoionization, (4) dissociative recombination, and (5) ion and neutral diffusion. NRL provided the experimental diagnostic instrument on the rocket which was a dual frequency radio beacon on the rocket to measure changes in total electron content. The AFRL provided ground based diagnostics of incoherent scatter radar and optical spectroscopy and imagery. The NRL Chemical Release Model (CRM) has over 600 excited states of atomic Samarium neutrals, atomic ions, along with Samarium Oxide Ions and electrons. Diffusive transport of neutrals in cylindrical geometry and ions along magnetic field lines is computed along with the reactive flow to predict the concentrations of Sm, Sm-Ion, Sm0, and SmO Ion. Comparison of the CRM with observations demonstrates that Sm release into the upper atmosphere initially produces enhanced electron densities and SmO-Ions. The diatomic ions recombine with electrons to yield neutral Sm and O. Only the photo ionization of Sm yields a stable atomic ion that does not substantially recombine. The MOSC releases in sunlight yielded long duration ion clouds that can be replicated with the CRM. The CRM predicts that Sm releases in darkness would not produce long duration plasma clouds because of the lack of photo excitation and photoionization.

  17. Reactive Materials for Evaporating Samarium (Pre-Print)

    Science.gov (United States)

    2016-04-15

    SUBJECT TERMS energetic materials, heat sources, pyrotechnic charges, easily ionized metals 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF...experiments.    Keywords:  energetic  materials, heat sources, pyrotechnic charges, easily ionized metals  1. Introduction Ejection of clouds of...results  were  negatively  affected  by  reduced  efficiency   of  release  and  ionization of samarium [8]. It is possible that not the entire charge of

  18. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  19. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  20. Luminescent solutions and powders of new samarium complexes with N,N',O,O'-chelating ligands

    Science.gov (United States)

    Kharcheva, Anastasia V.; Nikolskiy, Kirill S.; Borisova, Nataliya E.; Ivanov, Alexey V.; Reshetova, Marina D.; Yuzhakov, Viktor I.; Patsaeva, Svetlana V.

    2016-04-01

    Imaging techniques in biology and medicine are crucial tools to obtain information on structural and functional properties of living cells and organisms. To fulfill the requirements associated with application of these techniques it appears necessary to design markers with specific characteristics. Luminescent complexes of trivalent lanthanide ions with chelating ligands are of increasing importance in biomedical applications because of their millisecond luminescence lifetime, narrow emission band, high signal-to-noise ratio and minimal photodamage to biological samples. In order to extend the available emission wavelength range the luminescent samarium chelates are highly desirable. In this study the ligands with diamides of 2,2'-bipyridin-6,6'-dicarboxylic acid were used to improve photophysical characteristics of samarium complexes. We report the luminescence characteristics of samarium complexes with novel ligands. All complexes exhibited the characteristic emission of Sm (III) ion with the lines at 565, 597, 605, 645 and 654 nm, the intensity strongly depended on the ligand. Absorption and luminescence excitation spectra of Sm (III) complexes showed main peaks in the UV range demonstrating lanthanide coordination to the ligand. The absolute lumenescence quantum yield was measured for solutions in acetonitrile with excitation at 350 nm. The largest luminescence quantum yield was found for the samarium complex Bipy 6MePy Sm (3%) being much higher that for samarium complexes reported in the literature earlier. These results prove as well that samarium chelates are potential markers for multiparametric imaging techniques.

  1. Australian manufacture of Quadramet{sup TM} (Samarium-153 EDTMP)

    Energy Technology Data Exchange (ETDEWEB)

    Wood, N.R.; Whitwell, J. [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). Australian Radioisotopes

    1997-10-01

    Quadramet{sup T} (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200{mu}g/mL whereas the overseas formulation has a level of 20-46{mu}g/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet{sup TM} provides a further option in the management of these difficult cases

  2. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  3. Optical analysis of samarium doped sodium bismuth silicate glass.

    Science.gov (United States)

    Thomas, V; Sofin, R G S; Allen, M; Thomas, H; Biju, P R; Jose, G; Unnikrishnan, N V

    2017-01-15

    Samarium doped sodium bismuth silicate glass was synthesized using the melt quenching method. Detailed optical spectroscopic studies of the glassy material were carried out in the UV-Vis-NIR spectral range. Using the optical absorption spectra Judd-Ofelt (JO) parameters are derived. The calculated values of the JO parameters are utilized in evaluating the various radiative parameters such as electric dipole line strengths (Sed), radiative transition probabilities (Arad), radiative lifetimes (τrad), fluorescence branching ratios (β) and the integrated absorption cross- sections (σa) for stimulated emission from various excited states of Sm3+‡ ion. The principal fluorescence transitions are identified by recording the fluorescence spectrum. Our analysis revealed that the novel glassy system has the optimum values for the key parameters viz. spectroscopic quality factor, optical gain, stimulated emission cross section and quantum efficiency, which are required for a high performance optical amplifier. Calculated chromaticity co-ordinates (0.61, 0.38) also confirm its application potential in display devices. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Samarium Monosulfide (SmS): Reviewing Properties and Applications.

    Science.gov (United States)

    Sousanis, Andreas; Smet, Philippe F; Poelman, Dirk

    2017-08-16

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducting and metallic states could be exploited in several applications, such as high density optical storage and memory materials, thermovoltaic devices, infrared sensors and more. We discuss the electronic, optical and magnetic properties of SmS, its switching behavior, as well as the thin film deposition techniques which have been used, such as e-beam evaporation and sputtering. Moreover, applications and possible ideas for future work on this material are presented. Our scope is to present the properties of SmS, which were mainly measured in bulk crystals, while at the same time we describe the possible deposition methods that will push the study of SmS to nanoscale dimensions, opening an intriguing range of applications for low-dimensional, pressure-induced semiconductor-metal transition compounds.

  5. Excitation induced spectroscopic study and quenching effect in cerium samarium codoped lithium aluminoborate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Parvinder; Kaur, Simranpreet [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, Gurinder Pal [Department of Physics, Khalsa College, Amritsar 143002 (India); Arora, Deepawali; Kumar, Sunil [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, D.P., E-mail: dpsinghdr@yahoo.com [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India)

    2016-08-15

    Lithium aluminium borate host has been codoped with cerium and samarium to prepare glass by conventional melt quench technique. Their structural and spectroscopic investigation has been carried out using XRD, FTIR and density measurements. The UV‐Vis absorption spectra and fluorescence spectra (λ{sub exc}.=380 nm and 400 nm) have been studied for spectroscopic analysis. The amorphous nature of the prepared samples is shown by XRD. The density is increasing with addition of cerium at the expense of aluminium, keeping other components constant. FTIR study also shows the presence of compact and stable tetrahedral BO{sub 4} units thus supporting the density results. The UV‐ Vis absorption spectra show a shift of optical absorption edge towards longer wavelength along with an increase in intensity of peaks with rising samarium concentration. The fluorescence spectra show a blue shift and subsequent suppression of cerium peaks with addition of samarium.

  6. Effect of samarium doping on the dielectric behavior of barium zircomium titanate ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Badapanda, T., E-mail: badapanda.tanmaya@gmail.com [Department of Physics, C.V. Raman College of Engineering, Bhubaneswar, Odisha-752054 (India); Sarangi, S.; Behera, B. [School of Physics, Sambalpur University, Jyoti Vihar Sambalpur, Odisha-768019 (India); Anwar, S. [Colloids and Materials Chemistry, Institute of Minerals and Materials Technology, Bhubaneswar, Odisha-751013 (India); Sinha, T. P. [Department of Physics, Bose Institute, Kolkata-700009 (India)

    2014-04-24

    Samarium doped Barium Zirconium Titanate ceramic with general formula Ba{sub 1−x}Sm{sub 2x/3}Zr{sub 0.05}Ti{sub 0.95}O{sub 3} [x=0.0,0.01,0.02,0.03,0.04] has been prepared by high energy ball milling. The X-ray diffraction (XRD) patterns confirmed that these ceramics have a single phase with perovskite-type upto x≤0.03 and a small secondary phase exist at x=0.04. The temperature dependent dielectric study shows a ferroelectric phase transition and transition temperature decreases with an increase in the Samarium content.

  7. Lithium Bromide/Water as Additives in Dearomatizing Samarium-Ketyl (Hetero)Arene Cyclizations.

    Science.gov (United States)

    Rao, Chintada Nageswara; Bentz, Christoph; Reissig, Hans-Ulrich

    2015-11-02

    New conditions for dearomatizing samarium-ketyl (hetero)arene cyclizations are reported. In many examples of these samarium diiodide-mediated reactions, lithium bromide and water can be used as additives instead of the carcinogenic and mutagenic hexamethylphosphoramide (HMPA). The best results were obtained for the cyclizations of N-acylated indole derivatives delivering the expected indolines in good yields and excellent diastereoselectivities. A new type of cyclization delivering indolyl-substituted allene derivatives is also described. The scope and limitations of the lithium bromide/water system are discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    The samarium-doped ceria (SDC) nanospheres were prepared by the one-step hydrothermal method and characterized by transmission electron microscope, scanning electron microscope, powder X-ray diffraction, X-ray photoelectron spectroscopy, energy-dispersive spectrometer and Raman spectra. According to the ...

  9. A spectroscopic comparison of samarium-doped LiYF4 and KY3F10

    NARCIS (Netherlands)

    Wells, J. P. R.; Sugiyama, A.; Han, T. P. J.; Gallagher, H. G.

    2000-01-01

    Laser selective excitation and fluorescence has been performed on LiYF4 and KY3F10 doped with samarium ions. In LiYF4, a single, tetragonal symmetry center associated with isovalent substitution of Sm3+ with lattice yttrium ions is present. By contrast, three Sm2+ centres and a single, tetragonal

  10. The Use of a Flexible Calix[4]arene Template to Stabilize a Cyclooctatetraindiyl Samarium-Potassium Complex

    Directory of Open Access Journals (Sweden)

    Geoffroy Guillemot

    2013-01-01

    Full Text Available A sandwich compound of cyclooctatetraendiyl (COT2− samarium-potassium was synthesized and analyzed using a flexible calix[4]arene dianion. This compound, [p-tBu-calix[4]-(OMe2(O2]arenediyl-samarium-(η8-cyclooctatetraendiyl-potassium (tetrahydrofurane3, is constructed as a linear sequence L-Sm--K-, where L, , and are specific ligands with L = O,O-dimethyl-calix[4]arene2−, = cyclo-octatetraendiyl, and = tetrahydrofurane templates.

  11. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  12. Samarium(II) iodide-mediated reductive annulations of ketones bearing a distal vinyl epoxide moiety

    Energy Technology Data Exchange (ETDEWEB)

    Molander, G.A.; Shakya, S.R. [Univ. of Colorado, Boulder, CO (United States)

    1996-08-23

    It was found that samarium (II) iodide promotes the intramolecular coupling of ketones with distal epoxy olefins while in the presence of hexamethylphosphoramide (HPMA). A number of epoxide compounds (1 a-k) fragment to form carbocycles with allylic alcohol side chains with high diastereoselectivity (2 a-k). Substituting tetramethylguanidine for HPMA reduces the diastereoselectivity. Adding Pd(0) as a catalyst reverses the diastereoselective sense. 40 refs., 1 tab.

  13. A temporal three-dimensional simulation of samarium release in the ionosphere

    Science.gov (United States)

    Zhao, Hai-Sheng; Feng, Jie; Xu, Zheng-Wen; Wu, Jian; Wu, Zhen-Sen; Xu, Bin; Xue, Kun; Xu, Tong; Hu, Yan-Li

    2016-10-01

    For understanding plasma processes of the ionosphere and magnetosphere, the alkali and alkaline-earth metals are usually released in space for artificially increasing the electron density. However, it is a limitation that these releases must be in sunlight where the photoionization can take place. In recent years, the lanthanide metals, such as samarium, have been released to produce electrons in reaction with atomic oxygen in the upper space. The reaction could proceed without sunlight so that the restriction on experimental periods is broken. Unfortunately, any sophisticated models even preliminary ones are unavailable yet in the literature. A temporal three-dimensional model is presented for the samarium release in detail with respect to various altitudes and mass. Especially, the plasma diffusion equation is remarkably extended from 2-D to 3-D by importing the influence of geomagnetic declination, which could be also useful for other chemical releases. The field-aligned terms are brought so as to the presented model can describe the diffusion along the geomagnetic field subtly. On the basis of the presented model, behaviors of radio waves propagating through the release area are simulated by using ray tracing. This model could be as the theoretical support for samarium releases, and it also helpful for the research on the generation and evolution of the ionosphere irregularities.

  14. 34 CFR 300.165 - Public participation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Public participation. 300.165 Section 300.165 Education... DISABILITIES State Eligibility Additional Eligibility Requirements § 300.165 Public participation. (a) Prior to... under this part, a State must comply with the public participation requirements in paragraph (a) of this...

  15. 7 CFR 16.5 - Compliance.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Compliance. 16.5 Section 16.5 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS ORGANIZATIONS § 16.5 Compliance. USDA agencies will monitor compliance with this part in the course of regular oversight of USDA programs. ...

  16. 21 CFR 165.110 - Bottled water.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...

  17. Liquid–liquid anion exchange extraction studies of samarium(III from salicylate media using high molecular weight amine

    Directory of Open Access Journals (Sweden)

    Aniruddha M. Mandhare

    2015-07-01

    Full Text Available Liquid–liquid extraction and separation of samarium(III were carried out by using 0.025 mol dm−3 2-octylaminopyridine(2-OAP in xylene at 298 K. The extraction behavior of samarium was studied as a function of pH, weak acid concentration, extractant concentration, diluent, and equilibration time. Samarium was quantitatively extracted at pH 7.5 to 10.0 from 0.01 mol dm−3 sodium salicylate solution with 0.025 mol dm−3 2-OAP. The possible composition of the extracted species in organic phase has been determined by using model of slope analysis method and extraction mechanism was found to proceed via an anion exchange mechanism. The stripping efficiency was found to be quantitative in HNO3, HCl and CH3COOH. The robustness of the procedure was demonstrated by the average recoveries obtained (>99.6% for samarium(III extraction in the presence of several cations and anions which are commonly associated with it. The proposed method facilitates the separation and determination of samarium(III from binary and synthetic mixtures. The various thermodynamic functions like free energy (ΔG, enthalpy (ΔH and entropy (ΔS of extraction mechanism were discussed.

  18. 21 CFR 556.165 - Cloxacillin.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Cloxacillin. 556.165 Section 556.165 Food and... Residues of New Animal Drugs § 556.165 Cloxacillin. A tolerance of 0.01 part per million is established for negligible residues of cloxacillin in the uncooked edible tissues of cattle and in milk. [40 FR 28792, July 9...

  19. Samarium(II) iodide-mediated intramolecular conjugate additions of alpha,beta-unsaturated lactones.

    Science.gov (United States)

    Molander, Gary A; St Jean, David J

    2002-05-31

    Samarium(II) iodide, in the presence of catalytic amounts of nickel(II) iodide, has been used to promote intramolecular conjugate additions of alkyl halides onto alpha,beta-unsaturated lactones. This process has been shown to be applicable to a number of alpha,beta-unsaturated lactones, including tetrasubstituted olefins, and has been demonstrated to be quite general for the formation of saturated bicyclic and tricyclic lactones. The method presented herein provides a mild, efficient process to form structurally complex lactones from simple precursors.

  20. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  1. X-Band Microwave Reflection Properties of Samarium/Bismuth-Substituted Barium Lanthanum Titanate Ceramics

    Science.gov (United States)

    Bahel, Shalini; Pubby, Kunal; Narang, Sukhleen Bindra

    2017-03-01

    Samarium/bismuth-substituted barium lanthanum titanate ceramics with chemical composition Ba4 (La_{1 - y - z} Smy Biz )_{9.33} Ti_{18} O_{54} ( y = 0.5, 0.7; z = 0.05, 0.10, 0.15), intended as microwave reflecting materials, have been investigated in microwave X-band (8.2 GHz to 12.4 GHz) and the effect of substitution on their dielectric properties, i.e., dielectric constant and dielectric loss tangent, has been studied by vector network analyzer. Dielectric analysis showed that the dielectric constant increased with increasing samarium as well as bismuth content. Dielectric relaxation was observed for all samples in the scanned frequency range. Microwave reflection and transmission analysis of ceramic pellets of thickness 4 mm was carried out using two methods, i.e., open- and short-circuit approach, both indicating very high values of reflected power and very low values of transmitted power for all the doped materials in comparison with the base composition. The doped compositions are therefore potential microwave shielding materials for use in anechoic chambers, microwave laboratories, and radar equipment. Double-layer reflectors are also proposed, having better reflection properties (˜99% reflection) compared with single-layer reflectors.

  2. Microstructure and hysteresis curves of samarium-holmium-iron garnet synthesized by coprecipitation

    Directory of Open Access Journals (Sweden)

    Caffarena Valeska da Rocha

    2003-01-01

    Full Text Available An investigation was made into the synthesis and magnetic properties of Sm(3-xHo xFe5O12 (samarium-holmium-iron garnet ferrite, as yet absent from the literature. The material in question was synthesized by co-precipitation, starting from hydrated chlorides of rare-earth elements and ferrous sulfate, and the mixed hydroxide co-precipitate was calcined at 1000 °C. Using PVA as a binder, rectangular cross section-shaped compacts were produced by means of steel-die pressing, drying and sintering from 1200 to 1450 °C. The main conclusions of this study were that the coercive force decreases as the sintering temperature increases, and that the effect of substituting holmium for samarium in SmIG is entirely different from that provided by replacing yttrium by gadolinium in YIG, which is the most important result of this work. An in-depth investigation will be necessary to determine the correlation between microstructure/magnetic properties and ceramic processing variables.

  3. Bone-seeking radiopharmaceuticals as targeted agents of osteosarcoma: samarium-153-EDTMP and radium-223.

    Science.gov (United States)

    Anderson, Peter M; Subbiah, Vivek; Rohren, Eric

    2014-01-01

    Osteosarcoma is a cancer characterized by formation of bone by malignant cells. Routine bone scan imaging with Tc-99m-MDP is done at diagnosis to evaluate primary tumor uptake and check for bone metastases. At time of relapse the Tc-99m-MDP bone scan also provides a specific means to assess formation of bone by malignant osteosarcoma cells and the potential for bone-seeking radiopharmaceuticals to deliver radioactivity directly into osteoblastic osteosarcoma lesions. This chapter will review and compare a bone-seeking radiopharmaceutical that emits beta-particles, samarium-153-EDTMP, with an alpha-particle emitter, radium-223. The charged alpha particles from radium-223 have far more mass and energy than beta particles (electrons) from Sm-153-EDTMP. Because radium-223 has less marrow toxicity and more radiobiological effectiveness, especially if inside the bone forming cancer cell than samarium-153-EDTMP, radium-223 may have greater potential to become widely used against osteosarcoma as a targeted therapy. Radium-223 also has more potential to be used with chemotherapy against osteosarcoma and bone metastases. Because osteosarcoma makes bone and radium-223 acts like calcium, this radiopharmaceutical could possibly become a new targeted means to achieve safe and effective reduction of tumor burden as well as facilitate better surgery and/or radiotherapy for difficult to resect large, or metastatic tumors.

  4. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  5. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  6. 24 CFR 1720.165 - Time computation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Time computation. 1720.165 Section... Proceedings General Provisions § 1720.165 Time computation. Computation of any period of time prescribed or..., and national holidays shall be included in the computation of the prescribed or allowed period. ...

  7. 21 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... or marking, a day's production. (2) For purposes of determining quality factors related to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Definitions. 165.3 Section 165.3 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  8. Manganese-induced turnover of TMEM165.

    Science.gov (United States)

    Potelle, Sven; Dulary, Eudoxie; Climer, Leslie; Duvet, Sandrine; Morelle, Willy; Vicogne, Dorothée; Lebredonchel, Elodie; Houdou, Marine; Spriet, Corentin; Krzewinski-Recchi, Marie-Ange; Peanne, Romain; Klein, André; de Bettignies, Geoffroy; Morsomme, Pierre; Matthijs, Gert; Marquardt, Thorsten; Lupashin, Vladimir; Foulquier, François

    2017-04-19

    TMEM165 deficiencies lead to one of the congenital disorders of glycosylation (CDG), a group of inherited diseases where the glycosylation process is altered. We recently demonstrated that the Golgi glycosylation defect due to TMEM165 deficiency resulted from a Golgi manganese homeostasis defect and that Mn 2+ supplementation was sufficient to rescue normal glycosylation. In the present paper, we highlight TMEM165 as a novel Golgi protein sensitive to manganese. When cells were exposed to high Mn 2+ concentrations, TMEM165 was degraded in lysosomes. Remarkably, while the variant R126H was sensitive upon manganese exposure, the variant E108G, recently identified in a novel TMEM165-CDG patient, was found to be insensitive. We also showed that the E108G mutation did not abolish the function of TMEM165 in Golgi glycosylation. Altogether, the present study identified the Golgi protein TMEM165 as a novel Mn 2+ -sensitive protein in mammalian cells and pointed to the crucial importance of the glutamic acid (E108) in the cytosolic ELGDK motif in Mn 2+ -induced degradation of TMEM165. © 2017 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.

  9. 33 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Definitions. 165.3 Section 165.3 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS... credential that serves as the mariner's qualification document, certificate of identification, and...

  10. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  11. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry in the Region of Samarium, Europium, and Gadolinium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R D; Kelley, K; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of samarium, europium and gadolinium (62 {le} Z {le} 64, 82 {le} N {le} 96).

  12. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  13. Effects of the atomic environment on the electron binding energies in samarium

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh., E-mail: inoyatov@jinr.ru [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Institute of Applied Physics, National University, Tashkent, Republic of Uzbekistan (Uzbekistan); Kovalík, A. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Filosofov, D.V. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Ryšavý, M.; Vénos, D. [Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Yushkevich, Yu.V.; Perevoshchikov, L.L. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Zhdanov, V.S. [Nuclear Physics Institute, Almaty, Republic of Kazakhstan (Kazakhstan)

    2016-02-15

    Highlights: • Eight different matrices (evaporated and implanted at 30 keV) used. • The greatest average difference in the binding energies amounted to 3.1 ± 0.1 eV. • The presence of trivalent and divalent Sm ions found in some implanted samples. • No significant differences in Sm natural atomic level widths were observed. - Abstract: Effects of the atomic environment on the L{sub 1}, L{sub 2}, L{sub 3}, M{sub 1}, M{sub 2}, M{sub 3}, and N{sub 1} electron binding energies in samarium generated in the electron capture decay of radioactive {sup 149}Eu were investigated by means of the internal conversion electron spectroscopy using the conversion electron spectrum of the 22.5 keV M1 + E2 nuclear transition in the daughter {sup 149}Sm. In this investigation, four pairs of {sup 149}Eu sources prepared by vacuum evaporation deposition and by ion implantation at 30 keV with the use of four different source backing materials, namely polycrystalline carbon, aluminium, gadolinium and platinum foils, were employed. The greatest average difference of (3.1 ± 0.1) eV in the L{sub 1}, L{sub 2}, L{sub 3}, and M{sub 1} subshell electron binding energies was observed between the {sup 149}Eu sources prepared by ion implantation into the aluminium and platinum substrates. On the other hand, minimal differences in the electron binding energies were generally found between samarium generated in the evaporated layer and in the bulk for the individual investigated source backings with the exception of the gadolinium foil. A doublet structure of all investigated conversion electron lines with the average values of 8.1 ± 0.2 eV and 1.5 ± 0.1 for the separation energy and the intensity ratio of the low-energy to high-energy components, respectively, was observed for the {sup 149}Eu sources prepared by ion implantation into the aluminium and carbon foils. This structure was presumably caused by the presence of both the trivalent and divalent Sm ions in the sources. No

  14. 40 CFR 40.165 - Continuation grants.

    Science.gov (United States)

    2010-07-01

    ... RESEARCH AND DEMONSTRATION GRANTS § 40.165 Continuation grants. To be eligible for a continuation grant within the approved project period, the grantee must: (a) Have demonstrated satisfactory performance...

  15. Multiphoton laser wave-mixing absorption spectroscopy for samarium using a graphite furnace atomizer

    Energy Technology Data Exchange (ETDEWEB)

    Maniaci, Michael J.; Tong, William G. E-mail: william.tong@sdsu.edu

    2004-07-30

    Nonlinear laser wave-mixing optical technique is presented as a sensitive atomic spectroscopic method for the analysis of rare earth elements using an unmodified commercially available graphite furnace (GF) atomizer. A simple nonplanar backward-scattering degenerate four-wave mixing optical arrangement offers sub-picogram detection sensitivity with sub-Doppler Lorentzian-broadened resolution. Nonlinear wave mixing is an unusually sensitive absorption-based optical method that offers both excellent detection sensitivity and sub-Doppler spectral resolution. A mass detection limit of 0.7 pg and a concentration detection limit of 70 pg/ml are determined for a rare earth element, samarium, using the 429.7-nm excitation line.

  16. Samarium Doped Cerium Oxide Clusters: a Study on the Modulation of Electronic Structure

    Science.gov (United States)

    Topolski, Josey E.; Kafader, Jared O.; Marrero-Colon, Vicmarie; Chick Jarrold, Caroline

    2017-06-01

    Cerium oxide is known for its use in solid oxide fuel cells due to its high ionic conductivity. The doping of trivalent samarium atoms into cerium oxide is known to enhance the ionic conductivity through the generation of additional oxygen vacancies. This study probes the electronic structure of Sm_{x}Ce_{y}O_{z} (x+y=3, z=2-4) anion and neutral clusters. Anion photoelectron spectra of these mixed metal clusters exhibit additional spectral features not present in the previously studied cerium oxide clusters. Density functional theory calculations have been used to aid interpretation of collected spectra. The results of this work can be used to inform the design of materials used for solid oxide fuel cells.

  17. Chelating Ligand-Mediated Hydrothermal Synthesis of Samarium Orthovanadate with Decavanadate as Vanadium Source

    Directory of Open Access Journals (Sweden)

    Quanguo Li

    2013-01-01

    Full Text Available A new ethylenediaminetetraacetic acid- (EDTA- mediated hydrothermal route to prepare chrysanthemum-shaped samarium orthovanadate (SmVO4 nanocrystals with decavanadate (K6V10O28·9H2O as vanadium source has been developed. The present hydrothermal approach is simple and reproducible and employs a relatively mild reaction temperature. The EDTA, pH value, and temperature of the reaction systems play important roles in determining the morphologies and growth process of the SmVO4 products. The products have been characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, Fourier transform infrared spectroscopy (FT-IR, photoluminescence spectra (PL, and UV-Vis spectroscopy.

  18. The Magnetocaloric Effect and Heat Capacity of Suspensions of High-Dispersity Samarium Ferrite

    Science.gov (United States)

    Korolev, V. V.; Aref'ev, I. M.; Ramazanova, A. G.

    2008-02-01

    The magnetocaloric effect and specific heat capacity of an aqueous suspension of samarium ferrite were determined calorimetrically over the temperature range 288-343 K in magnetic fields of 0-0.7 T. The data obtained were used to calculate changes in the magnetic component of the molar heat capacity and entropy of the magnetic phase and changes in the enthalpy of the process under an applied magnetic field. The magnetocaloric effect was found to increase nonlinearly as the magnetic field induction grew. The corresponding temperature dependences contained a maximum at 313 K related to the second-order magnetic phase transition at the Curie point. The field and temperature dependences of heat capacity contained a maximum in fields of 0.4 T and a minimum at the magnetic phase transition temperature.

  19. Preparation of hollow core/shell microspheres of hematite and its adsorption ability for samarium.

    Science.gov (United States)

    Yu, Sheng-Hui; Yao, Qi-Zhi; Zhou, Gen-Tao; Fu, Sheng-Quan

    2014-07-09

    Hollow core/shell hematite microspheres with diameter of ca. 1-2 μm have been successfully achieved by calcining the precursor composite microspheres of pyrite and polyvinylpyrrolidone (PVP) in air. The synthesized products were characterized by a wide range of techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), energy-dispersive X-ray spectroscopy (EDX), transmission electron microscopy (TEM), high-resolution TEM (HRTEM), thermogravimetric analysis (TGA) and differential scanning calorimetry (DSC), and Brunauer-Emmett-Teller (BET) gas sorptometry. Temperature- and time-dependent experiments unveil that the precursor pyrite-PVP composite microspheres finally transform into hollow core/shell hematite microspheres in air through a multistep process including the oxidation and sulfation of pyrite, combustion of PVP occluded in the precursor, desulfation, aggregation, and fusion of nanosized hematite as well as mass transportation from the interior to the exterior of the microspheres. The formation of the hollow core/shell microspheres dominantly depends on the calcination temperature under current experimental conditions, and the aggregation of hematite nanocrystals and the core shrinking during the oxidation of pyrite are responsible for the formation of the hollow structures. Moreover, the adsorption ability of the hematite for Sm(III) was also tested. The results exhibit that the hematite microspheres have good adsorption activity for trivalent samarium, and that its adsorption capacity strongly depends on the pH of the solution, and the maximum adsorption capacity for Sm(III) is 14.48 mg/g at neutral pH. As samarium is a typical member of the lanthanide series, our results suggest that the hollow hematite microspheres have potential application in removal of rare earth elements (REEs) entering the water environment.

  20. The influence of the technological parameters on the ionic conductivity of samarium doped ceria thin films

    Directory of Open Access Journals (Sweden)

    Mantas Sriubas

    2015-03-01

    Full Text Available Sm0,20Ce0,80O2 powder was used for the formation of samarium doped cerium oxide (SDC thin films using e-beam. Surface area of powder was 34.9 m2/g and particle size – 0.3-0.5 μm. Thin films were deposited using physical vapor deposition system on SiO2 and Alloy 600 substrates. 2 Å/s – 16 Å/s growth rate and 20 °C – 600 °C substrate temperature were used during the deposition. Ionic conductivity investigation revealed that the maximum ionic conductivity (1.67 S/m has the thin film deposited on 300 °C temperature substrate using 4 Å/s growth rate. Minimum ionic conductivity (0.26 S/m has thin film which was deposited on 20 °C temperature substrate using 8 Å/s growth rate. Vacancy activation energies vary in 0.87 eV – 0.97 eV range. Furthermore the calculations of crystallite size revealed that crystallite size increases with increasing substrate temperature: from 7.50 nm to 46.23 nm on SiO2 substrate and from 9.30 nm to 44.62 nm on Alloy 600 substrate. Molar concentration of samarium in initial evaporated material is 19.38 mol% and varies from 11.37 mol% to 21 mol% in formed thin films depending on technological parameters.DOI: http://dx.doi.org/10.5755/j01.ms.21.1.5700

  1. Formation of Core-Shell Nanoparticles Composed of Magnetite and Samarium Oxide in Magnetospirillum magneticum Strain RSS-1.

    Science.gov (United States)

    Shimoshige, Hirokazu; Nakajima, Yoshikata; Kobayashi, Hideki; Yanagisawa, Keiichi; Nagaoka, Yutaka; Shimamura, Shigeru; Mizuki, Toru; Inoue, Akira; Maekawa, Toru

    2017-01-01

    Magnetotactic bacteria (MTB) synthesize magnetosomes composed of membrane-enveloped magnetite (Fe3O4) or greigite (Fe3S4) particles in the cells. Recently, several studies have shown some possibilities of controlling the biomineralization process and altering the magnetic properties of magnetosomes by adding some transition metals to the culture media under various environmental conditions. Here, we successfully grow Magnetospirillum magneticum strain RSS-1, which are isolated from a freshwater environment, and find that synthesis of magnetosomes are encouraged in RSS-1 in the presence of samarium and that each core magnetic crystal composed of magnetite is covered with a thin layer of samarium oxide (Sm2O3). The present results show some possibilities of magnetic recovery of transition metals and synthesis of some novel structures composed of magnetic particles and transition metals utilizing MTB.

  2. Co-reduction of aluminium and lanthanide ions in molten fluorides: Application to cerium and samarium extraction from nuclear wastes

    Energy Technology Data Exchange (ETDEWEB)

    Gibilaro, M. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France); Massot, L. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)], E-mail: massot@chimie.ups-tlse.fr; Chamelot, P.; Taxil, P. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)

    2009-09-01

    This work concerns the method of co-reduction process with aluminium ions in LiF-CaF{sub 2} medium (79-21 mol.%) on tungsten electrode for cerium and samarium extraction. Electrochemical techniques such as cyclic and square wave voltammetries, and potentiostatic electrolyses were used to study the co-reduction of CeF{sub 3} and SmF{sub 3} with AlF{sub 3}. For each of these elements, specific peaks of Al-Ce and Al-Sm alloys formation were observed by voltammetry as well as peaks of pure cerium and aluminium, and pure samarium and aluminium respectively. The difference of potential measured between the solvent reduction and the alloy formation suggests expecting an extraction efficiency of 99.99% of each lanthanide by the process. Different intermetallic compounds were obtained for different potentiostatic electrolysis and were characterised by Scanning Electron Microscopy with EDS probe. The validity of the process was verified by carrying out cerium and samarium extractions in the form of Al-Ln alloy; the extraction efficiency was 99.5% for Ce(III) and 99.4% for Sm(III)

  3. Dicty_cDB: SLB165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB165 (Link to dictyBase) - - - Contig-U16455-1 SLB165Z (Link... to Original site) - - SLB165Z 708 - - - - Show SLB165 Library SL (Link to library) Clone ID SLB165 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-C/SLB165Q.Seq.d/ Representative seq. ID SLB16...5Z (Link to Original site) Representative DNA sequence >SLB165 (SLB165Q) /CSM/SL/SLB1-C/SLB165Q.Seq.d/ XXXXX... Dictyostelium discoideum slug cDNA, clone SLE193. 1298 0.0 1 ( AU034146 ) Dictyostelium discoideum slug cDNA, clone SLB

  4. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  5. 40 CFR 300.165 - OSC reports.

    Science.gov (United States)

    2010-07-01

    ... Responsibility and Organization for Response § 300.165 OSC reports. (a) As requested by the NRT or RRT, the OSC/RPM shall submit to the NRT or RRT a complete report on the removal operation and the actions taken. The RRT shall review the OSC report and send to the NRT a copy of the OSC report with its comments or...

  6. X-ray Induced Luminescence Spectroscopy of Samarium Doped Barium Sulfate Prepared by Sintering Method

    Science.gov (United States)

    Kumeda, T.; Maeda, K.; Shirano, Y.; Fujiwara, K.; Sakai, K.; Ikari, T.

    2015-06-01

    X-ray induced luminescence (XL) properties of phosphor materials made of samarium doped barium sulfate have been investigated. The samples were prepared by sintering method heated at 900-1250 °C for 3 hours in air from the mixture of BaSO4 and Sm2O3. The concentration of Sm were prepared from 0.01-6 at.%. In as-prepared sample, the Sm3+ was detected by photoluminescence (PL). The PL intensity is maximum about 2 at.% with Sm, and then starts decreasing. The PL intensity showed concentration quenching. The XL observed Sm2+ and Sm3+ ions. The XL was shown from the sample sintered up to 1200 °C. The XL intensity increased with Sm concentration up to 1 at.%. The intensity was almost constant larger than 1 at.% Sm. These concentration dependences is different since the X-ray energy absorbed to the host material at once, and the energy transferred to both Sm3+ and Sm2+ ions. Sm doped BaSO4 is found a host for XL phosphor materials.

  7. High-κ Samarium-Based Metal-Organic Framework for Gate Dielectric Applications.

    Science.gov (United States)

    Pathak, Abhishek; Chiou, Guan Ru; Gade, Narsinga Rao; Usman, Muhammad; Mendiratta, Shruti; Luo, Tzuoo-Tsair; Tseng, Tien Wen; Chen, Jenq-Wei; Chen, Fu-Rong; Chen, Kuei-Hsien; Chen, Li-Chyong; Lu, Kuang-Lieh

    2017-07-05

    The self-assembly of a samarium-based metal-organic framework [Sm2(bhc)(H2O)6]n (1) in good yield was achieved by reacting Sm(NO3)3·6H2O with benzenehexacarboxylic acid (bhc) in a mixture of H2O-EtOH under hydrothermal conditions. A structural analysis showed that compound 1 crystallized in a space group of Pnmn and adopted a 3D structure with (4,8) connected nets. Temperature dependent dielectric measurements showed that compound 1 behaves as a high dielectric material with a high dielectric constant (κ = 45.1) at 5 kHz and 310 K, which is comparable to the values for some of the most commonly available dielectric inorganic metal oxides such as Sm2O3, Ta2O5, HfO2, and ZrO2. In addition, electrical measurements of 1 revealed an electrical conductivity of about 2.15 × 10-7 S/cm at a frequency of 5 kHz with a low leakage current (Ileakage = 8.13 × 10-12 Amm-2). Dielectric investigations of the Sm-based MOF provide an effective path for the development of high dielectric materials in the future.

  8. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  9. Characterization of luminescent samarium doped HfO{sub 2} coatings synthesized by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Chacon-Roa, C [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Guzman-Mendoza, J [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Aguilar-Frutis, M [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Garcia-Hipolito, M [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Alvarez-Fragoso, O [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Falcony, C [Departamento de Fisica, CINVESTAV-IPN, A. P. 14-740, 07000 Mexico D.F. (Mexico)

    2008-01-07

    Trivalent samarium (Sm{sup 3+}) doped hafnium oxide (HfO{sub 2}) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO{sub 2} monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO{sub 2} : SmCl{sub 3} films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm{sup 3+} ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed.

  10. Samarium-153 EDTMP for metastatic bone pain palliation: the impact of europium impurities.

    Science.gov (United States)

    Kalef-Ezra, J A; Valakis, S T; Pallada, S

    2015-02-01

    To evaluate the impact on the radiation protection policies of the radiocontaminants in Samarium-153 ethylenediamine tetramethylene phosphonate ((153)Sm-EDTMP). The internal contamination of patients treated with (153)Sm-EDMTP for palliation of painful disseminated multiple bone metastases due to long-lived impurities was assessed by direct measurements. These measurements were coupled with dose-rate measurements close to their bodies and spectroscopic analysis of the residual activity in post-treatment radiopharmaceutical vials. Whole-body counting carried out in six patients showed a 30-81-kBq europium -152 plus europium-154 contamination. The 0.85 mean (152)Eu- to -(154)Eu activity ratio obtained by direct counting was similar to that assessed by analysis of post-treatment residual activities in twelve radiopharmaceutical vials following radiopharmaceutical injection. The long-lived radiocontaminants in the patient's bodies and the treatment wastes require modifications of the applicable radiation protection policies. Copyright © 2014 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  11. Luminescence of trivalent samarium ions in silver and tin co-doped aluminophosphate glass

    Science.gov (United States)

    Jiménez, José A.; Lysenko, Sergiy; Liu, Huimin; Sendova, Mariana

    2011-06-01

    This work presents the spectroscopic properties of trivalent samarium ions in a melt-quenched aluminophosphate glass containing silver and tin. Addition of 4 mol% of each Ag 2O and SnO into the glass system with 2 mol% Sm 2O 3 results in Sm 3+ ions luminescence under non-resonant UV excitation owing to energy transfer from single silver ions and/or twofold-coordinated Sn centers. Assessment of luminescence spectra and decay dynamics suggest the energy transfer mechanism to be essentially of the resonant radiative type. Moreover, a connection between the luminescent and structural properties of the rare-earth doped glass system was demonstrated. Raman spectroscopy characterization revealed that no significant variation in the glass matrix is induced by Sm 3+ doping at the concentration employed. A comparison was made with a structural study performed on the Eu 3+ doped system (containing 2 mol% Eu 2O 3 along with 4 mol% of each Ag 2O and SnO) where the radiative energy transfer mechanism was previously established. The data appears consistent regarding the lack of variation in glass structure upon the Eu 3+ and Sm 3+ doping in connection with the dominance of the radiative transfer in the matrix. Thermal treatment of the material leads to precipitation of Ag nanoparticles of a broad size range inside the dielectric as observed by transmission electron microspcopy. Assessment of 4G 5/2 excited state decay in Sm 3+ ions shows no influence from the silver particles.

  12. Samarium (III) adsorption on bentonite modified with N-(2-hydroxyethyl) ethylenediamine.

    Science.gov (United States)

    Li, Dandan; Chang, Xijun; Hu, Zheng; Wang, Qihui; Li, Ruijun; Chai, Xiaoli

    2011-02-15

    A new material has been synthesized using dry process to activate bentonite followed by N-(2-hydroxyethyl) ethylenediamine connecting chlorosilane coupling agent. The synthesized new material was characterized by elemental analysis, FT-IR and thermogravimetry which proved that bentonite was successfully modified. The most interesting trait of the new material was its selective adsorption for rare earth elements. A variety of conditions of the new material were investigated for adsorption. The optimal conditions were determined with respect to pH and shaking time. Samarium (Sm) was quantitatively adsorbed at pH 4 and shaking time of 2 min onto the new material. Under these conditions the maximum static adsorption capacity of Sm(III) was found to be 17.7 mg g(-1). The adsorbed Sm(III) ion were quantitatively eluted by 2.0 mL 0.1 mol L(-1) HCl and 5% CS (NH(2))(2) solution. According to IUPAC definition, the detection limit (3σ) of this method was 0.60 ng mL(-1). The relative standard deviation (RSD) under optimum conditions was less than 3% (n=8). The new material also was applied for the preconcentration of trace Sm(III) in environmental samples with satisfactory results. Copyright © 2010 Elsevier B.V. All rights reserved.

  13. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  14. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Science.gov (United States)

    Mandiwana, Vusani; Kalombo, Lonji; Venter, Kobus; Sathekge, Mike; Grobler, Anne; Zeevaart, Jan Rijn

    2015-09-01

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly( d, l-lactide- co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([153Sm]Sm2O3) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive 153Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The 153Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [153Sm]Sm2O3 loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [153Sm]Sm2O3-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  15. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  16. 26 CFR 1.165-6 - Farming losses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Farming losses. 1.165-6 Section 1.165-6 Internal... TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.165-6 Farming losses. (a... sustains a loss from the operation of the farming business, then the amount of loss sustained in the...

  17. 22 CFR 16.5 - Relationship to other remedies.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Relationship to other remedies. 16.5 Section 16.5 Foreign Relations DEPARTMENT OF STATE PERSONNEL FOREIGN SERVICE GRIEVANCE SYSTEM § 16.5 Relationship to other remedies. (a) A grievant may not file a grievance under these procedures if the grievant...

  18. 7 CFR 1427.165 - Eligible seed cotton.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible seed cotton. 1427.165 Section 1427.165... OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COTTON Recourse Seed Cotton Loans § 1427.165 Eligible seed cotton. (a) Seed cotton pledged as collateral for a loan must be tendered to CCC by an...

  19. 49 CFR 37.165 - Lift and securement use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Lift and securement use. 37.165 Section 37.165... DISABILITIES (ADA) Provision of Service § 37.165 Lift and securement use. (a) This section applies to public... with disabilities with the use of securement systems, ramps and lifts. If it is necessary for the...

  20. 40 CFR 159.165 - Toxicological and ecological studies.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Toxicological and ecological studies. 159.165 Section 159.165 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS STATEMENTS OF POLICIES AND INTERPRETATIONS Reporting Requirements for Risk/Benefit Information § 159.165 Toxicological and ecological...

  1. 26 CFR 1.165-3 - Demolition of buildings.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Demolition of buildings. 1.165-3 Section 1.165-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.165-3 Demolition of buildings. (a) Intent to demolish formed...

  2. 38 CFR 17.165 - Emergency outpatient dental treatment.

    Science.gov (United States)

    2010-07-01

    ... for outpatient dental care, the treatment will be restricted to the alleviation of pain or extreme... dental treatment. 17.165 Section 17.165 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.165 Emergency outpatient dental treatment. When outpatient emergency...

  3. 26 CFR 1.165-5 - Worthless securities.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Worthless securities. 1.165-5 Section 1.165-5... securities. (a) Definition of security. As used in section 165(g) and this section, the term “security” means.... (b) Ordinary loss. If any security which is not a capital asset becomes wholly worthless during the...

  4. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 keV. This...

  5. Optical response and magnetic characteristic of samarium doped zinc phosphate glasses containing nickel nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Azmi, Siti Amlah M.; Sahar, M.R., E-mail: mrahim057@gmail.com

    2015-11-01

    A magnetic glass of composition 40ZnO–(58−x) P{sub 2}O{sub 5}–1Sm{sub 2}O{sub 3}–xNiO, with x=0.0, 1.0, 1.5 and 2.0 mol% is prepared by melt-quenching technique. The glass is characterized by X-ray diffraction, high-resolution transmission electron microscope (HRTEM), photoluminescence (PL) spectroscopy and vibrating sample magnetometer (VSM) analysis. The X-rays diffraction confirms the amorphous nature of the glass while the HRTEM analysis reveals the presence of nickel nanoparticles in the glass samples. High-resolution TEM reveals that the lattice spacing of nickel nanoparticles is 0.35 nm at (100) plane. Photoluminescence emission shows the existence of four peaks that correspond to the transition from the upper level of {sup 4}G{sub 5/2} to the lower level of {sup 6}H{sub 5/2}, {sup 6}H{sub 7/2}, {sup 6}H{sub 9/2,} and {sup 6}H{sub 11/2.} It is observed that all peaks experience significant quenching effect with the increasing concentration of nickel nanoparticles, suggesting a strong energy transfer from excited samarium ions to the nickel ions. The glass magnetization and susceptibility at 12 kOe at room temperature are found to be in the range of (3.87±0.17×10{sup −2}–7.19±0.39×10{sup −2}) emu/g and (3.24±0.16×10{sup −6}–5.99±0.29×10{sup −6}) emu/Oe g respectively. The obtained hysteresis curve indicates that the glass samples are paramagnetic materials. The studied glass can be further used towards the development of magneto-optical functional glass. - Highlights: • Sm{sup 3+} doped zinc phosphate glass embedded with Ni NPs has been prepared. • The Laue pattern and lattice spacing of Ni NPs are confirmed by HRTEM image. • The magnetic response of glasses has been studied through VSM analysis. • Enhancement factor and decay half-lifetime are investigated.

  6. Treatment of bone pain secondary to metastases using samarium-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Elba Cristina Sá de Camargo Etchebehere

    Full Text Available CONTEXT: More than 50% of patients with prostate, breast or lung cancer will develop painful bone metastases. The purpose of treating bone metastases is to relieve pain, reduce the use of steroids and to maintain motion. OBJECTIVE: To evaluate the use of samarium-153-EDTMP (153Sm-EDTMP for the treatment of bone pain secondary to metastases that is refractory to clinical management. TYPE OF STUDY: Retrospective. SETTING: Division of Nuclear Medicine, Universidade Estadual de Campinas (Unicamp. METHODS: Fifty-eight patients were studied (34 males with mean age 62 years; 31 patients had prostate cancer, 20 had breast cancer, three had lung cancer, one had lung hemangioendothelioma, one had parathyroid adenocarcinoma, one had osteosarcoma and one had an unknown primary tumor. All patients had multiple bone metastases demonstrated by bone scintigraphy using 99mTc-MDP,and were treated with 153Sm-EDTMP. Response to treatment was graded as good (pain reduction of 50-100%, intermediate (25-49% and poor (0-24%. RESULTS: All patients showed good uptake of 153Sm-EDTMP by bone metastases. Among the patients with prostate cancer, intermediate or good response to therapy occurred in 80.6% (25 patients and poor response in 19.4% (6. Among the patients with breast cancer, 85% (17 showed intermediate or good response to therapy while 15% (3 showed poor response. All three patients with lung cancer showed poor response to treatment. The lung hemangioendothelioma and unknown primary lesion patients showed intermediate response to treatment; the osteosarcoma and parathyroid adenocarcinoma patients showed good response to treatment. No significant myelotoxicity occurred. DISCUSSION: Pain control is important for improving the quality of life of patients with advanced cancers. The mechanism by which pain is relieved with the use of radionuclides is still not yet completely understood, however, the treatment is simple and provides a low risk of mielotoxicity

  7. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  8. Effect of Current Density on Thermodynamic Properties of Nanocrystalline Palladium Capped Samarium Hydride Thin Film Switchable Mirrors

    Directory of Open Access Journals (Sweden)

    Pushpendra Kumar

    2007-01-01

    Full Text Available A 55 nm samarium film capped with a 10 nm palladium overlayer switched from a metallic reflecting to a semiconducting, transparent in visible state during ex-situ hydrogen loading via electrochemical means in 1 M KOH electrolytic aqueous solution at room temperature. The switching between metal to semiconductor was accompanied by measurement of transmittance during hydrogen loading/unloading. The effect of current density on switching and thermodynamic properties was studied between dihydride state (FCC phase and trihydride state (hexagonal phase. From the plateau of partial pressure of hydrogen at x=2.6, enthalpy of formation was calculated at different current densities. The diffusion coefficients and switching kinetics are shown to depend on applied current density.

  9. Targeted bone marrow radioablation with 153Samarium-lexidronam promotes allogeneic hematopoietic chimerism and donor-specific immunologic hyporesponsiveness.

    Science.gov (United States)

    Inverardi, Luca; Linetsky, Elina; Pileggi, Antonello; Molano, R Damaris; Serafini, Aldo; Paganelli, Giovanni; Ricordi, Camillo

    2004-03-15

    Transplantation tolerance, defined as acceptance of a graft by an otherwise fully immunocompetent host, has been an elusive goal. Although robust tolerance has been achieved by the induction of stable hematopoietic chimerism after bone marrow transplantation, lethal or sublethal radiation conditioning used to induce long-term chimerism precludes its clinical use. We studied whether targeted delivery of radiation to bone marrow could allow for bone marrow cell (BMC) engraftment, chimerism, and donor-specific tolerance in the absence of the side effects associated with external irradiation. We administered a radioactive bone-seeking compound (Samarium-Lexidronam, Quadramet, Berlex Laboratories, Wayne, NJ) together with transient T-cell costimulatory blockade to recipient mice. Allogeneic BMCs were given 7 or 14 days after preconditioning. Costimulatory blockade was obtained by the use of an anti-CD154 antibody for 4 weeks. Chimerism was assessed by flow cytometry. Mice then received donor-specific and third-party skin grafts. Graft survival was analyzed with mechanisms of donor-specific hyporesponsiveness. High levels of stable chimerism across an allogeneic barrier were achieved in mice by a single administration of Samarium-Lexidronam, transient T-cell costimulatory blockade, and BMC transplantation. A large percentage of chimeric animals retained donor-derived skin grafts for more than 120 days without requiring additional immunosuppression, suggesting that harsh cytotoxic preconditioning is not necessary to achieve stable chimerism and donor specific hyporesponsiveness. Analysis of the T-cell repertoire in chimeras indicates T-cell deletional mechanisms. These data broaden the potential use of BMC transplantation for tolerance induction and argue for its potential in treating autoimmune diseases.

  10. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  11. 14 CFR 125.165 - Extinguishing agent container pressure relief.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Extinguishing agent container pressure relief. 125.165 Section 125.165 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS...

  12. 47 CFR 90.165 - Procedures for mutually exclusive applications.

    Science.gov (United States)

    2010-10-01

    .... 90.165 Section 90.165 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... one-day filing window, the two dates are the same. The dates are made known to the public in advance... grant, pursuant to § 1.935 of this chapter. (1) Selection methods. In selecting the application to grant...

  13. 33 CFR 165.1309 - Eagle Harbor, Bainbridge Island, WA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Eagle Harbor, Bainbridge Island, WA. 165.1309 Section 165.1309 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Eagle Harbor, Bainbridge Island, WA. (a) Regulated area. A regulated navigation area is established on...

  14. 33 CFR 165.1408 - Security Zones; Maui, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Maui, HI. 165... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1408 Security Zones; Maui, HI... Harbor, Maui, HI or within 3 nautical miles seaward of the Kahului Harbor COLREGS DEMARCATION (See 33 CFR...

  15. 33 CFR 165.1407 - Security Zones; Oahu, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Oahu, HI. 165... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1407 Security Zones; Oahu, HI... defined in 33 CFR 110.235(a). (3) Kalihi Channel and Keehi Lagoon, Oahu. All waters of Kalihi Channel and...

  16. Crystal growth of semiorganic complex- samarium chloride coordinated thiourea-L-tartaric acid and its studies on structure and optical characteristics

    Science.gov (United States)

    Slathia, Goldy; Singh, Harjinder; Ramya, E.; Rao, D. Narayana; Bamzai, K. K.

    2017-05-01

    The semi-organic complex of samarium chloride coordinated thiourea-L-tartaric acid (SCTLT) has been grown as a single crystal by slow evaporation technique at room temperature. For structural studies, the grown crystal was subjected to single crystal X-ray diffraction and Fourier transform infra-red (FTIR) spectroscopy. Low cut off wavelength and transparent characteristics were explored by UV-VIS optical characterization. Third-order nonlinear optical properties of grown crystal were investigated by Z-scan technique.

  17. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J.C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  18. Trace amounts of rare earth elements in high purity samarium oxide by sector field inductively coupled plasma mass spectrometry after separation by HPLC

    Energy Technology Data Exchange (ETDEWEB)

    Pedreira, W.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil) and Fundacao Jorge Duprat Figueiredo de Seguranca e Medicina do Trabalho (FUNDACENTRO), 05409-002 Sao Paulo, SP (Brazil)]. E-mail: walter.pedreira@fundacentro.gov.br; Queiroz, C.A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Abrao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Rocha, S.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Vasconcellos, M.E. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Boaventura, G.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil); Pimentel, M.M. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil)

    2006-07-20

    Today there is an increasing need for high purity rare earth compounds in various fields, the optical, the electronics, the ceramic, the nuclear and geochemistry. Samarium oxide has special uses in glass, phosphors, lasers and thermoelectric devices. Calcium chloride crystals treated with samarium have been employed in lasers, which produce light beams intense enough to burn metal. In general, the inductively coupled plasma mass spectrometry (ICP-MS) presents some advantages for trace element analysis, due to high sensitivity and resolution, when compared with other analytical techniques such as ICP optical emission spectrometry (ICP-OES). In this work, sector field inductively coupled plasma mass spectrometry was used. Sixteen elements (Sc, Y and 14 lanthanides) were determined selectively with the ICP-MS system using a concentration gradient method. The detection limits with the ICP-MS system were about 0.2 (La) pg mL{sup -1} to 8 (Gd) pg mL{sup -1}. The %R.S.D. of the methods varying between 0.9 and 1.5% for a set of five (n = 5) replicates was found for the IPEN's material and for the certificate reference sample. Determination of trace REEs in two high pure samarium oxides samples (IPEN and JMC) was performed. IPEN's material is highly pure (>99.99%) and was successfully analyzed without spectral interference (MO{sup +} and MOH{sup +})

  19. 47 CFR 80.165 - Operator requirements for voluntary stations.

    Science.gov (United States)

    2010-10-01

    ... Requirements § 80.165 Operator requirements for voluntary stations. Minimum Operator License Ship Morse telegraph T-2. Ship direct-printing telegraph MP. Ship telephone, with or without DSC, more than 250 watts...

  20. Effectiveness of radiation synovectomy with samarium-{sup 153} particulate hydroxyapatite in rheumatoid arthritis patients with knee synovitis: a controlled randomized double-blind trial

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Marla Francisca dos; Furtado, Rita Nely Vilar; Konai, Monique Sayuri; Natour, Jamil, E-mail: jnatour@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Reumatologia; Castiglioni, Mario Luiz Vieira; Marchetti, Renata Rosa [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Medicina Nuclear

    2009-07-01

    Objectives: the aim of the present study was to investigate the effectiveness of Samarium{sup 153}-particulate hydroxyapatite radiation synovectomy in rheumatoid arthritis patients with chronic knee synovitis. Methods: fifty-eight rheumatoid arthritis patients (60 knees) with chronic knee synovitis participated in a controlled double-blinded trial. Patients were randomized to receive either an intra-articular injection with 40 mg triamcinolone hexacetonide alone (TH group) or 40 mg triamcinolone hexacetonide combined with 15 mCi Samarium{sup 153}-particulate hydroxyapatite (Sm/TH group). Blinded examination at baseline (T0) and at 1 (T1), 4 (T4), 12 (T12), 32 (T32), and 48 (T48) weeks post-intervention were performed on all patients and included a visual analog scale for joint pain and swelling as well as data on morning stiffness, flexion, extension, knee circumference, Likert scale of improvement, percentage of improvement, SF-36 generic quality of life questionnaire, Stanford Health Assessment Questionnaire (HAQ), Lequesne index, use of non-steroidal anti-inflammatory drugs or oral corticosteroids, events and adverse effects, calls to the physician, and hospital visits. Results: the sample was homogeneous at baseline, and there were no withdrawals. Improvement was observed in both groups in relation to T0, but no statistically significant differences between groups were observed regarding all variables at the time points studied. The Sm/TH group exhibited more adverse effects at T1 (p<0.05), but these were mild and transitory. No severe adverse effects were reported during follow-up. Conclusion: intra-articular injection of Samarium{sup 153}-particulate hydroxyapatite (15 mCi) with 40 mg of triamcinolone hexacetonide is not superior to triamcinolone hexacetonide alone for the treatment of knee synovitis in patients with rheumatoid arthritis at 1 y of follow-up. (author)

  1. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  2. Synthesis of the human VEGF165 gene based on overlap PCR and ...

    African Journals Online (AJOL)

    Yomi

    2012-01-16

    Jan 16, 2012 ... human VEGF165 (hVEGF165) gene based on overlap PCR method and recombinant expressed in Chinese's hamster ovary (CHO) ... recombinant human VEGF165 (rhVEGF165) protein in CHO cells. Key words: Overlap .... Stable transfected positive clones appeared after 14 days when the. CHO cells not ...

  3. 33 CFR 165.1191 - Safety zones: Northern California annual fireworks events.

    Science.gov (United States)

    2010-07-01

    ... annual fireworks events. 165.1191 Section 165.1191 Navigation and Navigable Waters COAST GUARD... § 165.1191 Safety zones: Northern California annual fireworks events. (a) General. Safety zones are... § 165.1191 KFOG KaBoom Sponsor KFOG Radio, San Francisco. Event Description Fireworks display. Date Last...

  4. Neutron Activated Samarium-153 Microparticles for Transarterial Radioembolization of Liver Tumour with Post-Procedure Imaging Capabilities

    Science.gov (United States)

    Hashikin, Nurul Ab. Aziz; Yeong, Chai-Hong; Abdullah, Basri Johan Jeet; Ng, Kwan-Hoong; Chung, Lip-Yong; Dahalan, Rehir; Perkins, Alan Christopher

    2015-01-01

    Introduction Samarium-153 (153Sm) styrene divinylbenzene microparticles were developed as a surrogate for Yttrium-90 (90Y) microspheres in liver radioembolization therapy. Unlike the pure beta emitter 90Y, 153Sm possess both therapeutic beta and diagnostic gamma radiations, making it possible for post-procedure imaging following therapy. Methods The microparticles were prepared using commercially available cation exchange resin, Amberlite IR-120 H+ (620–830 μm), which were reduced to 20–40 μm via ball mill grinding and sieve separation. The microparticles were labelled with 152Sm via ion exchange process with 152SmCl3, prior to neutron activation to produce radioactive 153Sm through 152Sm(n,γ)153Sm reaction. Therapeutic activity of 3 GBq was referred based on the recommended activity used in 90Y-microspheres therapy. The samples were irradiated in 1.494 x 1012 n.cm-2.s-1 neutron flux for 6 h to achieve the nominal activity of 3.1 GBq.g-1. Physicochemical characterisation of the microparticles, gamma spectrometry, and in vitro radiolabelling studies were carried out to study the performance and stability of the microparticles. Results Fourier Transform Infrared (FTIR) spectroscopy of the Amberlite IR-120 resins showed unaffected functional groups, following size reduction of the beads. However, as shown by the electron microscope, the microparticles were irregular in shape. The radioactivity achieved after 6 h neutron activation was 3.104 ± 0.029 GBq. The specific activity per microparticle was 53.855 ± 0.503 Bq. Gamma spectrometry and elemental analysis showed no radioactive impurities in the samples. Radiolabelling efficiencies of 153Sm-Amberlite in distilled water and blood plasma over 48 h were excellent and higher than 95%. Conclusion The laboratory work revealed that the 153Sm-Amberlite microparticles demonstrated superior characteristics for potential use in hepatic radioembolization. PMID:26382059

  5. Phenotype abnormality: 165 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 165 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u671i decreased efficiency... in organ named whole plant during process named auxin transport ... whole plant ... decreased efficiency ...

  6. 20 CFR 401.165 - Statistical and research activities.

    Science.gov (United States)

    2010-04-01

    ...-maintenance or health-maintenance programs; or is used for research that is of importance to the Social Security program or the Social Security beneficiaries; or an epidemiological research project that relates... Section 401.165 Employees' Benefits SOCIAL SECURITY ADMINISTRATION PRIVACY AND DISCLOSURE OF OFFICIAL...

  7. 21 CFR 516.165 - Records and reports.

    Science.gov (United States)

    2010-04-01

    ... DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.165 Records and reports. (a) Scope and purpose... local FDA resident post of any product or manufacturing defects that may result in serious adverse drug...

  8. 40 CFR 763.165 - Manufacture and importation prohibitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Manufacture and importation...) TOXIC SUBSTANCES CONTROL ACT ASBESTOS Prohibition of the Manufacture, Importation, Processing, and Distribution in Commerce of Certain Asbestos-Containing Products; Labeling Requirements § 763.165 Manufacture...

  9. Image collection: 165 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 165 Trichosurus_vulpecula_NL.png フクロギツネ Trichosurus vulpecula Trichosurus vulpecula 9337 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,後獣下綱,

  10. 46 CFR 67.165 - Deposit of Certificate of Documentation.

    Science.gov (United States)

    2010-10-01

    ... National Vessel Documentation Center when: (1) Exchange of the Certificate is required upon the occurrence... 46 Shipping 2 2010-10-01 2010-10-01 false Deposit of Certificate of Documentation. 67.165 Section... MEASUREMENT OF VESSELS DOCUMENTATION OF VESSELS Validity of Certificates of Documentation; Renewal of...

  11. 33 CFR 165.1409 - Security Zones; Hawaii, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Hawaii, HI. 165..., HI. (a) Location. The following areas, from the surface of the water to the ocean floor, are security..., Hawaii, HI or within 3 nautical miles seaward of the Hilo Harbor COLREGS DEMARCATION (See 33 CFR 80.1480...

  12. 33 CFR 165.1410 - Security Zones; Kauai, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Kauai, HI. 165..., HI. (a) Location. The following areas, from the surface of the water to the ocean floor, are security... Nawiliwili Harbor, Kauai, HI or within 3 nautical miles seaward of the Nawiliwili Harbor COLREGS DEMARCATION...

  13. 14 CFR 21.165 - Responsibility of holder.

    Science.gov (United States)

    2010-01-01

    ... manual describing its quality system to the FAA for approval. The manual must be in the English language... Inspections and tests. Each applicant for or holder of a production certificate must allow the FAA to inspect... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS Production Certificates § 21.165 Responsibility of holder. The...

  14. 21 CFR 211.165 - Testing and release for distribution.

    Science.gov (United States)

    2010-04-01

    ... Section 211.165 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES..., including the identity and strength of each active ingredient, prior to release. Where sterility and/or... released prior to completion of sterility and/or pyrogen testing, provided such testing is completed as...

  15. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  16. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  17. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints.

    Science.gov (United States)

    Najeeb Al Hallak, Mohammed; McCurdy, Matt; Zouain, Nicolas; Hayes, Justin

    2009-08-28

    (153)Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate) and Samarium-153 [1]. (153)Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of (153)Sm-EDTMP leads to contamination with (154)Eu (Europium-154) [2]. A previous study only alluded to the retention of (154)Eu in the bones after receiving treatment with (153)Sm-EDTMP [2]. Activation of the alarm at security checkpoints after (153)Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received (153)Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA) activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing the American-Canadian border. We assume that the (154)Eu which remained in the patients' bones activated the sensors. METHODS: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received (153)Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. RESULTS: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of (154)Eu emissions. CONCLUSION: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of (154)Eu retained in patients who received (153)Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of (153)Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with (153)Sm-EDTMP at Roger Maris Cancer

  18. Investigation of Antiangiogenic Tumor Therapy Potential of Microencapsulated HEK293 VEGF165b Producing Cells

    Directory of Open Access Journals (Sweden)

    Fatemeh Afkhami

    2010-01-01

    encapsulated and non-encapsulated cells was similar. The effect of VEGF165b harvested from encapsulated cells on Human Umbilical Vein Endothelial cells (HUVECs proliferation were also examined.The same inhibitory effects on HUVECs proliferation was seen when the cells were incubated with a mixture of VEGF165b and a 2-fold VEGF165b or with VEGF165b and 2-fold excess VEGF165b released from encapsulated cells. Subcutaneous injection of microencapsulated VEGF165b producing cells in tumor site of nude mice resulted in the reduction of the number of vessels around the tumors.

  19. A new solar reference spectrum from 165 to 3088 nm

    Science.gov (United States)

    Damé, Luc; Meftah, Mustapha; Bolsée, David; Pereira, Nuno; Bekki, Slimane; Hauchecorne, Alain; Irbah, Abdenour; Cessateur, Gaël; Sluse, Dominique

    2017-04-01

    Since April 5, 2008 and until February 15, 2017 the SOLAR/SOLSPEC spectro-radiometer on the International Space Station performed accurate measurements of Solar Spectral Irradiance (SSI) from the far ultraviolet to the infrared (165 nm to 3088 nm). These measurements are of primary importance for a better understanding of solar physics and of the impact of solar variability on climate (via Earth's atmospheric photochemistry). In particular, a new reference solar spectrum is established covering most of the unusual solar cycle 24 from minimum in 2008 to maximum. Temporal variability in the UV (165 to 400 nm) is presented in several wavelengths bands. These results are possible thanks to revised engineering corrections, improved calibrations and new procedures to account for thermal and aging advanced corrections. Uncertainties on these measurements are evaluated and compare favorably with other instruments.

  20. Identical gamma-vibrational bands in {sup 165}Ho

    Energy Technology Data Exchange (ETDEWEB)

    Radford, D.C.; Galindo-Uribarri, A.; Janzen, V.P. [Chalk River Labs., Ontario (Canada)] [and others

    1996-12-31

    The structure of {sup 165}Ho at moderate spins has been investigated by means of Coulomb excitation. Two {gamma}-vibrational bands (K{sup {pi}} = 11/2{sup {minus}} and K{sup {pi}} = 3/2{sup {minus}}) are observed, with very nearly identical in-band {gamma}-ray energies. Gamma-ray branching ratios are analyzed to extract information on Coriolis mixing, and the role of the K quantum number in identical bands is discussed.

  1. Formation of a new adduct based on fullerene tris-malonate samarium salt C60-[C60(=C(COO)2)3]Sm2

    Science.gov (United States)

    Petrov, A. A.; Keskinov, V. A.; Semenov, K. N.; Charykov, N. A.; Letenko, D. G.; Nikitin, V. A.

    2017-03-01

    Gram quantities of a new adduct based on light fullerene tris-malonate samarium salt C60 [C60(=C(COO)2)3]Sm2 are obtained via the reaction of ion exchange. The obtained adduct is studied by means of electron and infrared spectroscopy, X-ray and elemental analysis, electron microscopy, and thermogravimetry. The polythermal solubility of [C60(=C(COO)2)3]Sm2 in water is determined in ampoules via saturation within 20-70°C. The composition of crystalline hydrate [C60(=C(COO)2)3]Sm2 · 36H2O, which exists in equilibrium with the saturated solution, is estimated.

  2. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  3. 33 CFR 165.1155 - Security Zone; Diablo Canyon Nuclear Power Plant, Avila Beach, California.

    Science.gov (United States)

    2010-07-01

    ... Nuclear Power Plant, Avila Beach, California. 165.1155 Section 165.1155 Navigation and Navigable Waters... Coast Guard District § 165.1155 Security Zone; Diablo Canyon Nuclear Power Plant, Avila Beach... surface to bottom, within a 2,000 yard radius of Diablo Canyon Nuclear Power Plant centered at position 35...

  4. 33 CFR 165.166 - Safety Zone: Macy's July 4th Fireworks, East River, NY.

    Science.gov (United States)

    2010-07-01

    ... Fireworks, East River, NY. 165.166 Section 165.166 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.166 Safety Zone: Macy's July 4th Fireworks, East River, NY. (a) Regulated area. The following area...) in length, carrying persons for the purpose of viewing the fireworks, may take position in an area...

  5. 33 CFR 165.162 - Safety Zone: New York Super Boat Race, Hudson River, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: New York Super Boat Race, Hudson River, New York. 165.162 Section 165.162 Navigation and Navigable Waters COAST GUARD... § 165.162 Safety Zone: New York Super Boat Race, Hudson River, New York. (a) Regulated area. The...

  6. 33 CFR 165.1314 - Safety Zone; Fort Vancouver Fireworks Display, Columbia River, Vancouver, Washington.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Fort Vancouver Fireworks Display, Columbia River, Vancouver, Washington. 165.1314 Section 165.1314 Navigation and Navigable... Thirteenth Coast Guard District § 165.1314 Safety Zone; Fort Vancouver Fireworks Display, Columbia River...

  7. 40 CFR 7.165 - Special benefits for children and the elderly.

    Science.gov (United States)

    2010-07-01

    ... elderly. 7.165 Section 7.165 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL... Discrimination Prohibited on the Basis of Age § 7.165 Special benefits for children and the elderly. If a recipient operating a program which serves the elderly or children in addition to persons of other ages...

  8. 33 CFR 165.104 - Safety Zone: Vessel Launches, Bath Iron Works, Kennebec River, Bath, Maine.

    Science.gov (United States)

    2010-07-01

    ... Guard District § 165.104 Safety Zone: Vessel Launches, Bath Iron Works, Kennebec River, Bath, Maine. (a... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: Vessel Launches, Bath Iron Works, Kennebec River, Bath, Maine. 165.104 Section 165.104 Navigation and Navigable Waters...

  9. 26 CFR 1.165-4 - Decline in value of stock.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Decline in value of stock. 1.165-4 Section 1.165... in value of stock. (a) Deduction disallowed. No deduction shall be allowed under section 165(a) solely on account of a decline in the value of stock owned by the taxpayer when the decline is due to a...

  10. 9 CFR 381.165 - “(Kind) barbecued prepared with moist heat.”

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false â(Kind) barbecued prepared with moist heat.â 381.165 Section 381.165 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Standards of Identity or Composition § 381.165 “(Kind) barbecued prepared with moist heat.” Such product...

  11. 33 CFR 165.503 - Security Zone; Captain of the Port Hampton Roads Zone.

    Science.gov (United States)

    2010-07-01

    ... § 165.503 Security Zone; Captain of the Port Hampton Roads Zone. (a) Definitions. As used in this... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Captain of the Port Hampton Roads Zone. 165.503 Section 165.503 Navigation and Navigable Waters COAST GUARD...

  12. 33 CFR 165.530 - Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC. 165.530 Section 165.530 Navigation and Navigable Waters COAST GUARD... § 165.530 Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC. (a) Location. The following area is...

  13. 33 CFR 165.835 - Security Zone; Port of Mobile, Mobile Ship Channel, Mobile, AL.

    Science.gov (United States)

    2010-07-01

    ..., Mobile Ship Channel, Mobile, AL. 165.835 Section 165.835 Navigation and Navigable Waters COAST GUARD... § 165.835 Security Zone; Port of Mobile, Mobile Ship Channel, Mobile, AL. (a) Definition. As used in... following areas are security zones: all waters of the Port of Mobile and Mobile Ship Channel— (1) Within 100...

  14. 33 CFR 165.805 - Security Zones; Calcasieu River and Ship Channel, Louisiana.

    Science.gov (United States)

    2010-07-01

    ... and Ship Channel, Louisiana. 165.805 Section 165.805 Navigation and Navigable Waters COAST GUARD... § 165.805 Security Zones; Calcasieu River and Ship Channel, Louisiana. (a) Location. (1) The following... waters and extending channel edge to channel edge on the Calcasieu Channel and shoreline to shoreline on...

  15. 33 CFR 165.115 - Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth, Massachusetts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth, Massachusetts. 165.115 Section 165.115 Navigation and Navigable... Coast Guard District § 165.115 Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth...

  16. Marrow irradiation with high-dose 153Samarium-EDTMP followed by chemotherapy and hematopoietic stem cell infusion for acute myelogenous leukemia.

    Science.gov (United States)

    Rodriguez, Vilmarie; Anderson, Peter M; Litzow, Mark R; Erlandson, Linda; Trotz, Barbara A; Arndt, Carola A S; Khan, Shakila P; Wiseman, Gregory A

    2006-08-01

    In four patients, aged 15 - 20 years, with high-risk acute myeloid leukemia (AML), high-dose samarium 153-labelled ethylenediaminetetramethylenephosphonate (153Sm-EDTMP) was used for targeted marrow irradiation before preparative chemotherapy conditioning regimens and allogeneic (three patients) or autologous (one patient) hematopoietic stem cell transplantation. The dose of 153Sm-EDTMP was 703 MBq/kg (n = 1) or 1110 MBq/kg (n = 3). No side-effects occurred during the 30-min infusion of 153Sm-EDTMP. Samarium - melphalan regimens were given to three patients; one had 153Sm-EDTMP - busulfan + cyclophosphamide. Total body radioactivity was below the 133 MBq safe limit before infusion of stem cells (day 14 after 153Sm-EDTMP). No hemorrhagic cystitis, nephrotoxicity or serious infections occurred. Leukocyte engraftment (white blood cell count >0.5 x 10(9)/l) occurred between 12 and 23 days after stem cell infusion (mean of 17 days). Complete cytogenetic and morphologic remission of AML was evident on follow-up marrow aspirate and biopsy specimens from all patients. In two of the four study patients, the disease remains in complete remission and the patients have an excellent quality of life (Eastern Cooperative Oncology Group performance status 0; no medications) and no organ toxicity more than 2 years and more than 4 years, respectively, after their blood and bone marrow transplantations. Thus, in adolescents and adults, 153Sm-EDTMP may provide a relatively simple and effective means for using irradiation to eliminate AML within the marrow.

  17. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  18. 33 CFR 165.168 - Safety Zones; Coast Guard Captain of the Port New York Fireworks Displays.

    Science.gov (United States)

    2010-07-01

    ... of the Port New York Fireworks Displays. 165.168 Section 165.168 Navigation and Navigable Waters... Guard District § 165.168 Safety Zones; Coast Guard Captain of the Port New York Fireworks Displays. (a... Upper New York Bay within a 360-yard radius of the fireworks barge in approximate position 40°41′16.5″ N...

  19. Pyrolysis result of polyethylene waste as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-02-01

    In this research, the result of pyrolysis on polyethylene was used as fuel for a solid oxide fuel cell (SOFC). The pyrolysis result is a liquid which consists of hydrocarbon chains. According to GC-MS analysis, the hydrocarbons mainly consist of C7 to C20 hydrocarbon chain. Then, the liquid was applied to a single cell of NSDC-L | NSDC | NSDC-L. NSDC is a composite SDC (samarium doped-ceria) with sodium carbonate. Meanwhile, NSDC-L is a composite of NSDC with LiNiCuO (LNC). NSDC and LNC were analyzed by X-ray diffraction to understand their crystal structure. The result shows that presence of carbonate did not change the crystal structure of SDC. SEM EDX analysis for fuel cell before and after being loaded with polyethylene oil to get information of element diffusion to the electrolyte. Meanwhile, the conductivity properties were investigated through impedance measurement. The presence of carbonate even increases the electrical conductivity. The single cell test with the pyrolysis result of polyethylene at 300 - 600 °C, found that the highest power density is at 600 °C with the maximum power density of 0.14 mW/cm2 and open circuit voltage of 0.4 Volt. Elemental analysis at three point spots of single cell NDSC-L |NSDC|NSDC-L found that a migration of ions was occurred during fuel operation at 300 - 600 °C.

  20. Effects of some rare earth and carbonate-based co-dopants on structural and electrical properties of samarium doped ceria (SDC) electrolytes for solid oxide fuel cells

    Science.gov (United States)

    Anwar, Mustafa; Khan, Zuhair S.; Mustafa, Kamal; Rana, Akmal

    2015-09-01

    In the present study, samarium doped ceria (SDC) and SDC-based composite with the addition of K2CO3 were prepared by co-precipitation route and effects of pH of the solution and calcination temperature on microstructure of SDC and SDC-K2CO3, respectively, were investigated. Furthermore, experimentation was performed to investigate into the ionic conductivity of pure SDC by co-doping with yttrium i.e., YSDC, XRD and SEM studies show that the crystallite size and particle size of SDC increases with the increase in pH. The SEM images of all the samples of SDC synthesized at different pH values showed the irregular shaped and dispersed particles. SDC-K2CO3 was calcined at 600∘C, 700∘C and 800∘C for 4 h and XRD results showed that crystallite size increases while lattice strain, decreases with the increase in calcination temperature and no peaks were detected for K2CO3 as it is present in an amorphous form. The ionic conductivity of the electrolytes increases with the increase in temperature and SDC-K2CO3 shows the highest value of ionic conductivity as compared to SDC and YSDC. Chemical compatibility tests were performed between the co-doped electrolyte and lithiated NiO cathode at high temperature. It revealed that the couple could be used up to the temperature of 700∘C.

  1. Calculation of the Dose of Samarium-153-Ethylene Diamine Tetramethylene Phosphonate (153Sm-EDTMP as a Radiopharmaceutical for Pain Relief of bone Metastasis

    Directory of Open Access Journals (Sweden)

    Fatemeh Razghandi

    2016-04-01

    Full Text Available Introduction One of the important applications of nuclear physics in medicine is the use of radioactive elements as radiopharmaceuticals. Metastatic bone disease is the most common form of malignant bone tumors. Samarium-153-ethylene diamine tetramethylene phosphonate (153Sm-EDTMP as a radiopharmaceutical is used for pain palliation. This radiopharmaceutical usually emits beta particles, which have a high uptake in bone tissues. The purpose of this study was to calculate the radiation dose distribution of 153Sm-EDTMP in bone and other tissues, using MCNPX Monte Carlo code in the particle transport model. Materials and Methods Dose delivery to the bone was simulated by seeking radiopharmaceuticals on the bone surface. The phantom model had a simple cylindrical geometry and included bone, bone marrow, and soft tissue. Results The simulation results showed that a significant amount of radiation dose was delivered to the bone by the use of this radiopharmaceutical. Conclusion Thebone acted as a fine protective shield against rays for the bone marrow. Therefore, the trivial absorbed dose by the bone marrow caused less damage to bone-making cells. Also, the high absorbed dose of the bone could destroy cancer cells and relieve the pain in the bone.

  2. Synthesis, quality control and biological evaluation of tris[(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate complex as a therapeutic agent

    Energy Technology Data Exchange (ETDEWEB)

    Naseri, Z.; Kharat, A. Nemati [Tehran Univ. (Iran, Islamic Republic of). Inorganic Chemistry Dept.; Hakimi, A. [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Dept. of Nuclear Engineering, Science and Research Branch; Jalilian, A.R.; Shirvani-Arani, S.; Bahrami-Samani, A.; Ghannadi-Maragheh, M. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (IR). Radiopharmaceutical Research and Development Lab (RRDL)

    2012-07-01

    Therapeutic radiopharmaceuticals are designed to deliver high doses of radiation to selected target organs or tissues with an aim of minimizing unwanted radiation to surrounding healthy tissue. In this work, [tris(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate ({sup 153}Sm-TPTTC) was developed for possible therapeutic properties. The cold compound, i.e. {sup nat}Sm-TPTTC was prepared and characterized by IR, UV, mass and {sup 1}H-NMR spectroscopy. {sup 153}Sm-TPTTC was prepared in two steps using [{sup 153}Sm]SmCl{sub 3}, obtained by neutron activation of an enriched {sup 152}Sm sample. Stability tests, partition coefficient determination, toxicity tests and biodistribution studies of the complex in wild-type and fibrosarcoma-bearing mice were determined. The radiolabeled complex was prepared in high radiochemical purity (> 99% precipitation method) and specific activity of 278 GBq/mmol and demonstrated significant stability at 4, 25 and 37 C (in presence of human serum). Initial complex biodistribution data showed significant liver accumulation in wild-type mice and significant tumor accumulation in fibrosarcoma-bearing mice with tumor:blood and tumor:muscle ratios of 3.55 (2 h) and 38.26 (96 h) respectively. {sup 153}Sm-TPTTC properties suggest an efficient tumor targeting agent with high tumor-avidity. Further investigation on the therapeutic properties must be conducted. (orig.)

  3. [Classification and clinical analysis of 165 patients with antiphospholipid syndrome.].

    Science.gov (United States)

    Xu, Na; Zhang, Yao; Zhang, Wen; Zhao, Yan; Zeng, Xiao-Feng

    2009-11-01

    Based on 2006 revised classification criteria of definite antiphospholipid syndrome (APS) and definition of new APS subsets, we investigated clinical features of APS patients, correlation between thrombotic events and related antibodies was assessed as well. 165 patients with APS were enrolled and analysed retrospectively. 124 female and 41 male patients were included. 116 cases (70.3%), 34 cases (20.6%), 10 cases (6.1%), and 5 cases (3.0%) were classified as definite APS, probable APS, seronegative APS, and microangiopathic APS (MAPS) respectively. Among 124 patients accompanied with other diseases, 113 (91.1%) were autoimmune diseases, mostly systemic lupus erythematosus (79.6%). 121 (73.3%) patients had episodes of thrombosis, with majority of deep vein thrombosis. The patients with positive test of lupus anticoagulant (LA) only were more likely to have episodes of thrombosis than with positive anticardiolipid antibody (ACL) only (86.0% versus 55.7%; P < 0.05). Among 61 patients with prolonged APTT, the presence of LA was detected in 50 (82.0%) patients, and ACL in 34 (55.7%) patients. APS patients could be classified into several subgroups according to their clinical features. Venous thromboses are more common than arterial thromboses, and positive of LA correlates thrombosis more than ACL.

  4. 33 CFR 165.771 - Safety Zone; Bahia de Ponce, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ..., Puerto Rico 165.771 Section 165.771 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Zone; Bahia de Ponce, Puerto Rico (a) Location. The following area is established as a safety zone... Bahia de Ponce, on approach to or departure from the Puerto de Ponce waterfront facility in Bahia de...

  5. 33 CFR 165.778 - Security Zone; Port of Mayaguez, Puerto Rico.

    Science.gov (United States)

    2010-07-01

    ..., Puerto Rico. 165.778 Section 165.778 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Security Zone; Port of Mayaguez, Puerto Rico. (a) Security zone. A moving and fixed security zone is established around all cruise ships entering, departing, mooring, or anchoring in the Port of Mayaguez, Puerto...

  6. 33 CFR 165.758 - Security Zone; San Juan, Puerto Rico.

    Science.gov (United States)

    2010-07-01

    ... Security Zone; San Juan, Puerto Rico. (a) Location. Moving and fixed security zones are established 50... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; San Juan, Puerto Rico. 165.758 Section 165.758 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND...

  7. 33 CFR 165.905 - USX Superfund Site Safety Zones: St. Louis River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false USX Superfund Site Safety Zones: St. Louis River. 165.905 Section 165.905 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... USX Superfund Site Safety Zones: St. Louis River. (a) The following areas of the St. Louis River...

  8. 40 CFR 429.165 - Pretreatment standards for existing sources (PSES).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Pretreatment standards for existing sources (PSES). 429.165 Section 429.165 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS TIMBER PRODUCTS PROCESSING POINT SOURCE CATEGORY Wood Furniture...

  9. 10 CFR 52.165 - Referral to the Advisory Committee on Reactor Safeguards (ACRS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Referral to the Advisory Committee on Reactor Safeguards (ACRS). 52.165 Section 52.165 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS... Committee on Reactor Safeguards (ACRS). The Commission shall refer a copy of the application to the ACRS...

  10. 14 CFR 406.165 - Argument before the administrative law judge.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Argument before the administrative law judge. 406.165 Section 406.165 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... law judge. (a) Argument during the hearing. During the hearing, the administrative law judge must give...

  11. 20 CFR 1002.165 - How does the employee elect continuing health plan coverage?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does the employee elect continuing health plan coverage? 1002.165 Section 1002.165 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR... elect continuing health plan coverage? USERRA does not specify requirements for electing continuing...

  12. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  13. SU-C-201-06: Utility of Quantitative 3D SPECT/CT Imaging in Patient Specific Internal Dosimetry of 153-Samarium with GATE Monte Carlo Package

    Energy Technology Data Exchange (ETDEWEB)

    Fallahpoor, M; Abbasi, M [Tehran University of Medical Sciences, Vali-Asr Hospital, Tehran, Tehran (Iran, Islamic Republic of); Sen, A [University of Houston, Houston, TX (United States); Parach, A [Shahid Sadoughi University of Medical Sciences, Yazd, Yazd (Iran, Islamic Republic of); Kalantari, F [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: Patient-specific 3-dimensional (3D) internal dosimetry in targeted radionuclide therapy is essential for efficient treatment. Two major steps to achieve reliable results are: 1) generating quantitative 3D images of radionuclide distribution and attenuation coefficients and 2) using a reliable method for dose calculation based on activity and attenuation map. In this research, internal dosimetry for 153-Samarium (153-Sm) was done by SPECT-CT images coupled GATE Monte Carlo package for internal dosimetry. Methods: A 50 years old woman with bone metastases from breast cancer was prescribed 153-Sm treatment (Gamma: 103keV and beta: 0.81MeV). A SPECT/CT scan was performed with the Siemens Simbia-T scanner. SPECT and CT images were registered using default registration software. SPECT quantification was achieved by compensating for all image degrading factors including body attenuation, Compton scattering and collimator-detector response (CDR). Triple energy window method was used to estimate and eliminate the scattered photons. Iterative ordered-subsets expectation maximization (OSEM) with correction for attenuation and distance-dependent CDR was used for image reconstruction. Bilinear energy mapping is used to convert Hounsfield units in CT image to attenuation map. Organ borders were defined by the itk-SNAP toolkit segmentation on CT image. GATE was then used for internal dose calculation. The Specific Absorbed Fractions (SAFs) and S-values were reported as MIRD schema. Results: The results showed that the largest SAFs and S-values are in osseous organs as expected. S-value for lung is the highest after spine that can be important in 153-Sm therapy. Conclusion: We presented the utility of SPECT-CT images and Monte Carlo for patient-specific dosimetry as a reliable and accurate method. It has several advantages over template-based methods or simplified dose estimation methods. With advent of high speed computers, Monte Carlo can be used for treatment planning

  14. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO2) thin films using electron beam evaporation

    Science.gov (United States)

    Kundu, Subrata; Sutradhar, Narottam; Thangamuthu, R.; Subramanian, B.; Panda, Asit Baran; Jayachandran, M.

    2012-08-01

    Samarium (Sm)-doped cerium oxide (CeO2) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ( 300 or 500 °C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO2 nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO2 nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH4. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO2 thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.

  15. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films using electron beam evaporation

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Subrata, E-mail: skundu@cecri.res.in [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Sutradhar, Narottam [G. B. Marg, Central Salt and Marine Chemical Research Institute - CSIR (India); Thangamuthu, R.; Subramanian, B. [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Panda, Asit Baran [G. B. Marg, Central Salt and Marine Chemical Research Institute (CSIR) (India); Jayachandran, M., E-mail: mjayam54@yahoo.com [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India)

    2012-08-15

    Samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ({approx}300 or 500 Degree-Sign C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO{sub 2} nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO{sub 2} nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH{sub 4}. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO{sub 2} thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.Graphical Abstract.

  16. 33 CFR 165.T11-281 - Safety Zone; Lake Mead Intake Construction; Lake Mead, Boulder City, NV.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Lake Mead Intake Construction; Lake Mead, Boulder City, NV. 165.T11-281 Section 165.T11-281 Navigation and Navigable Waters... Coast Guard District § 165.T11-281 Safety Zone; Lake Mead Intake Construction; Lake Mead, Boulder City...

  17. 33 CFR 165.164 - Security Zones: Dignitary Arrival/Departure and United Nations Meetings, New York, NY.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones: Dignitary Arrival/Departure and United Nations Meetings, New York, NY. 165.164 Section 165.164 Navigation and Navigable Waters... Guard District § 165.164 Security Zones: Dignitary Arrival/Departure and United Nations Meetings, New...

  18. 33 CFR 165.505 - Security Zone; Calvert Cliffs Nuclear Power Plant, Chesapeake Bay, Calvert County, Maryland.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Calvert Cliffs Nuclear Power Plant, Chesapeake Bay, Calvert County, Maryland. 165.505 Section 165.505 Navigation and... Areas Fifth Coast Guard District § 165.505 Security Zone; Calvert Cliffs Nuclear Power Plant, Chesapeake...

  19. 33 CFR 165.161 - Safety zones: Coast Guard Captain of the Port New York annual fireworks displays.

    Science.gov (United States)

    2010-07-01

    ... of the Port New York annual fireworks displays. 165.161 Section 165.161 Navigation and Navigable... Coast Guard District § 165.161 Safety zones: Coast Guard Captain of the Port New York annual fireworks displays. (a) Safety zones. The following areas are designated safety zones: (1) Bar Beach fireworks...

  20. 33 CFR 165.941 - Safety Zones; Annual Fireworks Events in the Captain of the Port Detroit Zone.

    Science.gov (United States)

    2010-07-01

    ... dates and times for this event will be determined annually. (11) Nautical Mile Venetian Festival... Events in the Captain of the Port Detroit Zone. 165.941 Section 165.941 Navigation and Navigable Waters... Guard District § 165.941 Safety Zones; Annual Fireworks Events in the Captain of the Port Detroit Zone...

  1. 33 CFR 165.776 - Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico 165.776 Section 165.776 Navigation and Navigable Waters COAST... Guard District § 165.776 Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico (a...

  2. 33 CFR 165.T09-0333 - Safety zone; Marathon Oil Refinery construction, Rouge River, Detroit, MI.

    Science.gov (United States)

    2010-07-01

    ... Coast Guard District § 165.T09-0333 Safety zone; Marathon Oil Refinery construction, Rouge River... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety zone; Marathon Oil Refinery construction, Rouge River, Detroit, MI. 165.T09-0333 Section 165.T09-0333 Navigation and Navigable...

  3. 33 CFR 165.1411 - Security zone; waters surrounding U.S. Forces vessel SBX-1, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security zone; waters surrounding U.S. Forces vessel SBX-1, HI. 165.1411 Section 165.1411 Navigation and Navigable Waters COAST GUARD... § 165.1411 Security zone; waters surrounding U.S. Forces vessel SBX-1, HI. (a) Location. The following...

  4. 41 CFR 102-118.165 - What must my agency do if it finds an error on a TSP bill?

    Science.gov (United States)

    2010-07-01

    ... if it finds an error on a TSP bill? 102-118.165 Section 102-118.165 Public Contracts and Property... Services § 102-118.165 What must my agency do if it finds an error on a TSP bill? Your agency must advise the TSP via statement of difference of any adjustment that you make either electronically or in...

  5. 46 CFR 7.165 - Kenai Peninsula, AK to Kodiak Island, AK.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Kenai Peninsula, AK to Kodiak Island, AK. 7.165 Section... BOUNDARY LINES Alaska § 7.165 Kenai Peninsula, AK to Kodiak Island, AK. (a) A line drawn from the southernmost extremity of Kenai Peninsula at longitude 151°44.0′ W. to East Amatuli Island Light; thence to the...

  6. VEGF121b and VEGF165b are weakly angiogenic isoforms of VEGF-A

    Directory of Open Access Journals (Sweden)

    Pio Ruben

    2010-12-01

    Full Text Available Abstract Background Different isoforms of VEGF-A (mainly VEGF121, VEGF165 and VEGF189 have been shown to display particular angiogenic properties in the generation of a functional tumor vasculature. Recently, a novel class of VEGF-A isoforms, designated as VEGFxxxb, generated through alternative splicing, have been described. Previous studies have suggested that these isoforms may inhibit angiogenesis. In the present work we have produced recombinant VEGF121/165b proteins in the yeast Pichia pastoris and constructed vectors to overexpress these isoforms and assess their angiogenic potential. Results Recombinant VEGF121/165b proteins generated either in yeasts or mammalian cells activated VEGFR2 and its downstream effector ERK1/2, although to a lesser extent than VEGF165. Furthermore, treatment of endothelial cells with VEGF121/165b increased cell proliferation compared to untreated cells, although such stimulation was lower than that induced by VEGF165. Moreover, in vivo angiogenesis assays confirmed angiogenesis stimulation by VEGF121/165b isoforms. A549 and PC-3 cells overexpressing VEGF121b or VEGF165b (or carrying the PCDNA3.1 empty vector, as control and xenotransplanted into nude mice showed increased tumor volume and angiogenesis compared to controls. To assess whether the VEGFxxxb isoforms are differentially expressed in tumors compared to healthy tissues, immunohistochemical analysis was conducted on a breast cancer tissue microarray. A significant increase (p xxxb and total VEGF-A protein expression in infiltrating ductal carcinomas compared to normal breasts was observed. A positive significant correlation (r = 0.404, p = 0.033 between VEGFxxxb and total VEGF-A was found. Conclusions Our results demonstrate that VEGF121/165b are not anti-angiogenic, but weakly angiogenic isoforms of VEGF-A. In addition, VEGFxxxb isoforms are up-regulated in breast cancer in comparison with non malignant breast tissues. These results are to be taken

  7. Crystal structure of monoclinic samarium and cubic europium sesquioxides and bound coherent neutron scattering lengths of the isotopes {sup 154}Sm and {sup 153}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Kohlmann, Holger [Leipzig Univ. (Germany). Inst. of Inorganic Chemistry; Hein, Christina; Kautenburger, Ralf [Saarland Univ., Saarbruecken (Germany). Inorganic Solid State Chemistry; Hansen, Thomas C.; Ritter, Clemens [Institut Laue-Langevin, Grenoble (France); Doyle, Stephen [Karlsruhe Institute of Technology, Eggenstein-Leopoldshafen (Germany). Inst. for Synchrotron Radiation (ISS)

    2016-11-01

    The crystal structures of monoclinic samarium and cubic europium sesquioxide, Sm{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}, were reinvestigated by powder diffraction methods (laboratory X-ray, synchrotron, neutron). Rietveld analysis yields more precise structural parameters than previously known, especially for oxygen atoms. Interatomic distances d(Sm-O) in Sm{sub 2}O{sub 3} range from 226.3(4) to 275.9(2) pm [average 241.6(3) pm] for the monoclinic B type Sm{sub 2}O{sub 3} [space group C2/m, a = 1418.04(3) pm, b = 362.660(7) pm, c = 885.48(2) pm, β = 100.028(1) ], d(Eu-O) in Eu{sub 2}O{sub 3} from 229.9(2) to 238.8(2) pm for the cubic bixbyite (C) type [space group Ia anti 3, a = 1086.87(1) pm]. Neutron diffraction at 50 K and 2 K did not show any sign for magnetic ordering in Sm{sub 2}O{sub 3}. Isotopically enriched {sup 154}Sm{sub 2}O{sub 3} and {sup 153}Eu{sub 2}O{sub 3} were used for the neutron diffraction work because of the enormous absorption cross section of the natural isotopic mixtures for thermal neutrons. The isotopic purity was determined by inductively coupled plasma - mass spectrometry to be 98.9% for {sup 154}Sm and 99.8% for {sup 153}Eu. Advanced analysis of the neutron diffraction data suggest that the bound coherent scattering lengths of {sup 154}Sm and {sup 153}Eu need to be revised. We tentatively propose b{sub c}({sup 154}Sm) = 8.97(6) fm and b{sub c}({sup 153}Eu) = 8.85(3) fm for a neutron wavelength of 186.6 pm to be better values for these isotopes, showing up to 8% deviation from accepted literature values. It is shown that inaccurate scattering lengths may result in severe problems in crystal structure refinements causing erroneous structural details such as occupation parameters, which might be critically linked to physical properties like superconductivity in multinary oxides.

  8. Highly CO2-Tolerant Cathode for Intermediate-Temperature Solid Oxide Fuel Cells: Samarium-Doped Ceria-Protected SrCo0.85Ta0.15O3-δ Hybrid.

    Science.gov (United States)

    Li, Mengran; Zhou, Wei; Zhu, Zhonghua

    2017-01-25

    Susceptibility to CO2 is one of the major challenges for the long-term stability of the alkaline-earth-containing cathodes for intermediate-temperature solid oxide fuel cells. To alleviate the adverse effects from CO2, we incorporated samarium-stabilized ceria (SDC) into a SrCo0.85Ta0.15O3-δ (SCT15) cathode by either mechanical mixing or a wet impregnation method and evaluated their cathode performance stability in the presence of a gas mixture of 10% CO2, 21% O2, and 69% N2. We observed that the CO2 tolerance of the hybrid cathode outperforms the pure SCT15 cathode by over 5 times at 550 °C. This significant enhancement is likely attributable to the low CO2 adsorption and reactivity of the SDC protective layer, which are demonstrated through thermogravimetric analysis, energy-dispersive spectroscopy, and electrical conductivity study.

  9. 33 CFR 165.106 - Security Zone: Seabrook Nuclear Power Plant, Seabrook, New Hampshire.

    Science.gov (United States)

    2010-07-01

    ... Guard District § 165.106 Security Zone: Seabrook Nuclear Power Plant, Seabrook, New Hampshire. (a... property boundary of Seabrook Nuclear Power Plant identified as follows: beginning at position 42°53′58″ N, 070°51′06″ W then running along the property boundaries of Seabrook Nuclear Power Plant to position 42...

  10. 40 CFR 86.165-12 - Air conditioning idle test procedure.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Air conditioning idle test procedure... Complete Heavy-Duty Vehicles; Test Procedures § 86.165-12 Air conditioning idle test procedure. (a) Applicability. This section describes procedures for determining air conditioning-related CO2 emissions from...

  11. 33 CFR 165.811 - Atchafalaya River, Berwick Bay, LA-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... Bridge. (c) When the Morgan City River gauge reads 3.0 feet or above mean sea level, in addition to the... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Atchafalaya River, Berwick Bay... § 165.811 Atchafalaya River, Berwick Bay, LA-regulated navigation area. (a) The following is a regulated...

  12. 33 CFR 165.1404 - Apra Harbor, Guam-security zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Apra Harbor, Guam-security zone... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1404 Apra Harbor, Guam—security zone. (a) The following is designated as Security Zone C—The waters of Apra Outer Harbor, Guam...

  13. 33 CFR 165.1401 - Apra Harbor, Guam-safety zones.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Apra Harbor, Guam-safety zones... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1401 Apra Harbor, Guam—safety zones. (a) The following is designated as Safety Zone A—The waters of the Pacific Ocean and Apra Outer...

  14. Synthesis of the human VEGF 165 gene based on overlap PCR and ...

    African Journals Online (AJOL)

    Synthesis of the human VEGF165 gene based on overlap PCR and recombinant expression in stable transfected CHO cells. J Zhang, T Wang, B Yang, Y Lin, Z Li. Abstract. Vascular endothelial growth factors (VEGFs) are a member of a family of structurally related proteins that mediate angiogenesis, and vascular ...

  15. Synthesis of the human VEGF165 gene based on overlap PCR and ...

    African Journals Online (AJOL)

    Yomi

    2012-01-16

    Jan 16, 2012 ... pMDV plasmid was digested by Hind III and Xba I (TaKaRa, Japan) and inserted into the pCAG vector (Wang et al., 2009) digested with the corresponding enzymes, replacing the CAT gene with VEGF165 gene, to generate the resultant plasmid pCGV. The constructs were shown schematically in Figure 2A.

  16. 15 CFR 16.5 - Development of performance information labeling specifications.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Development of performance information... PROCEDURES FOR A VOLUNTARY CONSUMER PRODUCT INFORMATION LABELING PROGRAM § 16.5 Development of performance information labeling specifications. (a) If the Secretary makes a finding of need pursuant to § 16.4, she will...

  17. 42 CFR 423.165 - Compliance deemed on the basis of accreditation.

    Science.gov (United States)

    2010-10-01

    ... Control and Quality Improvement Requirements § 423.165 Compliance deemed on the basis of accreditation. (a... programs, quality assurance measures and systems, and MTMPs as provided under § 423.153. (3) Privacy... 42 Public Health 3 2010-10-01 2010-10-01 false Compliance deemed on the basis of accreditation...

  18. 33 CFR 165.T01-0542 - Safety Zones: Neptune Deepwater Port, Atlantic Ocean, Boston, MA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones: Neptune Deepwater... Guard District § 165.T01-0542 Safety Zones: Neptune Deepwater Port, Atlantic Ocean, Boston, MA. (a...-meter radius of each of the two STL buoys of the Neptune Deepwater Port, marked on the surface of the...

  19. 33 CFR 165.902 - Niagara River at Niagara Falls, New York-safety zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Niagara River at Niagara Falls... § 165.902 Niagara River at Niagara Falls, New York—safety zone. (a) The following is a safety zone—The United States waters of the Niagara River from the crest of the American and Horseshoe Falls, Niagara...

  20. 33 CFR 165.815 - Ohio River at Louisville, KY; regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Ohio River at Louisville, KY... § 165.815 Ohio River at Louisville, KY; regulated navigation area. (a) The following is a regulated navigation area: The waters of the Ohio River from the Clark Memorial (Highway) Bridge at Mile 603.5...

  1. 33 CFR 165.821 - Ohio River at Cincinnati, OH; regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Ohio River at Cincinnati, OH... § 165.821 Ohio River at Cincinnati, OH; regulated navigation area. (a) Location. The following is a regulated navigation area (RNA)—The waters of the Ohio River between mile 466.0 and mile 473.0. (b...

  2. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  3. Regulation of MIR165/166 by class II and class III homeodomain leucine zipper proteins establishes leaf polarity

    DEFF Research Database (Denmark)

    Merelo, Paz; Ram, Hathi; Caggiano, Monica Pia

    2016-01-01

    -ZIP) transcription factors are key mediators in the regulation of adaxial-abaxial patterning. Their expression is restricted adaxially during early development by the abaxially expressed microRNA (MIR)165/166, yet the mechanism that restricts MIR165/166 expression to abaxial leaf tissues remains unknown. Here, we...

  4. 33 CFR 165.1406 - Safety Zone: Pacific Missile Range Facility (PMRF), Barking Sands, Island of Kauai, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... Range Facility (PMRF), Barking Sands, Island of Kauai, Hawaii. 165.1406 Section 165.1406 Navigation and...), Barking Sands, Island of Kauai, Hawaii. (a) Location. The following area is established as a safety zone during launch operations at PMRF, Kauai, Hawaii: The waters bounded by the following coordinates: (22°01...

  5. 33 CFR 165.T01-0176 - Regulated Navigation Area; Lake Champlain Bridge Construction, Crown Point, New York and Chimney...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Regulated Navigation Area; Lake Champlain Bridge Construction, Crown Point, New York and Chimney Point, Vermont. 165.T01-0176 Section 165.T01-0176 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATIO...

  6. 33 CFR 165.1195 - Regulated Navigation Area; Humboldt Bay Bar Channel and Humboldt Bay Entrance Channel, Humboldt...

    Science.gov (United States)

    2010-07-01

    ...; Humboldt Bay Bar Channel and Humboldt Bay Entrance Channel, Humboldt Bay, California. 165.1195 Section 165... Channel and Humboldt Bay Entrance Channel, Humboldt Bay, California. (a) Location. The Regulated Navigation Area (RNA) includes all navigable waters of the Humboldt Bay Bar Channel and the Humboldt Bay...

  7. 33 CFR 165.T14-204 - Safety Zone; fixed mooring balls, south of Barbers Pt Harbor Channel, Oahu, Hawaii.

    Science.gov (United States)

    2010-07-01

    ..., south of Barbers Pt Harbor Channel, Oahu, Hawaii. 165.T14-204 Section 165.T14-204 Navigation and... Pt Harbor Channel, Oahu, Hawaii. (a) Location. The following area is a safety zone: All waters... position is approximately 2,500 yards south of Barbers Point Harbor channel buoy #2, Oahu, Hawaii. This...

  8. 33 CFR 165.901 - Great Lakes-regulated navigation areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Great Lakes-regulated navigation... Specific Regulated Navigation Areas and Limited Access Areas Ninth Coast Guard District § 165.901 Great... a line from Gray's Reef Light (LL-2006) at 45°46′00″ N, 85°09′12″ W; to White Shoals Light (LL-2003...

  9. Global microarray analysis of carbohydrate use in alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5.

    Science.gov (United States)

    Song, Yajian; Xue, Yanfen; Ma, Yanhe

    2013-01-01

    The alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5 has a broad substrate spectrum and exhibits the capacity to utilize complex carbohydrates such as galactomannan, xylan, and pectin. In the monosaccharide mixture, sequential utilization by Bacillus sp. N16-5 was observed. Glucose appeared to be its preferential monosaccharide, followed by fructose, mannose, arabinose, xylose, and galactose. Global transcription profiles of the strain were determined separately for growth on six monosaccharides (glucose, fructose, mannose, galactose, arabinose, and xylose) and four polysaccharides (galactomannan, xylan, pectin, and sodium carboxymethylcellulose) using one-color microarrays. Numerous genes potentially related to polysaccharide degradation, sugar transport, and monosaccharide metabolism were found to respond to a specific substrate. Putative gene clusters for different carbohydrates were identified according to transcriptional patterns and genome annotation. Identification and analysis of these gene clusters contributed to pathway reconstruction for carbohydrate utilization in Bacillus sp. N16-5. Several genes encoding putative sugar transporters were highly expressed during growth on specific sugars, suggesting their functional roles. Two phosphoenolpyruvate-dependent phosphotransferase systems were identified as candidate transporters for mannose and fructose, and a major facilitator superfamily transporter was identified as a candidate transporter for arabinose and xylose. Five carbohydrate uptake transporter 1 family ATP-binding cassette transporters were predicted to participate in the uptake of hemicellulose and pectin degradation products. Collectively, microarray data improved the pathway reconstruction involved in carbohydrate utilization of Bacillus sp. N16-5 and revealed that the organism precisely regulates gene transcription in response to fluctuations in energy resources.

  10. Global microarray analysis of carbohydrate use in alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5.

    Directory of Open Access Journals (Sweden)

    Yajian Song

    Full Text Available The alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5 has a broad substrate spectrum and exhibits the capacity to utilize complex carbohydrates such as galactomannan, xylan, and pectin. In the monosaccharide mixture, sequential utilization by Bacillus sp. N16-5 was observed. Glucose appeared to be its preferential monosaccharide, followed by fructose, mannose, arabinose, xylose, and galactose. Global transcription profiles of the strain were determined separately for growth on six monosaccharides (glucose, fructose, mannose, galactose, arabinose, and xylose and four polysaccharides (galactomannan, xylan, pectin, and sodium carboxymethylcellulose using one-color microarrays. Numerous genes potentially related to polysaccharide degradation, sugar transport, and monosaccharide metabolism were found to respond to a specific substrate. Putative gene clusters for different carbohydrates were identified according to transcriptional patterns and genome annotation. Identification and analysis of these gene clusters contributed to pathway reconstruction for carbohydrate utilization in Bacillus sp. N16-5. Several genes encoding putative sugar transporters were highly expressed during growth on specific sugars, suggesting their functional roles. Two phosphoenolpyruvate-dependent phosphotransferase systems were identified as candidate transporters for mannose and fructose, and a major facilitator superfamily transporter was identified as a candidate transporter for arabinose and xylose. Five carbohydrate uptake transporter 1 family ATP-binding cassette transporters were predicted to participate in the uptake of hemicellulose and pectin degradation products. Collectively, microarray data improved the pathway reconstruction involved in carbohydrate utilization of Bacillus sp. N16-5 and revealed that the organism precisely regulates gene transcription in response to fluctuations in energy resources.

  11. Regulation of human feto-placental endothelial barrier integrity by vascular endothelial growth factors: competitive interplay between VEGF-A165a, VEGF-A165b, PIGF and VE-cadherin.

    Science.gov (United States)

    Pang, Vincent; Bates, David O; Leach, Lopa

    2017-12-01

    The human placenta nourishes and protects the developing foetus whilst influencing maternal physiology for fetal advantage. It expresses several members of the vascular endothelial growth factor (VEGF) family including the pro-angiogenic/pro-permeability VEGF-A 165 a isoform, the anti-angiogenic VEGF-A 165 b, placental growth factor (PIGF) and their receptors, VEGFR1 and VEGFR2. Alterations in the ratio of these factors during gestation and in complicated pregnancies have been reported; however, the impact of this on feto-placental endothelial barrier integrity is unknown. The present study investigated the interplay of these factors on junctional occupancy of VE-cadherin and macromolecular leakage in human endothelial monolayers and the perfused placental microvascular bed. Whilst VEGF-A 165 a (50 ng/ml) increased endothelial monolayer albumin permeability ( P 0.05) or PlGF ( P >0.05) did not. Moreover, VEGF-A 165 b (100 ng/ml; P 0.05) inhibited VEGF-A 165 a-induced permeability when added singly. PlGF abolished the VEGF-A 165 b-induced reduction in VEGF-A 165 a-mediated permeability ( P >0.05); PlGF was found to compete with VEGF-A 165 b for binding to Flt-1 at equimolar affinity. Junctional occupancy of VE-cadherin matched alterations in permeability. In the perfused microvascular bed, VEGF-A 165 b did not induce microvascular leakage but inhibited and reversed VEGF-A 165 a-induced loss of junctional VE-cadherin and tracer leakage. These results indicate that the anti-angiogenic VEGF-A 165 b isoform does not increase permeability in human placental microvessels or HUVEC primary cells and can interrupt VEGF-A 165 a-induced permeability. Moreover, the interplay of these isoforms with PIGF (and s-flt1) suggests that the ratio of these three factors may be important in determining the placental and endothelial barrier in normal and complicated pregnancies. © 2017 The Author(s).

  12. Association between human prothrombin variant (T165M and kidney stone disease.

    Directory of Open Access Journals (Sweden)

    Nanyawan Rungroj

    Full Text Available We previously reported the association between prothrombin (F2, encoding a stone inhibitor protein - urinary prothrombin fragment 1 (UPTF1, and the risk of kidney stone disease in Northeastern Thai patients. To identify specific F2 variation responsible for the kidney stone risk, we conducted sequencing analysis of this gene in a group of the patients with kidney stone disease. Five intronic SNPs (rs2070850, rs2070852, rs1799867, rs2282687, and rs3136516 and one exonic non-synonymous single nucleotide polymorphism (nsSNP; rs5896 were found. The five intronic SNPs have no functional change as predicted by computer programs while the nsSNP rs5896 (c.494 C>T located in exon 6 results in a substitution of threonine (T by methionine (M at the position 165 (T165M. The nsSNP rs5896 was subsequently genotyped in 209 patients and 216 control subjects. Genotypic and allelic frequencies of this nsSNP were analyzed for their association with kidney stone disease. The frequency of CC genotype of rs5896 was significantly lower in the patient group (13.4% than that in the control group (22.2% (P = 0.017, OR 0.54, 95% CI 0.32-0.90, and the frequency of C allele was significantly lower in the patient group (36.1% than that in the control group (45.6% (P = 0.005, OR 0.68, 95% CI 0.51-0.89. The significant differences of genotype and allele frequencies were maintained only in the female group (P = 0.033 and 0.003, respectively. The effect of amino-acid change on UPTF1 structure was also examined by homologous modeling and in silico mutagenesis. T165 is conserved and T165M substitution will affect hydrogen bond formation with E180. In conclusion, our results indicate that prothrombin variant (T165M is associated with kidney stone risk in the Northeastern Thai female patients.

  13. 33 CFR 165.T13-149 - Safety Zone; McNary-John Day Transmission Line Project, Columbia River, Hermiston, OR.

    Science.gov (United States)

    2010-07-01

    ... Transmission Line Project, Columbia River, Hermiston, OR. 165.T13-149 Section 165.T13-149 Navigation and... Areas Thirteenth Coast Guard District § 165.T13-149 Safety Zone; McNary-John Day Transmission Line... Columbia River between two lines with the first line starting at the north bank at 45° 56′ 16.5″ N/119° 19...

  14. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  15. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS); Die Dynamik des laserinduzierten Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS)

    Energy Technology Data Exchange (ETDEWEB)

    Kaempfer, Tino

    2009-12-15

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [German] Die vorliegende Arbeit ist der experimentellen Untersuchung des Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS) gewidmet. Es werden temperatur- und zeitaufgeloeste Experimente zur Charakterisierung des Phasenuebergangs gemischt-valenter SmS Proben (M-SmS) vorgestellt. Die Messung der Dynamik des laserinduzierten Phasenuebergangs erfolgt ueber zeitaufgeloeste Ultrakurzzeit-Mikroskopie und durch Roentgenbeugung mit subpikosekunden Zeitaufloesung. Die elektronischen und strukturellen Prozesse, welche einer Anregung von M-SmS mit infraroten Femtosekunden-Laserpulsen folgen, werden auf der Basis der in dieser Arbeit gewonnenen Ergebnisse und Modellvorstellungen physikalisch interpretiert. (orig.)

  16. Molecular characterization of a DNA fragment harboring the replicon of pBMB165 from Bacillus thuringiensis subsp. tenebrionis

    Directory of Open Access Journals (Sweden)

    Yu Ziniu

    2006-10-01

    Full Text Available Abstract Background Bacillus thuringiensis belongs to the Bacillus cereus sensu lato group of Gram-positive and spore-forming bacteria. Most isolates of B. thuringiensis can bear many endogenous plasmids, and the number and size of these plasmids can vary widely among strains or subspecies. As far as we know, the replicon of the plasmid pBMB165 is the first instance of a plasmid replicon being isolated from subsp. tenebrionis and characterized. Results A 20 kb DNA fragment containing a plasmid replicon was isolated from B. thuringiensis subsp. tenebrionis YBT-1765 and characterized. By Southern blot analysis, this replicon region was determined to be located on pBMB165, the largest detected plasmid (about 82 kb of strain YBT-1765. Deletion analysis revealed that a replication initiation protein (Rep165, an origin of replication (ori165 and an iteron region were required for replication. In addition, two overlapping ORFs (orf6 and orf10 were found to be involved in stability control of plasmid. Sequence comparison showed that the replicon of pBMB165 was homologous to the pAMβ1 family replicons, indicating that the pBMB165 replicon belongs to this family. The presence of five transposable elements or remnants thereof in close proximity to and within the replicon control region led us to speculate that genetic exchange and recombination are potentially responsible for the divergence among the replicons of this plasmid family. Conclusion The replication and stability features of the pBMB165 from B. thuringiensis subsp. tenebrionis YBT-1765 were identified. Of particular interest is the homology and divergence shared between the pBMB165 replicon and other pAMβ1 family replicons.

  17. Molecular characterization of a DNA fragment harboring the replicon of pBMB165 from Bacillus thuringiensis subsp. tenebrionis.

    Science.gov (United States)

    Huang, Junyan; Guo, Suxia; Mahillon, Jacques; Van der Auwera, Géraldine A; Wang, Li; Han, Dongmei; Yu, Ziniu; Sun, Ming

    2006-10-23

    Bacillus thuringiensis belongs to the Bacillus cereus sensu lato group of Gram-positive and spore-forming bacteria. Most isolates of B. thuringiensis can bear many endogenous plasmids, and the number and size of these plasmids can vary widely among strains or subspecies. As far as we know, the replicon of the plasmid pBMB165 is the first instance of a plasmid replicon being isolated from subsp. tenebrionis and characterized. A 20 kb DNA fragment containing a plasmid replicon was isolated from B. thuringiensis subsp. tenebrionis YBT-1765 and characterized. By Southern blot analysis, this replicon region was determined to be located on pBMB165, the largest detected plasmid (about 82 kb) of strain YBT-1765. Deletion analysis revealed that a replication initiation protein (Rep165), an origin of replication (ori165) and an iteron region were required for replication. In addition, two overlapping ORFs (orf6 and orf10) were found to be involved in stability control of plasmid. Sequence comparison showed that the replicon of pBMB165 was homologous to the pAMbeta1 family replicons, indicating that the pBMB165 replicon belongs to this family. The presence of five transposable elements or remnants thereof in close proximity to and within the replicon control region led us to speculate that genetic exchange and recombination are potentially responsible for the divergence among the replicons of this plasmid family. The replication and stability features of the pBMB165 from B. thuringiensis subsp. tenebrionis YBT-1765 were identified. Of particular interest is the homology and divergence shared between the pBMB165 replicon and other pAMbeta1 family replicons.

  18. /sup 165/Ho(n,. gamma. ) standard cross section from 3 to 450 keV

    Energy Technology Data Exchange (ETDEWEB)

    Macklin, R.L.

    1976-03-01

    The /sup 165/Ho(n, ..gamma..) cross section was measured at the Oak Ridge Electron Linear Accelerator neutron time-of-flight facility. Nonhydrogenous scintillation detectors were used with pulse-height weighting to measure the prompt photon yield, normalized to the saturated 3.92-eV resonance in (/sup 165/Ho + n) and the shape of the /sup 6/Li(n,..cap alpha..) cross section. Resonance parameters for many of the observed peaks below 3 keV were determined by a nonlinear least-squares fit. The data to 100 keV were well fitted with energy-independent strength functions 10/sup 4/S/sup 0/ = 1.33 +- 0.14, 10/sup 4/S/sup 1/ = 1.36 +- 0.24, 10/sup 4/S/sub 2/ = 1.19 +- 0.76 and anti GAMMA/sub ..gamma../D/sub 0/ = 0.076/(3.23 +- 0.55 eV). The fluctuations of the cross section about the strength function fit are analyzed for 250-eV averages. The Wald-Wolfowitz ''Runs'' test is consistent with no additional nonrandom structure in the cross section. 3 figures, 1 table. (auth)

  19. Comparative proteome analysis of alkaliphilic Bacillus sp. N16-5 grown on different carbon sources.

    Science.gov (United States)

    Li, Gang; Song, YaJian; Xue, YanFen; Rao, Lang; Zhou, Chen; Wang, QuanHui; Ma, YanHe

    2011-01-01

    To determine the impact of carbohydrates on the metabolic pathway in alkaliphiles, proteomes were obtained from cultures containing different carbohydrates and were resolved on two-dimensional gel electrophoresis (2-DE). The proteomes were compared to determine differentially expressed proteins. A novel alkaliphilic bacterium (alkaliphilic Bacillus sp. N16-5 isolated from Wudunur Soda Lake, China) was isolated in media with five different carbon sources (glucose, mannose, galactose, arabinose, and xylose). Comparative proteome analysis identified 61 differentially expressed proteins, which were mainly involved in carbohydrate metabolism, amino acid transport, and metabolism, as well as energy production and conversion. The comparison was based on the draft genome sequence of strain N16-5. The abundance of enzymes involved in central metabolism was significantly changed when exposed to various carbohydrates. Notably, catabolite control protein A (CcpA) was up-regulated under all carbon sources compared with glucose. In addition, pentose exhibited a stronger effect than hexose in CcpA-mediated carbon catabolite repression. These results provided a fundamental understanding of carbohydrate metabolism in alkaliphiles.

  20. Distribution of the PKU mutation 165T in Spain and Latin America

    Energy Technology Data Exchange (ETDEWEB)

    Perez, B.; deLucca, M.; Desviat, L.R. [UAM-CSIC, Madrid (Spain)] [and others

    1994-09-01

    The 165T mutation is the second most common mutation in the Spanish PKU patients. In order to provide some additional data about the origin of this mutation, we have analyzed 452 PKU alleles from all regions of Spain. The mutation was found in 9% of alleles. We have found a South-North gradient with a highest frequency in the South and the lowest in the North. In the North-West regions (which has the greatest Celtic influence in Spain) the frequency was 7%. The chromosomes bearing this mutation contained the 8 repeat VNTR allele, as has been described in other populations. In view of these results, we suggest an origin other than Celtic for this mutation. On the other hand, we have analyzed 406 PKU alleles from five Latin American countries, 158 from Brazil, 170 from Chile, 56 from Argentina, 14 from Mexico and 8 from Venezuela. Unlike the results of the IVS10 mutation, 165T is present in Latin America with a low frequency. The results show that this mutation is rare in Chile (1%) and is absent in the chromosomes analyzed from Argentina, Mexico and Venezuela. Only in Brazil has this mutation been found in 5% of the alleles. Up to now, Spain is the only Mediterranean country where this mutation is present with a relatively high frequency. This mutation has been detected in the Portuguese patients and would also have migrated to Brazil.

  1. A polymer nanoparticle with engineered affinity for a vascular endothelial growth factor (VEGF165)

    Science.gov (United States)

    Koide, Hiroyuki; Yoshimatsu, Keiichi; Hoshino, Yu; Lee, Shih-Hui; Okajima, Ai; Ariizumi, Saki; Narita, Yudai; Yonamine, Yusuke; Weisman, Adam C.; Nishimura, Yuri; Oku, Naoto; Miura, Yoshiko; Shea, Kenneth J.

    2017-07-01

    Protein affinity reagents are widely used in basic research, diagnostics and separations and for clinical applications, the most common of which are antibodies. However, they often suffer from high cost, and difficulties in their development, production and storage. Here we show that a synthetic polymer nanoparticle (NP) can be engineered to have many of the functions of a protein affinity reagent. Polymer NPs with nM affinity to a key vascular endothelial growth factor (VEGF165) inhibit binding of the signalling protein to its receptor VEGFR-2, preventing receptor phosphorylation and downstream VEGF165-dependent endothelial cell migration and invasion into the extracellular matrix. In addition, the NPs inhibit VEGF-mediated new blood vessel formation in Matrigel plugs in vivo. Importantly, the non-toxic NPs were not found to exhibit off-target activity. These results support the assertion that synthetic polymers offer a new paradigm in the search for abiotic protein affinity reagents by providing many of the functions of their protein counterparts.

  2. Release kinetics of VEGF165 from a collagen matrix and structural matrix changes in a circulation model

    Directory of Open Access Journals (Sweden)

    Fischer Carsten

    2010-07-01

    Full Text Available Abstract Background Current approaches in bone regeneration combine osteoconductive scaffolds with bioactive cytokines like BMP or VEGF. The idea of our in-vitro trial was to apply VEGF165 in gradient concentrations to an equine collagen carrier and to study pharmacological and morphological characteristics of the complex in a circulation model. Methods Release kinetics of VEGF165 complexed in different quantities in a collagen matrix were determined in a circulation model by quantifying protein concentration with ELISA over a period of 5 days. The structural changes of the collagen matrix were assessed with light microscopy, native scanning electron microscopy (SEM as well as with immuno-gold-labelling technique in scanning and transmission electron microscopy (TEM. Results We established a biological half-life for VEGF165 of 90 minutes. In a half-logarithmic presentation the VEGF165 release showed a linear declining gradient; the release kinetics were not depending on VEGF165 concentrations. After 12 hours VEGF release reached a plateau, after 48 hours VEGF165 was no longer detectable in the complexes charged with lower doses, but still measurable in the 80 μg sample. At the beginning of the study a smear layer was visible on the surface of the complex. After the wash out of the protein in the first days the natural structure of the collagen appeared and did not change over the test period. Conclusions By defining the pharmacological and morphological profile of a cytokine collagen complex in a circulation model our data paves the way for further in-vivo studies where additional biological side effects will have to be considered. VEGF165 linked to collagen fibrils shows its improved stability in direct electron microscopic imaging as well as in prolonged release from the matrix. Our in-vitro trial substantiates the position of cytokine collagen complexes as innovative and effective treatment tools in regenerative medicine and and may initiate

  3. Chitosan microspheres loaded with holmium-165 produced by spray dryer for liver cancer therapy: preliminary experiments

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Douglas Massao; Pires, Geovanna; Lira, Raphael A. de; Melo, Vitor H.S.; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de, E-mail: douglas.miyamoto@usp.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Radiofarmacia

    2011-07-01

    Chitosan is a biopolymer of 2-deoxy-2-amino-D-glucose that is obtained by deacetylation of chitin. It's biocompatible, biodegradable, non toxic and has antitumor activity. Chitosan has many applications, such as their microparticles that can be used to treat prostate cancer, rheumatoid arthritis, and for liver tumor brachytherapy treatment. Our group is developing different biodegradable polymer-based microspheres loaded with holmium-165 for this purpose. The Chitosan microspheres were produced loaded with holmium (III) chloride, and not loaded with it, by Mini Spray Dryer procedure. The microspheres were evaluated by scanning electron microscopy, energy dispersive spectroscopy (EDS), confocal laser scanning microscopy, thermogravimetric analysis, particle size, and X-ray diffraction. The EDS analysis confirmed the holmium chloride presence into the prepared chitosan microparticles. (author)

  4. Acetylcholinesterase Inhibitory Meroterpenoid from a Mangrove Endophytic Fungus Aspergillus sp. 16-5c.

    Science.gov (United States)

    Long, Yuhua; Cui, Hui; Liu, Xinglie; Xiao, Ze'en; Wen, Shitong; She, Zhigang; Huang, Xishan

    2017-05-03

    One new meroterpenoid, named 2-hydroacetoxydehydroaustin ( 1 ), together with nine known meroterpenoids, 11-acetoxyisoaustinone ( 2 ), isoaustinol ( 3 ), austin ( 4 ), austinol ( 5 ), acetoxydehydroaustin ( 6 ), dehydroaustin ( 7 ), dehydroaustinol ( 8 ), preaustinoid A2 ( 9 ), and 1,2-dihydro-acetoxydehydroaustin B ( 10 ), were isolated from the mangrove endophytic fungus, Aspergillus sp. 16-5c. These structures were characterized by spectroscopic analysis, further the absolute configurations of stereogenic carbons for Compounds 1 , 3 , 4 , 6 , 7 , 8 , 9 , and 10 were determined by single crystal X-ray diffraction analysis using Cu Kα radiation. Moreover, the absolute configurations of stereogenic carbons for Known Compounds 3 , 7 , 8 , and 9 are identified here for the first time. Compounds 3 , 7 , and 8 showed acetylcholinesterase (AchE) inhibitory activity with IC 50 values of 2.50, 0.40, and 3.00 μM, respectively.

  5. Studies of parity and time reversal symmetries in neutron scattering from165Ho

    Science.gov (United States)

    Haase, D. G.; Gould, C. R.; Koster, J. E.; Roberson, N. R.; Seagondollar, L. W.; Soderstrum, J. P.; Schneider, M. B.; Zhu, X.

    1988-12-01

    We describe searches for parity and time reversal violations in the scattering of polarized neutrons from polarized and aligned165Ho targets. We have completed a search with 7.1 and 11.0 MeV neutrons for PoddTodd terms in the elastic scattering forward amplitude of the form s. ( I×K), where s is the neutron spin, I is the target spin and k is the neutron momentum vector. The target was a single crystal of holmium, polarized horizontally along its b axis by a 1 Tesla magnetic field. The neutrons were polarized vertically. Differences in the neutron transmission were measured for neutrons with spins parallel (antiparallel) to I×k. The P,T violating analyzing powers were found to be consistent with zero at the few 10-3 level: ρP,T(7.1 MeV)=-0.88 (±2.02) x 10-3, ρP,T(11.0 MeV)=-0.4 (±2.88) x 10-3. We have also attempted to find enhancements with MeV neutrons in P-violation due to the term s k. We are preparing an aligned target cryostat for investigations of PevenTodd terms {bd(Ik)(I×k)s} in neutron scattering. The target will be a single crystal cylinder of165Ho cooled to 100 mK in a bath of liquid helium and rotated by a shaft from a room temperature stepping motor. The cylinder will be oriented vertically and the alignment ( c) axis oriented horizontally. Warming or rotation of the sample allows one to separate effects that mimic the sought-after time reversal violating term.

  6. 41 CFR 102-33.165 - What standards must we establish or require (contractually, where applicable) for operation of...

    Science.gov (United States)

    2010-07-01

    ... of Labor's Office of Workers' Compensation Programs at (202) 693-0044. State or foreign laws may... Section 102-33.165 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 33-MANAGEMENT OF GOVERNMENT AIRCRAFT Managing...

  7. 33 CFR 165.1315 - Safety Zones: Fireworks displays in the Captain of the Port Portland Zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones: Fireworks displays... Coast Guard District § 165.1315 Safety Zones: Fireworks displays in the Captain of the Port Portland Zone. (a) Safety zones. The following areas are designated safety zones: (1) Cinco de Mayo Fireworks...

  8. 78 FR 5209 - 165th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2013-01-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF LABOR Employee Benefits Security Administration 165th Meeting of the Advisory Council on Employee Welfare and Pension... Council on Employee Welfare and Pension Benefit Plans (also known as the ERISA Advisory Council) will be...

  9. 33 CFR 165.804 - Snake Island, Texas City, Texas; mooring and fleeting of vessels-safety zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Snake Island, Texas City, Texas... Guard District § 165.804 Snake Island, Texas City, Texas; mooring and fleeting of vessels—safety zone. (a) The following is a safety zone: (1) The west and northwest shores of Snake Island; (2) The...

  10. Atypical Friedreich ataxia in patients with FXN p.R165P point mutation or comorbid hemochromatosis

    DEFF Research Database (Denmark)

    Ygland, Emil; Taroni, Franco; Gellera, Cinzia

    2014-01-01

    BACKGROUND: Compound heterozygosity for a trinucleotide repeat expansion and a point mutation in the FXN gene is a rare cause of Friedreich ataxia (FRDA). METHODS: We identified three Swedish FRDA patients with an FXN p.R165P missense mutation and compared their clinical features with six...

  11. 33 CFR 165.1310 - Strait of Juan de Fuca and adjacent coastal waters of Northwest Washington; Makah Whale Hunting...

    Science.gov (United States)

    2010-07-01

    ... adjacent coastal waters of Northwest Washington; Makah Whale Hunting-Regulated Navigation Area. 165.1310... and adjacent coastal waters of Northwest Washington; Makah Whale Hunting—Regulated Navigation Area. (a.... Datum: NAD 1983. (b) During a whale hunt, while the international numeral pennant five (5) is flown by a...

  12. 33 CFR 165.820 - Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Ohio River Mile... Guard District § 165.820 Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania. (a) Location. The following area is a security zone: The waters of the Ohio River, extending 200 feet from the...

  13. 42 CFR 410.165 - Payment for rural health clinic services and ambulatory surgical center services: Conditions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Payment for rural health clinic services and... (SMI) BENEFITS Payment of SMI Benefits § 410.165 Payment for rural health clinic services and ambulatory surgical center services: Conditions. (a) Medicare Part B pays for covered rural health clinic and...

  14. 41 CFR 102-38.165 - Are the terms and conditions in the offer to sell binding?

    Science.gov (United States)

    2010-07-01

    ... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Offer to Sell § 102-38.165 Are the terms and conditions... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are the terms and...

  15. TMEM165 deficiencies in Congenital Disorders of Glycosylation type II (CDG-II): Clues and evidences for roles of the protein in Golgi functions and ion homeostasis.

    Science.gov (United States)

    Dulary, Eudoxie; Potelle, Sven; Legrand, Dominique; Foulquier, François

    2017-04-01

    Congenital Disorders of Glycosylation (CDG) are rare inherited diseases causing glycosylation defects responsible for severe growth and psychomotor retardations in patients. Whereas most genetic defects affect enzymes directly involved in the glycosylation process, like glycosyltransferases or sugar transporters, recent findings revealed the impact of gene mutations on proteins implicated in both Golgi vesicular trafficking and ion homeostasis. TMEM165 is one of these deficient Golgi proteins found in CDG patients whose function in the secretory pathway has been deduced from several recent studies using TMEM165 deficient mammalian cells or yeast cells deficient in Gtd1p, the yeast TMEM165 ortholog. These studies actually confirm previous observations based on both sequence and predicted topology of this transmembrane protein and the phenotypes of human and yeast cells, namely that TMEM165 is very probably a transporter involved in ion homeostasis. Whereas the exact function of TMEM165 remains to be fully characterized, several studies hypothesize that TMEM165 could be a Golgi localized Ca2+/H+ antiporter. However, recent data also support the role of TMEM165 in Golgi Mn2+ homeostasis then arguing for a putative role of Mn2+ transporter for TMEM165 essential to achieve the correct N-glycosylation process of proteins in the secretory pathway. This manuscript is a review of the current state of knowledge on TMEM165 deficiencies in Congenital Disorders of Glycosylation as well as new data on function of TMEM165 and some speculative models on TMEM165/Golgi functions are discussed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Production of 16.5% v/v ethanol from seagrass seeds.

    Science.gov (United States)

    Uchida, Motoharu; Miyoshi, Tatsuo; Kaneniwa, Masaki; Ishihara, Kenji; Nakashimada, Yutaka; Urano, Naoto

    2014-12-01

    Ethanol fermentation on seeds of seagrass Zostera marina was studied. The seeds were collected from the annual plant colony of Z. marina at Hinase Bay, Okayama. The seeds contained 83.5% carbohydrates including 48.1% crude starch on a dry weight basis, which is comparable to cereals such as wheat flour and corns. The seeds were saccharified with glucoamylase (50°C, 96 h) and 103.4 g/l concentration of glucose juice was obtained. The glucose juice was further fermented (23°C-35°C, 15 days) with Saccharomyces cerevisiae strains NBRC10217(T) and Kyokai 7-go, and ethanol was obtained at a 65.0 g/l (82.3 ml/l) level by monographic double-fermentation and at a 130.4 g/l (165.1 ml/l) level by parallel double-fermentation. Fermented products of seagrass seeds containing such a high ethanol concentration as the present study have potential to be utilized not only for biofuel but also for foods and beverages in the future. Culturing of seagrass seeds as a crop may enable development of a new marine fermentation industry. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  17. Multi-shock Shield Performance at 16.5 MJ for Catalogued Debris

    Science.gov (United States)

    Miller, J. E.; Christiansen, E. L.; Davis, B. A.

    2014-01-01

    While orbital debris of ten centimeters or more are tracked and catalogued, the difficulty of finding and accurately accounting for forces acting on the objects near the ten centimeter threshold results in both uncertainty of their presence and location. These challenges result in difficult decisions for operators balancing potential costly operational approaches with system loss risk. In this paper, numerical simulations and an experiment using the multi-shock shield system is described for a cylindrical projectile composed of Nylon, aluminum and void that is approximately 8 cm in diameter and 10 cm in length weighing 670 g impacting the multi-shock shield normal to the surface with approximately 16.5 MJ of kinetic energy. The multi-shock shield system has been optimized to facilitate the fragmentation, spread and deceleration of the projectile remnants using hydrodynamic simulations of the impact event. The characteristics and function of each of the layers of the multi-shock system will be discussed along with considerations for deployment and improvement.

  18. 33 CFR 165.812 - Security Zones; Lower Mississippi River, Southwest Pass Sea Buoy to Mile Marker 96.0, New Orleans...

    Science.gov (United States)

    2010-07-01

    ... River, Southwest Pass Sea Buoy to Mile Marker 96.0, New Orleans, LA. 165.812 Section 165.812 Navigation..., Southwest Pass Sea Buoy to Mile Marker 96.0, New Orleans, LA. (a) Location. Within the Lower Mississippi... Mississippi River mile marker 96.0 in New Orleans, Louisiana. These moving security zones encompass all waters...

  19. VEGF(165) and bFGF protein-based therapy in a slow release system to improve angiogenesis in a bioartificial dermal substitute in vitro and in vivo

    NARCIS (Netherlands)

    Wilcke, I.; Lohmeyer, J. A.; Liu, S.; Condurache, A.; Krueger, S.; Mailaender, P.; Machens, H. G.

    Background Angiogenesis can be enhanced by several growth factors, like vascular endothelial growth factor-165 (VEGF(165)) and basic fibroblast growth factor (bFGF). Delayed release of such growth factors could be provided by incorporation of growth factors in fibrin matrices. In this study, we

  20. Microspheres of poly({epsilon}-caprolactone) loaded Holmium-165: morphology and thermal degradation behavior

    Energy Technology Data Exchange (ETDEWEB)

    Geraldes, Adriana Napoleao; Miyamoto, Douglas Massao; Lira, Raphael Arivar de; Osso Junior, Joao Alberto; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Polycaprolactone (PCL), being one of the most important biocompatible and biodegradable aliphatic polyester, provides many potential biomedical. The preparation of biodegradable materials, polymer-based microspheres, is being developed by our group and the goal is to prepare and label with Ho-165 different polymer-based microspheres. The use of radionuclide-loaded microspheres is a promising treatment of liver malignancies. PCL microspheres can be loaded with holmium acetylacetonate (HoAcAc). PCL and PCL/HoAcAc microspheres were prepared by an emulsion solvent extraction/evaporation technique. The PCL/ HoAcAc microspheres were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP to radionuclide activation. Gamma irradiation was performed at 25 and 50 kGy doses. The microspheres were evaluated by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TG), Fourier transformed infrared spectroscopy (FTIR), scanning electron microscopy (SEM) and con focal laser scanning microscopy (CLSM). In the CLSM images were observed emission in 488 nm characteristic of holmium. The SEM surface image of PCL/HoAcAc microspheres showed more roughness than PCL microspheres. TG of PCL/HoAcAc microspheres showed a substantial weight loss above 200 degree C, indicating decomposition of HoAcAc. The residual weight indicates the presence of Ho{sub 2}O{sub 3}. Gamma irradiation at 25 and 50 kGy doses had no effect on the PCL/HoAcAc microspheres, which indicates that the chemical composition of the microspheres had not change. (author)

  1. 33 CFR 165.504 - Newport News Shipbuilding and Dry Dock Company Shipyard, James River, Newport News, Va.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Newport News Shipbuilding and Dry... Coast Guard District § 165.504 Newport News Shipbuilding and Dry Dock Company Shipyard, James River... the Newport News Shipbuilding and Dry Dock Co. at latitude 37°00′38.1″ N, longitude 76°27′05.7″ W...

  2. First Experience With the ICD 16.5 Mini-Scleral Lens for Optic and Therapeutic Purposes.

    Science.gov (United States)

    Suarez, Cyrielle; Madariaga, Virginie; Lepage, Benoît; Malecaze, Marie; Fournié, Pierre; Soler, Vincent; Galiacy, Stéphane; Mély, René; Cassagne, Myriam; Malecaze, François

    2018-01-01

    To evaluate the success rate, efficacy, and safety of the ICD 16.5 mini-scleral gas permeable (GP) contact lens. This prospective study included referred consecutive patients with irregular corneas and severe ocular surface disease (OSD) in treatment failure. All patients were fitted with the ICD 16.5 mini-scleral GP lens. Even though we had some limited experience with scleral lenses, it was our first experience with the ICD 16.5 mini-scleral GP lens. Efficacy was assessed by comparing best-corrected visual acuity (BCVA) with the mini-scleral lens to baseline BCVA. A subjective visual functioning questionnaire (comfort score, visual quality score, handling rating, and wearing time) was administered in a face-to-face structured interview. Thirty-nine eyes of 23 patients with a mean age of 43±16 years were included. Fitting indications were keratoconus (46%), post-penetrating keratoplasty (21%), other irregular astigmatism (15%), and severe OSD (18%). Twenty-five eyes (64%) were successfully fitted with an 18-month follow-up. The mini-scleral GP lens BCVA was 0.16 logarithm of the minimum angle of resolution (logMAR; 20/25) versus a baseline BCVA of 0.44 logMAR (20/63; P<0.001). Comfort and visual quality scores were 8.5/10 and 7.5/10, respectively. No complications were detected in 96% of the eyes (95% confidence interval, 76.1%-99.4%). One eye experienced corneal graft swelling. The present findings suggest that the ICD 16.5 mini-scleral GP lens is an effective and safe alternative for managing challenging corneas in a therapeutic impasse.

  3. Identification of NEK3 Kinase Threonine 165 as a Novel Regulatory Phosphorylation Site That Modulates Focal Adhesion Remodeling Necessary for Breast Cancer Cell Migration.

    Science.gov (United States)

    Harrington, Katherine M; Clevenger, Charles V

    2016-10-07

    Accumulating evidence supports a role for prolactin (PRL) in the development and progression of human breast cancer. Although PRL is an established chemoattractant for breast cancer cells, the precise molecular mechanisms of how PRL regulates breast cancer cell motility and invasion are not fully understood. PRL activates the serine/threonine kinase NEK3, which was reported to enhance breast cancer cell migration, invasion, and the actin cytoskeletal reorganization necessary for these processes. However, the specific mechanisms of NEK3 activation in response to PRL signaling have not been defined. In this report, a novel PRL-inducible regulatory phosphorylation site within the activation segment of NEK3, threonine 165 (Thr-165), was identified. Phosphorylation at NEK3 Thr-165 was found to be dependent on activation of the extracellular signal-regulated kinase 1/2 (ERK1/2) signaling pathway using both pharmacological inhibition and siRNA-mediated knockdown approaches. Strikingly, inhibition of phosphorylation at NEK3 Thr-165 by expression of a phospho-deficient mutant (NEK3-T165V) resulted in increased focal adhesion size, formation of zyxin-positive focal adhesions, and reorganization of the actin cytoskeleton into stress fibers. Concordantly, NEK3-T165V cells exhibited migratory defects. Together, these data support a modulatory role for phosphorylation at NEK3 Thr-165 in focal adhesion maturation and/or turnover to promote breast cancer cell migration. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  4. Inhibition of Ectopic Arginine Vasopressin Production by Phenytoin in the Small Cell Lung Cancer Cell Line Lu-165

    Directory of Open Access Journals (Sweden)

    Masaru Shoji

    2017-04-01

    Full Text Available Phenytoin, a voltage-gated sodium channel (NaV channel antagonist, reportedly inhibits arginine vasopressin (AVP release from an isolated rat neurohypophysis. So far, it is uncertain whether phenytoin has a direct action on ectopic AVP-producing neuroendocrine tumors. We studied the effect of phenytoin on the release of copeptin, the C-terminal fragment of pro-AVP, and expression of AVP gene in the human small cell lung cancer cell line Lu-165. Cells were maintained in RPMI1640 medium with 10% fetal bovine serum and were used within the fifth passage. Copeptin was detected using a new sandwich immunoassay, and AVP mRNA levels were measured using real-time reverse transcription polymerase chain reaction. Treatment with phenytoin at a concentration of 25 µg/mL, but not at 5 or 10 µg/mL, had an inhibitory effect on copeptin levels in the medium at 48 h. At the same concentration, AVP mRNA levels in Lu-165 cells also decreased. Although a sodium challenge with added sodium at 20 mEq/L increased copeptin levels in the medium, a sodium challenge with added sodium at 10 and 20 mEq/L had no effect on AVP mRNA levels. Phenytoin at a concentration of 25 µg/mL suppressed copeptin levels in the medium under the sodium challenge with added sodium at 10 and 20 mEq/L. Phenytoin at a concentration of 25 µg/mL also decreased AVP mRNA levels in Lu-165 cells under the sodium challenge with added sodium at 10 mEq/L, but not at 20 mEq/L. Among five tested NaV channel subunits, NaV1.3 was highly expressed in Lu-165 cells. However, phenytoin significantly decreased NaV1.3 mRNA levels under the sodium challenge with added sodium at 10 and 20 mEq/L. These results suggest that Lu-165 cells are sensitive to phenytoin and sodium to control of AVP release and its gene expression. Phenytoin might have a direct action on ectopic AVP-producing tumors, suggesting the importance of NaV channels in AVP-producing neuroendocrine tumors.

  5. New outburst of the symbiotic nova AG Pegasi after 165 yr

    Science.gov (United States)

    Skopal, A.; Shugarov, S. Yu.; Sekeráš, M.; Wolf, M.; Tarasova, T. N.; Teyssier, F.; Fujii, M.; Guarro, J.; Garde, O.; Graham, K.; Lester, T.; Bouttard, V.; Lemoult, T.; Sollecchia, U.; Montier, J.; Boyd, D.

    2017-08-01

    Context. AG Peg is known as the slowest symbiotic nova, which experienced its nova-like outburst around 1850. After 165 yr, during June of 2015, it erupted again showing characteristics of the Z And-type outburst. Aims: The primary objective is to determine basic characteristics, the nature and type of the 2015 outburst of AG Peg. Methods: We achieved this aim by modelling the spectral energy distribution using low-resolution spectroscopy (330-750 nm; R = 500-1000), medium-resolution spectroscopy (420-720 nm; R 11 000), and UBVRCIC photometry covering the 2015 outburst with a high cadence. Optical observations were complemented with the archival HST and FUSE spectra from the preceding quiescence. Results: During the outburst, the luminosity of the hot component was in the range of 2-11 × 1037 (d/ 0.8 kpc)2 erg s-1, being in correlation with the light curve (LC) profile. To generate the maximum luminosity by the hydrogen burning, the white dwarf (WD) had to accrete at 3 × 10-7 M⊙ yr-1, which exceeds the stable-burning limit and thus led to blowing optically thick wind from the WD. We determined its mass-loss rate to a few × 10-6 M⊙ yr-1. At the high temperature of the ionising source, 1.5-2.3 × 105 K, the wind converted a fraction of the WD's photospheric radiation into the nebular emission that dominated the optical. A one order of magnitude increase of the emission measure, from a few × 1059 (d/ 0.8 kpc)2 cm-3 during quiescence, to a few × 1060 (d/ 0.8 kpc)2 cm-3 during the outburst, caused a 2 mag brightening in the LC, which is classified as the Z And-type of the outburst. Conclusions: The very high nebular emission and the presence of a disk-like H I region encompassing the WD, as indicated by a significant broadening and high flux of the Raman-scattered O vi 6825 Å line during the outburst, is consistent with the ionisation structure of hot components in symbiotic stars during active phases. Full Table 1 and Table 6 are only available at the CDS are

  6. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from TAO165E8S and TAO165E_8S in the South Pacific Ocean from 2009-06-22 to 2011-11-15 (NODC Accession 0117073)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0117073 includes chemical, meteorological, physical and time series data collected from TAO165E8S and TAO165E_8S in the South Pacific Ocean from...

  7. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    INTRODUCTION. Fluorescent materials, particularly blue fluorescent materials have gained strong interest because ... emitting complexes in different technical applications, such as emitting materials for organic light emitting ..... properties of three novel two-dimensional lanthanide coordination polymers with mixed aromatic ...

  8. Pyroelectric Ferroelectric and Resistivity Studies on Samarium ...

    African Journals Online (AJOL)

    Barium Strontium Sodium Niobate (Ba1-xSrx)2NaNb5O15 (BSNN) belongs to tungsten bronze ferroelectric morphotrophic phase boundary (MPB) system at x = 0.6, having large spontaneous polarisation, pyroelectric coefficient and low dielectic constant and is expected to be applicable for piezoceramic filter and ...

  9. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    emitting complexes in different technical applications, such as emitting materials for organic light emitting diodes, sensitizers in solar energy conversion, chemical sensors and so forth [6-9]. The ability of bipy to act as a rigid ..... properties of three-dimensional organic-inorganic hybrids based on α-metatungstate. Inorg. Chim.

  10. Molecular characterization of a DNA fragment harboring the replicon of pBMB165 from Bacillus thuringiensis subsp tenebrionis

    OpenAIRE

    Yu Ziniu; Han Dongmei; Wang Li; Van der Auwera Géraldine A; Mahillon Jacques; Guo Suxia; Huang Junyan; Sun Ming

    2006-01-01

    Abstract Background Bacillus thuringiensis belongs to the Bacillus cereus sensu lato group of Gram-positive and spore-forming bacteria. Most isolates of B. thuringiensis can bear many endogenous plasmids, and the number and size of these plasmids can vary widely among strains or subspecies. As far as we know, the replicon of the plasmid pBMB165 is the first instance of a plasmid replicon being isolated from subsp. tenebrionis and characterized. Results A 20 kb DNA fragment containing a plasmi...

  11. Thermodynamic Properties of Low-Density {}^{132}Xe Gas in the Temperature Range 165-275 K

    Science.gov (United States)

    Akour, Abdulrahman

    2018-01-01

    The method of static fluctuation approximation was used to calculate selected thermodynamic properties (internal energy, entropy, energy capacity, and pressure) for xenon in a particularly low-temperature range (165-270 K) under different conditions. This integrated microscopic study started from an initial basic assumption as the main input. The basic assumption in this method was to replace the local field operator with its mean value, then numerically solve a closed set of nonlinear equations using an iterative method, considering the Hartree-Fock B2-type dispersion potential as the most appropriate potential for xenon. The results are in very good agreement with those of an ideal gas.

  12. Effect of Intranasally Delivered rh-VEGF165 on Angiogenesis Following Cerebral Hypoxia-Ischemia in the Cerebral Cortex of Newborn Piglets

    Directory of Open Access Journals (Sweden)

    Amit Jain

    2017-11-01

    Full Text Available Background: Vascular endothelial growth factor (VEGF stimulates vascular genesis and angiogenesis. Cerebral Hypoxia-Ischemia (HI leads to the reduction of vasculature in the cerebral cortex of newborn piglets. Objective: The present study tests the hypothesis that post-hypoxia intranasal administration of recombinant human VEGF165 (rh-VEGF165 for 3 days increases the vascular density in the cerebral cortex of newborn piglets without promoting neovascularization. Design/Methods: Ventilated newborn piglets were divided into three groups (n = 5/group: normoxic (Nx, hypoxic-ischemic (HI, and HI treated with intranasal rh-VEGF165rh-VEGF165 (HI-VEGF. HI piglets were exposed to HI (0.05 FiO2 for 30 min. Recombinant h-VEGF165 (100 ng/kg was administered 15 min after HI and then once daily for 3 days. The animals were perfused transcardially and coronal brains sections were processed for Isolectin, Hoechst, and ki-67 cell proliferation marker staining. To assess the vascular density, 30–35 fields per animal section were manually counted using image J software. Results: The vascular density (vessels/mm2 was 42.0 ± 8.0 in the Nx group, 26.4 ± 4.8 (p < 0.05 vs. Nx in the HI group, and 46.0 ± 11.9 (p < 0.05 vs. HI in the HI-VEGF group. When stained for newly formed vessels, via Ki-67 staining, the vascular density was 5.4 ± 3.6 in the Nx group (p < 0.05 vs. HI, 10.2 ± 2.1 in the HI group, and 10.9 ± 2.9 in the HI-VEGF group (p = 0.72 vs. HI. HI resulted in a decrease in vascular density. Intranasal rh-VEGF165rh-VEGF165 resulted in the attenuation of the HI-induced decrease in vascular density. However, rh-VEGF165 did not result in the formation of new vascularity, as evident by ki-67 staining. Conclusions: Intranasal rh-VEGF165 may prevent the HI-induced decrease in the vascular density of the brain and could serve as a promising adjuvant therapy for hypoxic-ischemic encephalopathy (HIE.

  13. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT165: AREA 25 AND 26 DRY WELL AND WASH DOWN AREAS, NEVADA TEST SITE, NEVADA

    Energy Technology Data Exchange (ETDEWEB)

    BECHTEL NEVADA

    2005-12-01

    This Closure Report (CR) documents the closure activities for Corrective Action Unit (CAU) 165, Area 25 and 26 Dry Well and Washdown Areas, according to the Federal Facility Agreement and Consent Order (FFACO) of 1996. CAU 165 consists of 8 Corrective Action Sites (CASs) located in Areas 25 and 26 of the Nevada Test Site (NTS). The NTS is located approximately 105 kilometers (65 miles) northwest of Las Vegas, nevada. Site closure activities were performed according to the Nevada Division of Environmental Protection (NDEP)-approved Corrective Action Plan (CAP) for CAU 165. CAU 165 consists of the following CASs: (1) CAS 25-07-06, Train Decontamination Area; (2) CAS 25-07-07, Vehicle Washdown; (3) CAS 25-20-01, Lab Drain Dry Well; (4) CAS 25-47-01, Reservoir and French Drain; (5) CAS 25-51-02, Drywell; (6) CAS 25-59-01, Septic System; (7) CAS 26-07-01, Vehicle Washdown Station; and (8) CAS 26-59-01, Septic System. CAU 165, Area 25 and 26 Dry Well and Washdown Areas, consists of eight CASs located in Areas 25 and 26 of the NTS. The approved closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls.

  14. Sustained-released mixture of vascular endothelial growth factor 165 and fibrin glue strengthens healing of ileal anastomoses in a rabbit model with intraperitoneal infection.

    Science.gov (United States)

    Li, Zhanwu; Wang, Wenjun; Wang, Xiaozhou; Jiang, Lei; Wang, Fengyi; Liu, Qiang

    2017-09-01

    To investigate the effects of a sustained-released mixture of vascular endothelial growth factor 165 (VEGF165) and fibrin glue (FG) local administration on postoperative rabbit ileal anastomoses. One hundred twenty-eight male and female New Zealand white rabbits underwent intraperitoneal infection subsequent ileal anastomosis surgery were divided randomly into 4 groups, including 32 animals in each, applied with saline solution, FG, rhVEGF165 and a mixture of rhVEGF165 with FG (VEGF + FG) on the anastomoses, respectively. The incidences of anastomotic leakage were observed. Histopathological examination for inflammatory infiltration, fibroblast proliferation, and capillary vascular proliferation were performed. Then, bursting pressure and hydroxyproline concentrations were assessed in anastomoses sits on postoperative days 3, 5, 7, and 14. Rabbits in VEGF + FG group had the lowest incidence of leakage (P < 0.05). Histological evaluations revealed that granulation tissue was formed on days 5 after anastomosis; fibroblast proliferation and capillary vascular proliferation were significantly increased on days 7 and 14 in VEGF + FG group. Furthermore, there was a statistically significant difference in the mean bursting pressures between VEGF + FG group and other groups on days 7 and 14 (P < 0.05), and rabbits in VEGF + FG group exhibited a higher concentration than VEGF group (P < 0.05) and FG group (P < 0.05) on day 14. Administration of VEGF165 mixed with FG to ileal anastomosis accelerates wound healing and enhances the anastomosis by increased angiogenesis.

  15. A Prospective Randomized Double-Blind Study Evaluating UP165 and S-Adenosyl-l-Methionine on Depression, Anxiety and Psychological Well-Being

    Directory of Open Access Journals (Sweden)

    Douglas S. Kalman

    2015-05-01

    Full Text Available The primary objective of this pilot clinical trial was to evaluate the effects of UP165 (derived from Zea mays L., commonly known as corn over time. The secondary objective was the comparison for outcomes versus S-adenosyl-methionine (SAM-e. Subjects with mild depression or anxiety were given the Beck Depression Inventory second edition (BDI-II, the Beck Anxiety Inventory (BAI, and the Schwartz Outcome Scale (SOS-10. Forty-two subjects (21–65 years old were randomized to eight-weeks of supplementation with UP165 or SAM-e with questionnaires being administered at randomization, week four and eight. Those receiving UP165 achieved significant reduction from baseline at weeks four and eight, respectively for the BDI-II, as well as a trend for reduction in BAI at week four and significance at week eight. There was a trend for improvement on the SOS at week four and significance at week eight. SAM-e demonstrated a trend for improvement on the BDI-II by week eight over the UP165 with no differences between the two for the BAI or the SOS. Overall, this study indicates that there may be benefit to UP165 for mood enhancement in those with mild depression or anxiety. Randomized placebo comparator trials appear warranted.

  16. Tratamiento del prolapso rectal en la infancia con infiltración de solución salina al 16,5 % Treatment of the prolapse of the rectum in childhood with 16,5 % saline solution infiltration

    Directory of Open Access Journals (Sweden)

    Carlos Ramírez Pérez

    2011-09-01

    Full Text Available Introducción: cuando falla el tratamiento médico conservador en los pacientes pediátricos con prolapso rectal se impone la infiltración perirrectal con sustancias irritantes. En la década de los 90 esas infiltraciones en nuestro centro se hacían con glicerina, pero escaseó en el mercado, y ante tal problema, se buscó otro agente infiltrante alternativo. En el presente trabajo se describe la experiencia con la utilización de solución salina al 16,5 %. Métodos: se realizó un estudio de intervención, longitudinal, prospectivo, experimental, del tipo ensayo clínico no controlado. Consta de una segunda parte en la que se utilizó la aleatorización con un grupo control para la validación. El universo estuvo constituido por 27 pacientes y la muestra, por 16 pacientes con prolapso rectal, que fueron atendidos en el servicio de gastroenterología del Hospital Pediátrico Provincial de Holguín en el quinquenio 2003-2007. Las variables desarrolladas fueron: concentración idónea para el tratamiento, cantidad de sustancia a infiltrar, complicaciones, recurrencia, número de infiltraciones y curación al año o más. Los resultados se exponen en forma de tablas porcentuales. Resultados: la eficacia con la utilización de solución salina al 16,5 % fue del 100 %, todos los pacientes curaron, y ninguno presentó recurrencia, por lo que no fueron necesarias 2 o más sesiones de tratamiento. Se comentó de un niño que, luego de fallar la infiltración con leche materna en primera opción y fallido también el cerclaje, finalmente resolvió con este método. Las complicaciones fueron relativamente pocas (18,9 %: un absceso, una celulitis y una retención urinaria con necesidad de sondaje durante 2 semanas, sin secuelas posteriores. Se realiz�� aleatorización con igual número de pacientes en quienes se usó la glicerina, los resultados del uso de ambas sustancias fueron muy parecidos, y el número de complicaciones fue ligeramente mayor en

  17. VLBI observations of the RS Canum Venaticorum binary systems UX Arietis and HR 1099 at 1.65 GHz

    Science.gov (United States)

    Mutel, R. L.; Doiron, D. J.; Phillips, R. B.; Lestrade, J. F.

    1984-01-01

    VLBI observations of the RS CVn binaries UX Arietis and HR 1099 have been made at 1.65 GHz using a three-element array with a minimum fringe spacing of 11.5 milli-arcsec. Both sources were found to be unresolved within measurement uncertainties. In both cases, the derived upper limit to the source size was comparable to the overall size of each binary system. The lower limits to the brightness temperature were 1.4 x 10 to the 10th K for UX Arietis and 2.9 x 10 to the 10th K for HR 1099. Simultaneous polarization measurements at the VLA showed 4-8 percent circular polarization and less than 2 percent linear polarization. It is found that the data are consistent with gyrosynchrotron emission from a power-law energy distribution of electrons in a magnetic field B less than or approximately equal to 6 gauss.

  18. Asperlones A and B, dinaphthalenone derivatives from a mangrove endophytic fungus Aspergillus sp. 16-5C.

    Science.gov (United States)

    Xiao, Ze'en; Lin, Shao'e; Tan, Chunbing; Lu, Yongjun; He, Lei; Huang, Xishan; She, Zhigang

    2015-01-13

    Racemic dinaphthalenone derivatives, (±)-asperlone A (1) and (±)-asperlone B (2), and two new azaphilones, 6'-hydroxy-(R)-mitorubrinic acid (3) and purpurquinone D (4), along with four known compounds, (-)-mitorubrinic acid (5), (-)-mitorubrin (6), purpurquinone A (7) and orsellinic acid (8), were isolated from the cultures of Aspergillus sp. 16-5C. The structures were elucidated using comprehensive spectroscopic methods, including 1D and 2D NMR spectra and the structures of 1 further confirmed by single-crystal X-ray diffraction analysis, while the absolute configuration of 3 and 4 were determined by comparing their optical rotation and CD with those of the literature, respectively. Compounds 1, 2 and 6 exhibited potent inhibitory effects against Mycobacterium tuberculosis protein tyrosine phosphatase B (MptpB) with IC50 values of 4.24 ± 0.41, 4.32 ± 0.60 and 3.99 ± 0.34 μM, respectively.

  19. Determination of specific radioactivity of samarium-153 product. 1. Quantitative determination of samarium by spectrophotometry

    Energy Technology Data Exchange (ETDEWEB)

    Izumo, Mishiroku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nemoto, Masahiro [Tokyo Nuclear Service Co., Ltd., Tokyo (Japan)

    2002-03-01

    On the specific radioactivity of Sm-153 for the radiotherapy of cancers, a simple method for determination of the amount of Sm was described. The method used Arsenazo III as a colorimetric reagent. The sample irradiated in the reactor was dissolved in 1M HCl solution. A small part of it was taken and mixed with Arsenazo III at pH 3.2, and the amount of Sm was determined by the spectrophotometric method at a wavelength of 652 nm. The molar absorptivity of Sm at 652 nm was 6.6x10{sup 3} m{sup -1}{center_dot}mm{sup -1}. The error of measurement in the partial different conditions was about 2% of the value determined. The effects of impurities, Fe, Zn and Cu mixing in the Sm during operation, were clarified. (author)

  20. Clinical trial of {sup 165}Dy-HMA and {sup 166}Ho-CHICO in the treatment of Rheumatoid knee synovitis

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S. Y.; Yoo, D. H.; Bae, S. C.; Jun, J. B. [Hanyang University, Seoul (Korea, Republic of); Lim, S. M.; Hong, S. W.; Lee, S. Y.; Cheon, D. G.; Kim, S. J. [Korea Cancer Center Hospital, Seoul (Korea, Republic of)

    1997-07-01

    The untreated, chronic synovial inflammation leads to pannus formation and eventual destruction of the articular cartilage. In cases where medical therapy was unsuccessful, surgical or radiation synovectomy is necessary especially in the knee joints. The advantages of radiation synovectomy over surgical synovectomy are (1) greater destruction of diseased synovium, (2) reduced potential for blood clots and infection, (3) no requirement for anesthesia, and (4) less costly and less time consuming. Recently KAERI developed Dy-165 HMA, which was characterized by the absence of iron and a higher concentration of dysprosium. And then more recently KAERI also developed {sup 166}Ho-CHICO, which was characterized by relatively longer half-life(26.8 hr), more biological due to organic nature of chitosan, more even spatial distribution due to colloidal solution and more absorbable to synovium than Dy-165 HMA. We studied to evaluate the efficacy and safety of radiation synovectomy with Dy-165 HMA and {sup 166}Ho-CHICO in chronic rheumatoid synovitis with knee. The present study indicates that the Dy-165 HMA and {sup 166}Ho-CHICO are an effective and safe agent for radiation synovectomy. But further large scaled long-term follow up study and controlled study with steroid only are required. 15 refs. (author)

  1. miR160 and miR166/165 Contribute to the LEC2-Mediated Auxin Response Involved in the Somatic Embryogenesis Induction in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Anna M. Wójcik

    2017-12-01

    Full Text Available MicroRNAs are non-coding small RNA molecules that are involved in the post-transcriptional regulation of the genes that control various developmental processes in plants, including zygotic embryogenesis (ZE. miRNAs are also believed to regulate somatic embryogenesis (SE, a counterpart of the ZE that is induced in vitro in plant somatic cells. However, the roles of specific miRNAs in the regulation of the genes involved in SE, in particular those encoding transcription factors (TFs with an essential function during SE including LEAFY COTYLEDON2 (LEC2, remain mostly unknown. The aim of the study was to reveal the function of miR165/166 and miR160 in the LEC2-controlled pathway of SE that is induced in in vitro cultured Arabidopsis explants.In ZE, miR165/166 controls the PHABULOSA/PHAVOLUTA (PHB/PHV genes, which are the positive regulators of LEC2, while miR160 targets the AUXIN RESPONSE FACTORS (ARF10, ARF16, ARF17 that control the auxin signaling pathway, which plays key role in LEC2-mediated SE. We found that a deregulated expression/function of miR165/166 and miR160 resulted in a significant accumulation of auxin in the cultured explants and the spontaneous formation of somatic embryos. Our results show that miR165/166 might contribute to SE induction via targeting PHB, a positive regulator of LEC2 that controls embryogenic induction via activation of auxin biosynthesis pathway (Wójcikowska et al., 2013. Similar to miR165/166, miR160 was indicated to control SE induction through auxin-related pathways and the negative impact of miR160 on ARF10/ARF16/ARF17 was shown in an embryogenic culture. Altogether, the results suggest that the miR165/166- and miR160-node contribute to the LEC2-mediated auxin-related pathway of embryogenic transition that is induced in the somatic cells of Arabidopsis. A model summarizing the suggested regulatory interactions between the miR165/166-PHB and miR160-ARF10/ARF16/ARF17 nodes that control SE induction in

  2. Inhibitory role of acyl homoserine lactones in hemolytic activity and viability of Streptococcus pyogenes M6 S165

    Science.gov (United States)

    Saroj, Sunil D.; Holmer, Linda; Berengueras, Júlia M.; Jonsson, Ann-Beth

    2017-01-01

    Streptococcus pyogenes an adapted human pathogen asymptomatically colonizes the nasopharynx, among other polymicrobial communities. However, information on the events leading to the colonization and expression of virulence markers subject to interspecies and host-bacteria interactions are limited. The interference of acyl homoserine lactones (AHLs) with the hemolytic activity and viability of S. pyogenes M6 S165 was examined. AHLs, with fatty acid side chains ≥12 carbon atoms, inhibited hemolytic activity by downregulating the expression of the sag operon involved in the production of streptolysin S. Inhibitory AHLs upregulated the expression of transcriptional regulator LuxR. Electrophoretic mobility shift assays revealed the interaction of LuxR with the region upstream of sagA. AHL-mediated bactericidal activity observed at higher concentrations (mM range) was an energy-dependent process, constrained by the requirement of glucose and iron. Ferrichrome transporter FtsABCD facilitated transport of AHLs across the streptococcal membrane. The study demonstrates a previously unreported role for AHLs in S. pyogenes virulence. PMID:28303956

  3. Structural characterization of CYP165D3, a cytochrome P450 involved in phenolic coupling in teicoplanin biosynthesis.

    Science.gov (United States)

    Cryle, Max J; Staaden, Jessica; Schlichting, Ilme

    2011-03-01

    Teicoplanin is a glycopeptide antibiotic with activity against Gram-positive bacteria and remains one of the last lines of clinical defense against certain bacterial infections. We have cloned, expressed, and purified the cytochrome P450 OxyE (CYP165D3) from the teicoplanin biosynthetic gene cluster of Actinoplanes teichomyceticus, which is responsible for the phenolic coupling of the aromatic side chains of the first and third peptide residues in the teicoplanin peptide. The crystal structure of OxyE has been determined to 2.5Å resolution, revealing the probable binding surface for the carrier protein substrate and an extension of the active site into a pocket located above the β-1 sheet. The binding of potential substrates to OxyE shows that peptidyl carrier protein-bound linear peptides bind to OxyE, albeit with low affinity in the absence of a phenolic cross-link that should normally be installed by another Oxy protein in the teicoplanin biosynthetic pathway. This result indicates that the carrier protein alone is not sufficient for tight substrate binding to OxyE and that the Oxy proteins sense the structure of the bound peptide in addition to the presence of the carrier protein, a feature distinct from other carrier protein/P450 systems. Copyright © 2010 Elsevier Inc. All rights reserved.

  4. Asperlones A and B, Dinaphthalenone Derivatives from a Mangrove Endophytic Fungus Aspergillus sp. 16-5C

    Directory of Open Access Journals (Sweden)

    Ze'en Xiao

    2015-01-01

    Full Text Available Racemic dinaphthalenone derivatives, (±-asperlone A (1 and (±-asperlone B (2, and two new azaphilones, 6′-hydroxy-(R-mitorubrinic acid (3 and purpurquinone D (4, along with four known compounds, (−-mitorubrinic acid (5, (−-mitorubrin (6, purpurquinone A (7 and orsellinic acid (8, were isolated from the cultures of Aspergillus sp. 16-5C. The structures were elucidated using comprehensive spectroscopic methods, including 1D and 2D NMR spectra and the structures of 1 further confirmed by single-crystal X-ray diffraction analysis, while the absolute configuration of 3 and 4 were determined by comparing their optical rotation and CD with those of the literature, respectively. Compounds 1, 2 and 6 exhibited potent inhibitory effects against Mycobacterium tuberculosis protein tyrosine phosphatase B (MptpB with IC50 values of 4.24 ± 0.41, 4.32 ± 0.60 and 3.99 ± 0.34 μM, respectively.

  5. The use of injectable sonication-induced silk hydrogel for VEGF165 and BMP-2 delivery for elevation of the maxillary sinus floor

    Science.gov (United States)

    Zhang, Wenjie; Wang, Xiuli; Wang, Shaoyi; Zhao, Jun; Xu, Lianyi; Zhu, Chao; Zeng, Deliang; Chen, Jake; Zhang, Zhiyuan; Kaplan, David L.; Jiang, Xinquan

    2011-01-01

    Sonication-induced silk hydrogels were previously prepared as an injectable bone replacement biomaterial, with a need to improve osteogenic features. Vascular endothelial growth factor (VEGF165) and bone morphogenic protein-2 (BMP-2) are key regulators of angiogenesis and osteogenesis, respectively, during bone regeneration. Therefore, the present study aimed at evaluating in situ forming silk hydrogels as a vehicle to encapsulate dual factors for rabbit maxillary sinus floor augmentation. Sonication-induced silk hydrogels were prepared in vitro and the slow release of VEGF165 and BMP-2 from these silk gels was evaluated by ELISA. For in vivo studies for each time point (4 and 12 weeks), 24 sinus floors elevation surgeries were made bilaterally in 12 rabbits for the following four treatment groups: silk gel (group Silk gel), silk gel/VEGF165 (group VEGF), silk gel/BMP-2 (group BMP-2), silk gel/VEGF165/BMP-2 (group V+B) (n=6 per group). Sequential florescent labeling and radiographic observations were used to record new bone formation and mineralization, along with histological and histomorphometric analysis. At week 4, VEGF165 promoted more tissue infiltration into the gel and accelerated the degradation of the gel material. At this time point, the bone area in group V+B was significantly larger than those in the other three groups. At week 12, elevated sinus floor heights of groups BMP-2 and V+B were larger than those of the Silk gel and VEGF groups, and the V+B group had the largest new bone area among all groups. In addition, a larger blood vessel area formed in the remaining gel areas in groups VEGF and V+B. In conclusion, VEGF165 and BMP-2 released from injectable and biodegradable silk gels promoted angiogenesis and new bone formation, with the two factors demonstrating an additive effect on bone regeneration. These results indicate that silk hydrogels can be used as an injectable vehicle to deliver multiple growth factors in a minimally invasive approach to

  6. Development of a 1.65 μm pulsed laser DIAL System to map atmospheric CH4 distributions

    Science.gov (United States)

    Ismail, S.; Crawford, J. H.; Leifer, I.; Hovis, F.; Hair, J. W.; Brown, L. R.; Hardesty, R.; Fix, A.; Abedin, N.; Devi, V.; Benner, D.; Sung, K.; Diskin, G. S.; Hostetler, C. A.

    2010-12-01

    We present the results of a system study conducted to develop and demonstrate a high sensitivity ground-based and airborne DIAL System for measuring atmospheric CH_{4}. This program addresses the 2007 NRC Decadal Survey recommendation that ‘if appropriate and cost-effective methane technology becomes available, methane capability should be added’ to close the carbon budget. A highly efficient absorber of IR radiation, methane is a potent greenhouse gas with a warming potential 72 times greater than CO_{2} per molecule, over a 20-year horizon. The proposed measurement will enable scientific assessments globally, and in particular of northern latitude CH_{4} emission impacts on climate and enhance understanding of ecosystem response to climate variability and land cover change. This system will provide simultaneous ranging and high resolution measurements of aerosol and cloud distributions. This will incorporate a pulsed 1.65 μm OPO laser; an existing receiver system redesigned to optimize its performance for this wavelength by incorporating an optical filter; a commercially available InGaAs APD and an existing 3-D scanner. High resolution FTIR laboratory spectroscopic measurements in the R4 transitions of 2ν_{3} of CH_{4} will be conducted to maximize accuracy of retrievals. This development demonstrates an azimuthal scanning system for ground-based mapping and monitoring of range-resolved, near-surface CH_{4} emissions and airborne detection of dry CH_{4} boundary layer and total vertical column fractions. Due to its relative insensitivity to aerosol and cloud interferences, this system will be ideal for investigating high latitude CH_{4} releases over polar ice sheets, permafrost regions, wetlands, and over open ocean during night and day as well as commercial applications in of natural gas leaks. The proposed task is applicable to NASA sub-orbital, satellite validation, and venture class programs.

  7. The inhibition and resistance mechanisms of actinonin, isolated from marine Streptomyces sp. NHF165, against Vibrio anguillarum

    Directory of Open Access Journals (Sweden)

    Na Yang

    2016-09-01

    Full Text Available Vibrio sp. is the most serious pathogen in marine aquaculture, and the development of anti-Vibrio agents is urgently needed. However, it is extreme lack of high-throughput screening (HTS model for searching anti-Vibrio compounds. Here, we established a protein-based HTS screening model to identify agents targeting peptide deformylase (PDF of Vibrio anguillarum. To find potential anti-Vibrio compounds, crude extracts derived from marine actinomycetes were applied for screening with this model. Notably, crude extract of strain Streptomyces sp. NHF165 inhibited dramatically both on V. anguillarum PDF (VaPDF activity and V. anguillarum cell growth. And actinonin was further identified as the functional component. Anti-VaPDF and anti-V. anguillarum activities of actinonin were dose-dependent, and the IC50 values were 6.94 M and 2.85 M, respectively. To understand the resistance of V. anguillarum against actinonin, spontaneous V. anguillarum mutants with resistance against actinonin were isolated. Surprisingly, for the resistant strains, the region between 774 and 852 base pairs was found to be absent in the gene folD which produces 10-formyl-tetrahydrofolate, a donor of N-formyl to Met-tRNAfmet. When compared to the wild type strain, folD mutant showed 8 times of minimum inhibition concentration on actinonin, however, the folD complementary strain could not grow on the medium supplemented with actinonin, which suggested that folD gene mutation was mainly responsible for the actinonin resistance. To our knowledge, this is the first report showing that marine derived Streptomyces sp. could produce actinonin with anti-VaPDF activity and the resistance against actinonin by V. anguillarum is mediated by mutation in folD gene.

  8. Prokaryotic Soluble Overexpression and Purification of Human VEGF165 by Fusion to a Maltose Binding Protein Tag.

    Directory of Open Access Journals (Sweden)

    Minh Tan Nguyen

    Full Text Available Human vascular endothelial growth factor (VEGF is a key regulator of angiogenesis and plays a central role in the process of tumor growth and metastatic dissemination. Escherichia coli is one of the most common expression systems used for the production of recombinant proteins; however, expression of human VEGF in E. coli has proven difficult because the E. coli-expressed VEGF tends to be misfolded and forms inclusion bodies, resulting in poor solubility. In this study, we successfully produced semi-preparative amounts of soluble bioactive human VEGF165 (hVEGF. We created seven N-terminal fusion tag constructs with hexahistidine (His6, thioredoxin (Trx, glutathione S-transferase (GST, maltose-binding protein (MBP, N-utilization substance protein A (NusA, human protein disulfide isomerase (PDI, and the b'a' domain of PDI (PDIb'a', and tested each construct for soluble overexpression in E. coli. We found that at 18°C, 92.8% of the MBP-tagged hVEGF to be soluble and that this tag significantly increased the protein's solubility. We successfully purified 0.8 mg of pure hVEGF per 500 mL cell culture. The purified hVEGF is stable after tag cleavage, contains very low levels of endotoxin, and is 97.6% pure. Using an Flk1+ mesodermal precursor cell (MPC differentiation assay, we show that the purified hVEGF is not only bioactive but has similar bioactivity to hVEGF produced in mammalian cells. Previous reports on producing hVEGF in E. coli have all been based on refolding of the protein from inclusion bodies. To our knowledge, this is the first report on successfully expressing and purifying soluble hVEGF in E. coli.

  9. Non-viral VEGF165 gene therapy ? magnetofection of acoustically active magnetic lipospheres (?magnetobubbles?) increases tissue survival in an oversized skin flap model

    OpenAIRE

    Holzbach, Thomas; Vlaskou, Dialekti; Neshkova, Iva; Konerding, Moritz A.; W?rtler, Klaus; Mykhaylyk, Olga; G?nsbacher, Bernd; Machens, H-G; Plank, Christian; Giunta, Riccardo E

    2008-01-01

    Abstract Adenoviral transduction of the VEGF gene in an oversized skin flap increases flap survival and perfusion. In this study, we investigated the potential of magnetofection of magnetic lipospheres containing VEGF165-cDNA on survival and perfusion of ischemic skin flaps and evaluated the method with respect to the significance of applied magnetic field and ultrasound. We prepared perfluoropropane-filled magnetic lipospheres (?magnetobubbles?) from Tween60-coated magnetic nanoparticles, Me...

  10. Asperterpenoid A, a new sesterterpenoid as an inhibitor of Mycobacterium tuberculosis protein tyrosine phosphatase B from the culture of Aspergillus sp. 16-5c.

    Science.gov (United States)

    Huang, Xishan; Huang, Hongbo; Li, Hanxiang; Sun, Xuefeng; Huang, Huarong; Lu, Yongjun; Lin, Yongcheng; Long, Yuhua; She, Zhigang

    2013-02-15

    Asperterpenoid A (1), a novel sesterterpenoid with a new carbon skeleton, has been isolated from a mangrove endophytic fungus Aspergillus sp. 16-5c. Its structure was characterized by extensive spectroscopic methods, and the absolute configuration was determined by single crystal X-ray diffraction analysis. Asperterpenoid A (1) exhibited strong inhibitory activity against Mycobacterium tuberculosis protein tyrosine phosphatase B (mPTPB) with an IC(50) value of 2.2 μM.

  11. β-decay half-lives of neutron-rich nuclei around 158Nd, relevant to the formation of the A≈165 rare-earth element peak

    Directory of Open Access Journals (Sweden)

    Wu J.

    2016-01-01

    Full Text Available A β-decay spectroscopy experiment around 158Nd was performed at RI Beam Factory (RIBF, RIKEN Nishina Center, in order to understand the production mechanism of the A≈165 rare-earth element (REE peak in the r-process mass abundance pattern. In this experiment, 53 half-lives are measured including 34 new results, which could be employed in a fully dynamic r-process network calculation.

  12. Biological activity and colonization pattern of the bioluminescence-labeled plant growth-promoting bacterium Kluyvera ascorbata SUD165/26.

    Science.gov (United States)

    Ma, W; Zalec, K; Glick, B R.

    2001-04-01

    Kluyvera ascorbata SUD165/26 is a spontaneous siderophore-overproducing mutant of K. ascorbata SUD165, which was previously isolated from nickel-contaminated soil and shown to significantly enhance plant growth in soil contaminated with high levels of heavy metals. To develop a better understanding of the functioning of K. ascorbata SUD165/26 in the environment, and to trace its distribution in the rhizosphere, isolates of this bacterium were labeled with either green fluorescent protein or luciferase. When the plant growth-promoting activities of the labeled strains were assayed and compared with the activities of the unlabeled strain, none of the monitored parameters had changed to any significant extent. When the spatial colonization patterns of the labeled bacteria on canola roots were determined after seed application, it was observed that the bacterium was tightly attached to the surface of both roots and seeds, and formed aggregates. The majority of the bacterial population inhabited the upper two thirds of the roots, with no bacteria detected around the root tips.

  13. Structural analysis of alkaline β-mannanase from alkaliphilic Bacillus sp. N16-5: implications for adaptation to alkaline conditions.

    Directory of Open Access Journals (Sweden)

    Yueju Zhao

    Full Text Available Significant progress has been made in isolating novel alkaline β-mannanases, however, there is a paucity of information concerning the structural basis for alkaline tolerance displayed by these β-mannanases. We report the catalytic domain structure of an industrially important β-mannanase from the alkaliphilic Bacillus sp. N16-5 (BSP165 MAN at a resolution of 1.6 Å. This enzyme, classified into subfamily 8 in glycosyl hydrolase family 5 (GH5, has a pH optimum of enzymatic activity at pH 9.5 and folds into a classic (β/α(8-barrel. In order to gain insight into molecular features for alkaline adaptation, we compared BSP165 MAN with previously reported GH5 β-mannanases. It was revealed that BSP165 MAN and other subfamily 8 β-mannanases have significantly increased hydrophobic and Arg residues content and decreased polar residues, comparing to β-mannanases of subfamily 7 or 10 in GH5 which display optimum activities at lower pH. Further, extensive structural comparisons show alkaline β-mannanases possess a set of distinctive features. Position and length of some helices, strands and loops of the TIM barrel structures are changed, which contributes, to a certain degree, to the distinctly different shaped (β/α(8-barrels, thus affecting the catalytic environment of these enzymes. The number of negatively charged residues is increased on the molecular surface, and fewer polar residues are exposed to the solvent. Two amino acid substitutions in the vicinity of the acid/base catalyst were proposed to be possibly responsible for the variation in pH optimum of these homologous enzymes in subfamily 8 of GH5, identified by sequence homology analysis and pK(a calculations of the active site residues. Mutational analysis has proved that Gln91 and Glu226 are important for BSP165 MAN to function at high pH. These findings are proposed to be possible factors implicated in the alkaline adaptation of GH5 β-mannanases and will help to further

  14. High doses of vascular endothelial growth factor 165 safely, but transiently, improve myocardial perfusion in no-option ischemic disease.

    Science.gov (United States)

    Giusti, Imarilde I; Rodrigues, Clarissa G; Salles, Felipe B; Sant'Anna, Roberto T; Eibel, Bruna; Han, Sang W; Ludwig, Eduardo; Grossman, Gabriel; Prates, Paulo Roberto L; Sant'Anna, João Ricardo M; Filho, Guaracy F Teixeira; Markoski, Melissa M; Nesralla, Ivo A; Nardi, Nance B; Kalil, Renato A K

    2013-10-01

    Gene therapy can induce angiogenesis in ischemic tissues. The aim of this study was to assess safety, feasibility, and results, both clinical and on myocardial perfusion, of gene therapy in refractory angina. This was a phase I/II, prospective, temporal-controlled series, clinical trial. Thirteen patients were maintained for minimum 6 months under optimized clinical management, and then received intramyocardial injections of 2000 μg plasmid vascular endothelial growth factor 165 and were followed by single-photon emission computed tomography (SPECT), treadmill tests, Minnesota quality of life questionnaire (QOL), and New York Heart Association (NYHA) functional plus Canadian Cardiovascular Society (CCS) angina classifications. There were no deaths, early or late. During the optimized clinical treatment, we observed worsening of rest ischemia scores on SPECT (p<0.05). After treatment, there was a transitory increase in myocardial perfusion at the third-month SPECT under stress (pre-operative [pre-op] 18.38 ± 7.51 vs. 3 months 15.31 ± 7.30; p<0.01) and at the sixth month under rest (pre-op 13.23 ± 7.98 vs. 6 months: 16.92 ± 7.27; p<0.01). One year after, there were improvements in treadmill test steps (pre-op 2.46 ± 2.07 vs.12 months 4.15 ± 2.23; p<0.01) and oxygen consumption (pre-op 7.66 ± 4.47 vs.12 months 10.89 ± 4.65; p<0.05), QOL (pre-op 48.23 ± 18.35 vs.12 months 28.31 ± 18.14; p<0.01) scores, and CCS (pre-op 3 [3-3.5] vs.12 months 2 [1-2.5]; p<0.01) and NYHA (pre-op 3 [3-3] vs. 2 [2-2] vs. 12 months 2 [1-2]; p<0.01) classes. Gene therapy demonstrated to be feasible and safe in this advanced ischemic cardiomyopathy patient sample. There were improvements in clinical evaluation parameters, and a transitory increase in myocardial perfusion detectable by SPECT scintigraphy. NCT00744315 http://clinicaltrials.gov/

  15. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  16. Stabilization and plant uptake of N from 15N-labelled pea residue 16.5 years after incorporation in soil

    DEFF Research Database (Denmark)

    Laberge, G.; Ambus, P.; Hauggaard-Nielsen, H.

    2006-01-01

    The decline of N from N-15-labelled mature pea residues was followed in unplanted soil over 16.5 yr. Eight years after residue incorporation, 24% of the residue N-15 input was still present in the soil and, after 16.5 yr, 16% of the residue N-15 input remained. A double exponential model...... successfully described the decay of N from N-15-labelled pea residues. The total residual N-15 declined with average decay constants of 1.45 yr(-1) for the 30 d to 1 yr period and of 0.07 yr(-1) for the 1-16 yr period. Sixteen years following incorporation of the residues, indicator plants growing in residues......-amended soils were obtaining 1.7% of their N from residue N. This is, to our knowledge, the longest study on decay of N in soils from N-15-labelled crop residues. The current study thus provides a unique data set for our empirical understanding of N-dynamics in agricultural systems, which is a prerequisite...

  17. The HER2 inhibitor TAK165 Sensitizes Human Acute Myeloid Leukemia Cells to Retinoic Acid-Induced Myeloid Differentiation by activating MEK/ERK mediated RARα/STAT1 axis

    Science.gov (United States)

    Shao, Xuejing; Liu, Yujia; Li, Yangling; Xian, Miao; Zhou, Qian; Yang, Bo; Ying, Meidan; He, Qiaojun

    2016-01-01

    The success of all-trans retinoic acid (ATRA) in differentiation therapy for patients with acute promyelocytic leukemia (APL) highly encourages researches to apply this therapy to other types of acute myeloid leukemia (AML). However, AML, with the exception of APL, fails to respond to differentiation therapy. Therefore, research strategies to further sensitize cells to retinoids and to extend the range of AMLs that respond to retinoids beyond APLs are urgently needed. In this study, we showed that TAK165, a HER2 inhibitor, exhibited a strong synergy with ATRA to promote AML cell differentiation. We observed that TAK165 sensitized the AML cells to ATRA-induced cell growth inhibition, G0/G1 phase arrest, CD11b expression, mature morphologic changes, NBT reduction and myeloid regulator expression. Unexpectedly, HER2 pathway might not be essential for TAK165-enhanced differentiation when combined with ATRA, while the enhanced differentiation was dependent on the activation of the RARα/STAT1 axis. Furthermore, the MEK/ERK cascade regulated the activation of STAT1. Taken together, our study is the first to evaluate the synergy of TAK165 and ATRA in AML cell differentiation and to assess new opportunities for the combination of TAK165 and ATRA as a promising approach for future differentiation therapy. PMID:27074819

  18. Titanium subhydride potassium perchlorate (TiH1.65/KClO4) burn rates from hybrid closed bomb-strand burner experiments.

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, Marcia A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Oliver, Michael S. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2012-08-01

    A hybrid closed bomb-strand burner is used to measure the burning behavior of the titanium subhydride potassium perchlorate pyrotechnic with an equivalent hydrogen concentration of 1.65. This experimental facility allows for simultaneous measurement of the closed bomb pressure rise and pyrotechnic burn rate as detected by electrical break wires over a range of pressures. Strands were formed by pressing the pyrotechnic powders to bulk densities between 60% and 90% theoretical maximum density. The burn rate dependance on initial density and vessel pressure are measured. At all initial strand densities, the burn is observed to transition from conductive to convective burning within the strand. The measured vessel pressure history is further analyzed following the closed bomb analysis methods developed for solid propellants.

  19. Complete and incomplete fusion of $^{12}C$ with $^{165}Ho$ below 7 MeV/nucleon Measurements and analysis of excitation functions

    CERN Document Server

    Gupta, S; Musthafa, M M; Bhardwaj, H D; Prasadl, R

    2000-01-01

    This experiment has been done with a view to studying complete and incomplete fusion in heavy-ion-induced reactions. Excitation functions for several reactions induced by /sup 12/C/sup 5+/ ions on /sup 165/Ho at incident energies from 55 to 80 MeV have been measured using the activation technique. The analysis of the data has been done using the codes ALICE-91 and CASCADE. The parameter F/sub theta /, the ratio of actual moment of inertia to the rigid-body value, has been found to play an important role in the calculations done by the code CASCADE. Significant contributions from both the complete and the incomplete fusion channels have been observed. Further, in the case of the reaction (C, p3n) considerable contribution from the decay of higher charge isobar precursor has been observed. (23 refs).

  20. Identification of a Rare β(0)-Thalassemia Mutation, Codon 54 (-T) (HBB: c.165delT) in an Iranian Family.

    Science.gov (United States)

    Ghasemian Dastjerdy, Nadia; Banihashemi, Ali; Azizi, Mandana; Akhavan-Niaki, Haleh

    2015-01-01

    β-Thalassemia (β-thal) is the most widespread autosomal recessive disorder worldwide. The present study describes a very rare β-globin gene mutation, codon 54 (-T) (HBB: c.165delT), in a family from northern Iran. Nucleotide sequencing of amplified DNA obtained from a 28-year-old man revealed a deletion (-T) at codon 54 of the β-globin gene that results in a nonsense sequence at codon 60 and inphase termination at codon 59. Moreover, the haplotype combination of six different restriction enzyme sites in the β-globin cluster was determined for this mutation. To the best of our knowledge, this is the second article reporting the codon 54 mutation worldwide and the first report of this mutation in the Iranian population, emphasizing the high heterogeneity of this population.

  1. Irradiation creep and void swelling of two LMR heat of HT9 at {approx}400{degrees}C and 165 dpa

    Energy Technology Data Exchange (ETDEWEB)

    Toloczko, M.B. [Univ. of California, Santa Barbara, CA (United States); Garner, F.A. [Pacific Northwest National Laboratory, Richland, WA (United States)

    1996-04-01

    Two nominally identical heats of HT9 ferritic-martensitic steel were produced, fabricated into pressurized tubes, and then irradiated in FFTF, using identical procedures. After reaching 165 dpa at {approx}400C, small differences in strains associated with both phase-related change in lattice parameter and void swelling were observed in comparing the two heats. The creep strains, while different, exhibited the same functional relationship to the swelling behavior. The derived creep coefficients, the one associated with creep in the absence of swelling and the one directly responsive to swelling, were essentially identical for the two heats. Even more significantly, the creep coefficients for this bcc ferritic-martensitic steel appear to be very similar and possibly identical to those routinely derived from creep experiments on fcc austenitic steels.

  2. Scale-Up of World Record 16.5% CdTe Cell Design for a 50 MWp Production Facility: September 27, 2007 - March 26, 2009

    Energy Technology Data Exchange (ETDEWEB)

    Seymour, F. H.

    2011-05-01

    This final report covers progress made on subcontract NAT-7-77015-07 by PrimeStar Solar Inc. for the 18 month period from September 27, 2007 through March 26, 2009. The project objectives were to accelerate the commercialization of the world record 16.5% efficiency cadmium telluride photovoltaic technology. This was done by developing high performance 6"x6" prototype mini-modules and by designing and commissioning a pilot line for manufacturing of commercial sized 60cmx120cm modules. This subcontract aligns with the SAI program by accelerating the development of high efficiency low cost CdTe solar PV module manufacturing. This will contribute to the goal of PV grid parity by 2015. Progress with the deliverables and milestones in this subcontract constitutes progress towards the KPP and milestone objectives for the SAI program.

  3. Uplift-driven sediment redness decrease at ~16.5 Ma in the Yumen Basin along the northeastern Tibetan Plateau

    Science.gov (United States)

    Wang, Weitao; Zhang, Peizhen; Zheng, Wenjun; Zheng, Dewen; Liu, Caicai; Xu, Hongyan; Zhang, Huiping; Yu, Jingxing; Pang, Jianzhang

    2016-07-01

    Significant climate shifts in the northeastern Tibetan Plateau have taken place during the Cenozoic, but the reasons behind them remain unclear. In order to unravel the mechanisms driving these climate changes, proxy data with accurate age constraint are needed. Here we present magnetostratigraphy, sediment color (redness a*, and lightness L*) and grain-size analysis from an early to middle Miocene (~20-15.3 Ma) sediment sequence preserved in the Yumen Basin on the northeastern Tibetan Plateau. In this basin, remarkable increase in lightness, decreases in redness and in ratio of hematite (Hm) to goethite (Gt) took place at ~16.5 Ma. We suggest that these changes result from shorter duration of weathering, climatic wetting, and cooling associated with rapid uplift of the Qilian Shan at the middle Miocene.

  4. Safety and Tolerability of Theta Burst Stimulation versus Single and Paired Pulse Transcranial Magnetic Stimulation: A Comparative Study of 165 Pediatric Subjects

    Directory of Open Access Journals (Sweden)

    Yaejee H Hong

    2015-02-01

    Full Text Available Background: Although single- and paired-pulse (sp/pp transcranial magnetic stimulation (TMS studies are considered minimal risk in adults and children, the safety profile for theta-burst TMS (TBS is unknown.Objective: In this comparative analysis, we explored the rate, severity, and specific symptoms of TMS-related adverse effects (AEs between sp/ppTMS and TBS in subjects between ages 6 and 18 years.Method: Data from 165 participants from 2009-2014 were analyzed. Assessment of AEs was performed based on baseline and post-TMS administration of a symptom-based questionnaire that rated AEs on a 5-level ordinal scale (minimal, mild, moderate, marked, severe. AE rates and severity were compared using Chi Square or Fisher’s Exact Test depending on data characteristics.Result: Overall, no seizures or severe-rated AEs were reported by 165 pediatric participants. The rate of AE in all TBS sessions was 10.5% (n=76, 95% CI: 4.7 - 19.7%, whereas the rate of AE in all sp/ppTMS sessions was 12.4% (n=89, 95% CI: 6.3 - 21.0%. There was no statistical difference in AE rates between TBS and sp/ppTMS (p=0.71. In all sp/ppTMS and TBS sessions, 20 subjects reported a total of 35 AEs, among these 31 (~88.6% were rated as minimal or mild. There was no difference in the severity of AE between TBS and sp/ppTMS (p=1.0. Only one of 76 TBS participants reported an AE rated as more than minimal/mild.Conclusion: Our comparative analysis showed that TBS appears to be as safe as sp/ppTMS in terms of AE rate and severity. This report supports further investigation of TBS in children.

  5. Production cross sections of elements near the N=126 shell in Ca48-induced reactions with Gd154,Tb159,Dy162, and Ho165 targets

    Science.gov (United States)

    Mayorov, D. A.; Werke, T. A.; Alfonso, M. C.; Bennett, M. E.; Folden, C. M.

    2014-08-01

    Excitation functions for shell-stabilized evaporation residues produced in Ca48-induced reactions with Gd154,Tb159,Dy162, and Ho165 targets have been measured in experiments performed at the Cyclotron Institute at Texas A&M University. The examined energy range predominantly covers the 3n and 4n evaporation channels with higher cross sections measured for the 4n products. The σ4n are nearly invariant within experimental uncertainty in reactions with Tb159,Dy162, and Ho165 with the maxima at 12.6 ± 1.9, 12.6 ± 1.7, and 9.4 ± 1.3 mb, respectively. For the reaction with Gd154, the maximum is slightly lower at 4.0 ± 0.6 mb. A simple model to describe the measured production cross sections was employed. Capture was estimated by using the "diffused barrier formula" from the "fusion by diffusion" model proposed by Świątecki et al. [Phys. Rev. C 71, 014602 (2005)]., 10.1103/PhysRevC.71.014602 The fusion probability was estimated by using a phenomenological expression presented by Siwek-Wilczyńska et al. [Int. J. Mod. Phys. E 17, 12 (2008)]., 10.1142/S0218301308009501 The survival probability was calculated according to the formula of Vandenbosch and Huizenga [Nuclear Fission (Academic, New York, 1973)], derived from transition-state theory. The best agreement is reached between calculation and experiment upon inclusion of collective effects in the calculation of the survival probability, shown previously to be important for production of weakly deformed nuclei. This, in turn, challenges the expectation that strong shell stabilization benefits the production cross section. The present data are compared with earlier studies on production of neutron-deficient nuclei in Ca-induced reactions with lanthanide targets.

  6. 46 CFR 154.625 - Design temperature below 0 °C (32 °F) and down to −165 °C (−265 °F).

    Science.gov (United States)

    2010-10-01

    ... LIQUEFIED GASES Design, Construction and Equipment Materials § 154.625 Design temperature below 0 °C (32 °F... 46 Shipping 5 2010-10-01 2010-10-01 false Design temperature below 0 °C (32 °F) and down to â165... process piping for a design temperature below 0 °C (32 °F) and down to −165 °C (−265 °F) must meet § 56.50...

  7. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    2016-10-07

    Oct 7, 2016 ... 1Department of Physics, Faculty of Science, Taif University, Taif 888, Saudi Arabia. 2Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo, Egypt. 3Materials Science Unit, Department of Chemistry, Faculty of Science, Tanta University, 31725 Tanta, Egypt. 4Department of ...

  8. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    The optical properties of a new family of Sm2O3–(40–)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at ... The refractive index, molar refraction and polarizability of oxide ions have been calculated by using Lorentz–Lorentz relations. The non-linear variations of the above optical ...

  9. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. The optical properties of a new family of xSm2O3–(40–x)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at room temperature in the UV-visible region. From the absorption edge studies, the values of optical bandgap energies have been evaluated. The refractive index, molar ...

  10. Measurement of radiative lifetime in atomic samarium using ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... In this paper, we report the investigations of lifetime measurement of odd-parity energy level 19009.52 cm. −1 .... introduced by an electronic delay generator between the two Q-switch pulses of Nd-YAG laser. The slope of the .... Our values of the lifetimes are free from the common systematic errors. Thus ...

  11. A novel samarium complex with interesting photoluminescence and ...

    African Journals Online (AJOL)

    The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

  12. Lithium samarium polyphosphate, LiSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-02-01

    Full Text Available The mixed-metal rare-earth polyphosphate LiSm(PO34 consists of a three-dimensional framework in which zigzag [(PO3n]n− chains with a periodicity of four PO4 tetrahedra are connected through Li+ and Sm3+ ions (both with 2. symmetry.

  13. Sodium samarium tetrakis(polyphosphate, NaSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-07-01

    Full Text Available NaSm(PO34 has been prepared by solid state reactions. It belongs to type II of the structural family of MILnIII(PO34 compounds (MI = alkali metal and LnIII = rare earth metal and is composed of ∞(PO3n]n− polyphosphate chains with a repeating unit of four PO4 tetrahedra. The chains extend parallel to [100] and share O atoms with irregular SmO8 polyhedra, forming a three-dimensional framework which delimits tunnels occupied by Na+ cations in a distorted octahedral environment.

  14. Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

    Energy Technology Data Exchange (ETDEWEB)

    Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-08

    The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

  15. Synthesis of copper, silver, and samarium chalcogenides by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Ohtani, T.; Maruyama, K.; Ohshima, K. [Okayama Univ. of Science (Japan). Lab. for Solid State Chemistry

    1997-03-01

    CuInX{sub 2} (X = S, Se, Te), Ag{sub 2}S, Ag{sub 2}Se, Ag{sub 3}Te{sub 2}, Ag{sub 1.9}Te, AgCuSe, Sm{sub 3}Se{sub 4}, Sm{sub 2}Se{sub 3}, and SmTe were synthesized by a mechanical alloying method, using a high-energy planetary ball mill. The compounds were obtained by milling mixtures of the elements with desired ratios in agate or Cu-Be vials for 60--180 min.

  16. Oriented growth of thin films of samarium oxide by MOCVD

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Thin films of Sm2O3 have been grown on Si(100) and fused quartz by low-pressure chemical va- pour deposition using an adducted β-diketonate precursor. The films on quartz are cubic, with no preferred orientation at lower growth temperatures (~ 550°C), while they grow with a strong (111) orientation as the.

  17. 150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

    Science.gov (United States)

    1978-12-01

    considerable hand labor. Addition of a provision for suitable electrical connection by the SCR manufacturer wou;d be desirable for production runs. Predicted...licen- sing the holder or any other person or corporation, or conveying any rights or permission to manufacture , use, or sell any patented invent,’n...tesile strength to contain the magnets and pole pieces up through the overspeed rating of the rotor. The cho.;en process uses maraging steel as the

  18. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Glasses with the composition, (Sm2O3)(ZnO)(40–)(TeO2)(60), were prepared by conventional melt quenching method. The density, molar volume, and optical energy band gap of these glasses have been measured. The refractive index, molar refraction and polarizability of oxide ion have been calculated by using ...

  19. Tratamiento del prolapso rectal en la infancia con infiltración de solución salina al 16,5 %

    Directory of Open Access Journals (Sweden)

    Carlos Ramírez Pérez

    Full Text Available Introducción: cuando falla el tratamiento médico conservador en los pacientes pediátricos con prolapso rectal se impone la infiltración perirrectal con sustancias irritantes. En la década de los 90 esas infiltraciones en nuestro centro se hacían con glicerina, pero escaseó en el mercado, y ante tal problema, se buscó otro agente infiltrante alternativo. En el presente trabajo se describe la experiencia con la utilización de solución salina al 16,5 %. Métodos: se realizó un estudio de intervención, longitudinal, prospectivo, experimental, del tipo ensayo clínico no controlado. Consta de una segunda parte en la que se utilizó la aleatorización con un grupo control para la validación. El universo estuvo constituido por 27 pacientes y la muestra, por 16 pacientes con prolapso rectal, que fueron atendidos en el servicio de gastroenterología del Hospital Pediátrico Provincial de Holguín en el quinquenio 2003-2007. Las variables desarrolladas fueron: concentración idónea para el tratamiento, cantidad de sustancia a infiltrar, complicaciones, recurrencia, número de infiltraciones y curación al año o más. Los resultados se exponen en forma de tablas porcentuales. Resultados: la eficacia con la utilización de solución salina al 16,5 % fue del 100 %, todos los pacientes curaron, y ninguno presentó recurrencia, por lo que no fueron necesarias 2 o más sesiones de tratamiento. Se comentó de un niño que, luego de fallar la infiltración con leche materna en primera opción y fallido también el cerclaje, finalmente resolvió con este método. Las complicaciones fueron relativamente pocas (18,9 %: un absceso, una celulitis y una retención urinaria con necesidad de sondaje durante 2 semanas, sin secuelas posteriores. Se realizó aleatorización con igual número de pacientes en quienes se usó la glicerina, los resultados del uso de ambas sustancias fueron muy parecidos, y el número de complicaciones fue ligeramente mayor en el

  20. "Kommentar zu „Ableitung von Korngrößenverteilungen aus textbasierten petrografischen Bohrgutbeschreibungen“ von Michael Naumann, Anja Waldeck, Wolfgang Poßin, Carsten Schwarz & Joachim Fritz (Z. Dt. Ges. Geowiss., 165/2: 275–286)"

    DEFF Research Database (Denmark)

    Fuchs, Sven

    2015-01-01

    Fuchs, S. (2015): Kommentar zu „Ableitung von Korngrößenverteilungen aus textbasierten petrografischen Bohrgutbeschreibungen“ von Michael Naumann, Anja Waldeck, Wolfgang Poßin, Carsten Schwarz & Joachim Fritz (Z. Dt. Ges. Geowiss., 165/2: 275?286). [Comment on “Deduction of grain size distributions...

  1. NOGA-guided analysis of regional myocardial perfusion abnormalities treated with intramyocardial injections of plasmid encoding vascular endothelial growth factor A-165 in patients with chronic myocardial ischemia: subanalysis of the EUROINJECT-ONE multicenter double-blind randomized study

    DEFF Research Database (Denmark)

    Gyongyosi, Mariann; Khorsand, Aliasghar; Zamini, Sholeh

    2005-01-01

    BACKGROUND: The aim of this substudy of the EUROINJECT-ONE double-blind randomized trial was to analyze changes in myocardial perfusion in NOGA-defined regions with intramyocardial injections of plasmid encoding plasmid human (ph)VEGF-A(165) using an elaborated transformation algorithm. METHODS A...

  2. Characterization of precipitates in a 7.9Cr-1.65Mo-1.25Si-1.2V steel during tempering

    Energy Technology Data Exchange (ETDEWEB)

    Djebaili, H., E-mail: h_djebaili@yahoo.fr [LASPI2A Laboratoire des Structures, Proprietes et Interactions Inter Atomiques, Centre Universitaire Khenchela (Algeria); Zedira, H.; Djelloul, A.; Boumaza, A. [LASPI2A Laboratoire des Structures, Proprietes et Interactions Inter Atomiques, Centre Universitaire Khenchela (Algeria)

    2009-09-15

    In this paper, the precipitates formed during the tempering after quenching from temperature 1150 deg. C for 7.90Cr-1.65Mo-1.25Si-1.2V steels are investigated using an analytical transmission electron microscope (A-TEM).The study of this tempering is carried out in isothermal and anisothermal conditions, by comparing the results given by dilatometry and hot hardness. Tempering is performed in the range of 300-700 deg. C. Coarse primary carbides retained after heat treatment are V-rich MC and Cr-Mo-rich M{sub 7}C{sub 3} types. In turn, it gives a significant influence on the precipitation of fine secondary carbides, that is, secondary hardening during tempering. The major secondary carbides are Cr-Mo-V-rich M'C (and/or) Cr-Mo-rich M{sub 2}C type. The peak hardness is observed in the tempering range of 450-500 deg. C. In the end, we observe between 600 and 700 deg. C, that this impoverished changes the phase. At these high temperatures of tempering, we observe that there is a carbide formation of the types M{sub 6}C developing at the expense of the fine M{sub 7}C{sub 3} carbides previously formed.

  3. Research, development and demonstration of lead-acid batteries for electric vehicle propulsion. Annual report, 1979. [165 Ah, 36. 5 Wh/kg

    Energy Technology Data Exchange (ETDEWEB)

    Bodamer, G.W.; Branca, G.C.; Cash, H.R.; Chrastina, J.R.; Yurick, E.M.

    1980-06-01

    Progress during the 1979 fiscal year is reported. All the tooling and capital equipment required for the pilot line production has been installed. A limited amount of plate production has been realized. A highly automated and versatile testing facility was established. The fabrication and testing of the initial calculated design is discussed. Cell component adjustments and the trade-offs associated with those changes are presented. Cells are being evaluated at the 3-hour rate. They have a capacity of 165 Ah and an energy density of 36.5 Wh/kg, and have completed 105 cycles to date. Experimental results being pursued under the advanced battery development program to enhance energy density and cycle life are presented. Data on the effects of different electrolyte specific gravity, separators, retainers, paste densities, battery additives and grid alloy composition on battery performance are presented and evaluated. Advanced battery prototype cells are under construction. Quality Assurance activities are summarized. They include monitoring the cell and battery fabrication and testing operations as well as all relevant documentation procedures. 12 figures, 28 tables.

  4. Comparison of neutron fluxes in an 18-MeV unshielded cyclotron room and a 16.5-MeV self-shielded cyclotron room.

    Science.gov (United States)

    Fujibuchi, Toshioh; Horitsugi, Genki; Yamaguchi, Ichiro; Eto, Akihisa; Iwamoto, Yasuo; Obara, Satoshi; Iimori, Takashi; Masuda, Yoshitada; Watanabe, Hiroshi; Hatazawa, Jun

    2012-07-01

    Some medical compact cyclotrons have self-shielding to reduce neutron fluxes. Thermal neutron fluxes in an 18-MeV unshielded cyclotron room and in a 16.5-MeV self-shielded cyclotron room were evaluated. In addition, the radioactivities in concrete and metals due to thermal neutrons in the cyclotron rooms for 30 years were calculated of operation such that the sum of the ratio of the nuclide concentration to the nuclide clearance level was equal to 1. The thermal neutron flux from the unshielded cyclotron was approximately 10(2) cm(-2) s(-1), whereas that from the self-shielded cyclotron was approximately 10(2) cm(-2) s(-1). The thermal neutron fluxes for concrete, stainless steel, vessel steel, and aluminum that reached their clearance levels were 9.80 × 10(4), 2.17 × 10(3), 1.87 × 10(4), and 2.41 × 10(5) cm(-2) s(-1), respectively. The specific activities in the cyclotron room were found to be sufficiently below the clearance level when the self-shield was employed.

  5. Non-viral VEGF165 gene therapy – magnetofection of acoustically active magnetic lipospheres (‘magnetobubbles’) increases tissue survival in an oversized skin flap model

    Science.gov (United States)

    Holzbach, Thomas; Vlaskou, Dialekti; Neshkova, Iva; Konerding, Moritz A; Wörtler, Klaus; Mykhaylyk, Olga; Gänsbacher, Bernd; Machens, H-G; Plank, Christian; Giunta, Riccardo E

    2010-01-01

    Abstract Adenoviral transduction of the VEGF gene in an oversized skin flap increases flap survival and perfusion. In this study, we investigated the potential of magnetofection of magnetic lipospheres containing VEGF165-cDNA on survival and perfusion of ischemic skin flaps and evaluated the method with respect to the significance of applied magnetic field and ultrasound. We prepared perfluoropropane-filled magnetic lipospheres (‘magnetobubbles’) from Tween60-coated magnetic nanoparticles, Metafectene, soybean-oil and cDNA and studied the effect in an oversized random-pattern-flap model in the rats (n= 46). VEGF-cDNA-magnetobubbles were administered under a magnetic field with simultaneously applied ultrasound, under magnetic field alone and with applied ultrasound alone. Therapy was conducted 7 days pre-operative. Flap survival and necrosis were measured 7 days post-operatively. Flap perfusion, VEGF-protein concentration in target and surrounding tissue, formation and appearance of new vessels were analysed additionally. Magnetofection with VEGF-cDNA-magnetobubbles presented an increased flap survival of 50% and increased flap perfusion (P < 0.05). Without ultrasound and without magnetic field, the effect is weakened. VEGF concentration in target tissue was elevated (P < 0.05), while underlying muscle was not affected. Our results demonstrate the successful VEGF gene therapy by means of magnetobubble magnetofection. Here, the method of magnetofection of magnetic lipospheres is equally efficient as adenoviral transduction, but has a presumable superior safety profile. PMID:19040418

  6. Non-viral VEGF(165) gene therapy--magnetofection of acoustically active magnetic lipospheres ('magnetobubbles') increases tissue survival in an oversized skin flap model.

    Science.gov (United States)

    Holzbach, Thomas; Vlaskou, Dialekti; Neshkova, Iva; Konerding, Moritz A; Wörtler, Klaus; Mykhaylyk, Olga; Gänsbacher, Bernd; Machens, H-G; Plank, Christian; Giunta, Riccardo E

    2010-03-01

    Adenoviral transduction of the VEGF gene in an oversized skin flap increases flap survival and perfusion. In this study, we investigated the potential of magnetofection of magnetic lipospheres containing VEGF(165)-cDNA on survival and perfusion of ischemic skin flaps and evaluated the method with respect to the significance of applied magnetic field and ultrasound. We prepared perfluoropropane-filled magnetic lipospheres ('magnetobubbles') from Tween60-coated magnetic nanoparticles, Metafectene, soybean-oil and cDNA and studied the effect in an oversized random-pattern-flap model in the rats (n= 46). VEGF-cDNA-magnetobubbles were administered under a magnetic field with simultaneously applied ultrasound, under magnetic field alone and with applied ultrasound alone. Therapy was conducted 7 days pre-operative. Flap survival and necrosis were measured 7 days post-operatively. Flap perfusion, VEGF-protein concentration in target and surrounding tissue, formation and appearance of new vessels were analysed additionally. Magnetofection with VEGF-cDNA-magnetobubbles presented an increased flap survival of 50% and increased flap perfusion (P < 0.05). Without ultrasound and without magnetic field, the effect is weakened. VEGF concentration in target tissue was elevated (P < 0.05), while underlying muscle was not affected. Our results demonstrate the successful VEGF gene therapy by means of magnetobubble magnetofection. Here, the method of magnetofection of magnetic lipospheres is equally efficient as adenoviral transduction, but has a presumable superior safety profile.

  7. The g.-165 T>C Rather than Methylation Is Associated with Semen Motility in Chinese Holstein Bulls by Regulating the Transcriptional Activity of the HIBADH Gene.

    Directory of Open Access Journals (Sweden)

    Shuai Zhang

    Full Text Available The 3-hydroxyisobutyrate dehydrogenase (HIBADH is regarded as a human sperm-motility marker. However, the molecular mechanisms involved in the regulation of expression of the HIBADH gene in bulls remain largely unknown. HIBADH was detected in the testis, epididymis, and sperm via reverse transcription polymerase chain reaction and Western blot analysis. It is also expressed in the seminiferous epithelium, spermatids, and the entire epididymis, as detected by immunohistochemistry. Furthermore, HIBADH was expressed in the neck-piece and mid-piece of bull spermatids, as shown in the immunofluorescence assay. Using serially truncated bovine HIBADH promoters and luciferase constructs, we discovered an 878 bp (-703 bp to +175 bp fragment that constitutes the core promoter region. One SNP g.-165 T>C of HIBADH was identified and genotyped in 307 Chinese Holstein bulls. Correlation analysis revealed that bulls with the TT genotype had higher initial sperm motility than those with the CC genotype (P C rather than methylation in the 5'-flanking region could affect the bovine sperm motility through the regulation of HIBADH gene transcriptional activity.

  8. 76 FR 165 - Indian Gaming

    Science.gov (United States)

    2011-01-03

    ... the purpose of engaging in Class III gaming activities on Indian lands. This Amendment changes the... benefitting Tribal members. Dated: December 22, 2010. Donald Laverdure, Deputy Assistant Secretary--Indian...

  9. Effects of therapeutic angiogenesis with plasmid VEGF165 on ventricular function in a canine model of chronic myocardial infarction Efeito da angiogênese terapêutica com VEGF165 sobre a função ventricular em infarto do miocárdio crônico

    Directory of Open Access Journals (Sweden)

    Ana Paula Furlani

    2009-06-01

    Full Text Available OBJECTIVE: Therapeutic angiogenesis is currently under investigation in ischemic heart disease. We examined the effect on left ventricular function induced by therapeutic angiogenesis by intramyocardial injection of plasmid VEGF165, in a canine model of chronic myocardial infarction. METHODS: Left thoracotomy was performed in 10 mongrel dogs, and myocardial infarction induced by ligation of the major diagonal coronary artery. At 7 postoperative (p.o. day (pre-treatment, left ventricular ejection fraction was assessed by echocardiogram, and a second procedure was done: saline or plasmid VEGF165 at 200 mg/mL was injected over 10 points of the ischemic areas of control or treated groups, respectively. Fourteen days later (post-treatment, day 21 a control echocardiogram was performed, the animals were sacrificed and histological examination was performed. RESULTS: Ejection fraction was maintained in the treated group: 52.45 + 15.1% on day 7 and 48.53 + 11.74% on day 21 (P=0.59, and tended to decrease in the control group, from 59.3 + 4% to 39.37 + 19.43% (P=0.04, although absolute values did not differ significantly between groups. Histological examination revealed a non significant increase in capillary vessels number in all areas in treated group. Paradoxically, arterioles were significantly less in number in all areas of treated dogs. CONCLUSION: Intramyocardial injection of plasmid VEGF165, in this canine model of chronic myocardial infarction, resulted in preservation of left ventricular ejection fraction, contrary to the control group where left ventricular ejection fraction showed continuous decline during the experiment. Histological examination, however, was unable to explain completely these results.OBJETIVO: Angiogênese por terapia gênica é alternativa ainda experimental para revascularização miocárdica. Este estudo objetivou verificar a indução de angiogênese e melhora funcional miocárdica pela injeção transmural de plasm

  10. Examining Psychiatric Disorder as a Risk Factor for Cancer in a Prospective Cohort Study of 1,165,039 Swedish Men: Different Analytical Strategies Reveal Different Findings

    Science.gov (United States)

    Whitley, Elise; Batty, G. David; Mulheran, Paul A.; Gale, Catharine R.; Osborn, David P.; Tynelius, Per; Rasmussen, Finn

    2014-01-01

    Background Associations between psychiatric disorders and cancer incidence are inconsistent, with studies reporting cancer rates in psychiatric patients that are higher, similar, or lower than the general population. Exploration of these associations is complicated by difficulties in establishing the timing of onset of psychiatric disorders and cancer, and the associated possibility of reverse causality. Some studies have dealt with this problem by excluding patients with cancers pre-dating their psychiatric illness; others have not considered the issue. Methods We examined associations between psychiatric hospitalization and cancer incidence in a cohort of 1,165,039 Swedish men, and explored the impact of different analytical strategies on these associations using real and simulated data. Results Relative to men without psychiatric hospitalization, we observed consistent increases in smoking-related cancers in those with psychiatric hospitalizations, regardless of analytical approach (for example, hazard ratio (95% confidence interval): 1.73 (1.52, 1.96)). However, associations with nonsmoking-related cancers were highly dependent on analytical strategy. In analyses based on the full cohort, we observed no association or a modest increase in cancer incidence in those with psychiatric hospitalizations (1.14 (1.07, 1.22)). In contrast, analyses excluding men whose cancer predated their psychiatric hospitalizations, resulted in a reduction in future cancer incidence in psychiatric patients (0.72; 0.67, 0.78). Results from simulated data suggest that even modest exclusions of this type can lead to strong artefactual associations. Conclusions Psychiatric disorder-cancer incidence associations are complex and influenced by analytical strategy. A greater understanding of the temporal relationship between psychiatric disorder and cancer incidence is required. PMID:22488410

  11. 0.5 - 165 MeV proton and 102 - 312 keV electron injections during the 2006 December 13 SEP event

    Science.gov (United States)

    Aran, A.; Agueda, N.; Jacobs, C.; Lario, D.; Sanahuja, B.; Poedts, S.; Marsden, R. G.

    2010-12-01

    The last large solar energetic particle event of solar cycle 23 was observed on 2006 December 13. The origin of this event was associated with a X3.4 flare from AR10930 at S06W23 and a fast (> 1700 km/s) halo CME. A long-lasting type III and a metric type II radio burst were also recorded. We combine proton observations from ACE/EPAM, SOHO/ERNE and STEREO/IMPACT (24 energy channels from 0.5 to 165 MeV) to model the proton differential intensities measured during this event. We simulate both the propagation of the CME-driven shock (from 4 solar radii to 1 AU) and the transport of shock-accelerated protons along the upstream interplanetary magnetic field lines. Near-relativistic (102 - 312 keV) electron observations by ACE/EPAM during the early phase of the event are used to constrain the electron transport conditions along the field lines and deduce, via a Monte Carlo transport model, the electron injection profile close to the Sun. The best-fit electron injection profile shows one prompt component consistent with the timing and duration of both the radio type III and the hard X-ray bursts and a second delayed injection component timely associated with the type II radio burst. From the proton modelling we quantify the injection rate of shock accelerated protons and show that most of the > 50 MeV protons are injected when the shock is still close to the Sun (i.e. within 42 solar radii). We compare the inferred electron and proton injections and discuss the possible contribution of flare-related particles in the early phase of the event.

  12. Measurement of the Doubly-Polarized $\\vec{{^3}He}(\\vec{\\gamma},n)pp$ Reaction at 16.5 MeV and Its Implications for the GDH Sum Rule

    CERN Document Server

    Laskaris, G; Mueller, J M; Zimmerman, W R; Xiong, W; Ahmed, M W; Averett, T; Chu, P -H; Deltuva, A; Flower, C; Fonseca, A C; Gao, H; Golak, J; Heideman, J N; Karwowski, H J; Meziane, M; Sauer, P U; Skibiński, R; Strakovsky, I I; Weller, H R; Witała, H; Wu, Y K

    2015-01-01

    We report new measurements of the doubly-polarized photodisintegration of $^3$He at an incident photon energy of 16.5 MeV, carried out at the High Intensity $\\gamma$-ray Source (HI$\\gamma$S) facility located at Triangle Universities Nuclear Laboratory (TUNL). The spin-dependent double-differential cross sections and the contribution from the three--body channel to the Gerasimov-Drell-Hearn (GDH) integrand were extracted and compared with the state-of-the-art three--body calculations. The calculations, which include the Coulomb interaction and are in good agreement with the results of previous measurements at 12.8 and 14.7 MeV, can no longer describe the cross section results at 16.5 MeV. The GDH integrand was found to be about one standard deviation larger than the maximum value predicted by the theories.

  13. Asociación entre incidencia de tuberculosis e Índice de Desarrollo Humano en 165 países del mundo

    Directory of Open Access Journals (Sweden)

    Diana M Castañeda-Hernández

    Full Text Available Objetivos. Evaluar la relación entre el índice de desarrollo humano (IDH y la incidencia de tuberculosis (TB en 165 países del mundo en el período 2005-2011. Materiales y métodos. Se realizó un estudio ecológico para el cual el IDH se obtuvo de la base de datos del Fondo de Naciones Unidas para el Desarrollo (PNUD y la incidencia de TB del Programa Alto a la TB de la Organización Mundial de la Salud (OMS. Se evaluó la variación anual de las variables y se realizaron modelos de regresión no lineales (exponencial. Resultados. Al analizar los datos con los modelos de regresión no lineal, se observó que los países con mayores tasas de incidencia de TB fueron aquellos con menores valores de IDH, siendo significativa su asociación (p<0,01. De igual forma se observó que en los países, la variación en el tiempo se asoció significativamente con la variación en el IDH. Conclusiones. Se ha encontrado una relación inversa y significativa entre el IDH y la morbilidad por TB en los países estudiados, incluidos tanto los países de mayor carga de enfermedad como los de la región andina en Latinoamérica. Esta información refleja la influencia significativa de indicadores socioeconómicos como el IDH sobre la tasa de incidencia de la TB, especialmente en países endémicos, siendo inversa entre ambos tipos de variables; con el incremento o mejoría del IDH la tasa de incidencia de la enfermedad disminuyó o se encontró siendo significativamente menor

  14. Experimental Evidence for a Glass forming "Stripe Liquid" in the Magnetic Ground State of La1.65Eu0.2Sr0.15CuO4

    OpenAIRE

    Simovic, B.; Hammel, P. C.; Hucker, M.; Buchner, B.; Revcolevschi, A.

    2002-01-01

    We report measurements of the longitudinal ($^{139}T_1^{-1}$) and transverse ($^{139}T_2^{-1}$) decay rates of the magnetization of $^{139}$La nuclei performed in a high quality single crystal of La$_{1.65}$Eu$_{0.2}$Sr$_{0.15}$CuO$_{4}$. We observe a dramatic slowing of the Cu 3d spins manifested as a sharp increase of both $^{139}T_1^{-1}$ and $^{139}T_2^{-1}$ below 30 K. We find that in this temperature range the fluctuations involve a unique time scale $\\tau $ which diverges as $(T-T_{\\rm...

  15. 46 CFR 154.620 - Design temperature below −55 °C (−67 °F) and down to −165 °C (−265 °F).

    Science.gov (United States)

    2010-10-01

    ... LIQUEFIED GASES Design, Construction and Equipment Materials § 154.620 Design temperature below −55 °C (−67... 46 Shipping 5 2010-10-01 2010-10-01 false Design temperature below â55 °C (â67 °F) and down to... design temperature below −55 °C (−67 °F) and down to −165 °C (−265 °F) must: (a) Meet § 54.25-10(b)(2...

  16. Measurement of thermal neutron capture cross-section and resonance integral for the {sup 165}Ho(n,γ){sup 166g}Ho reaction by the activation method

    Energy Technology Data Exchange (ETDEWEB)

    Zolghadri, Samaneh [Radiopharmaceutical Research and Development Laboratory (RRDL), Nuclear Sciences and Technology Research Institute (NSTRI), Tehran 14395-836 (Iran, Islamic Republic of); Yousefnia, Hassan, E-mail: hyousefnia@aeoi.org.ir [Radiopharmaceutical Research and Development Laboratory (RRDL), Nuclear Sciences and Technology Research Institute (NSTRI), Tehran 14395-836 (Iran, Islamic Republic of); Afarideh, Hossein [Department of Physics, Amirkabir University of Technology, Tehran (Iran, Islamic Republic of); Bahrami-Samani, Ali; Jalilian, A.R.; Ghannadi-Maragheh, Mohammad [Radiopharmaceutical Research and Development Laboratory (RRDL), Nuclear Sciences and Technology Research Institute (NSTRI), Tehran 14395-836 (Iran, Islamic Republic of)

    2013-01-15

    The thermal neutron capture cross-section and resonance integral for the {sup 165}Ho(n,γ){sup 166}Ho reaction were measured experimentally by the activation method. Holmium oxide, manganese oxide and cobalt oxide powders, all dissolved in a mixture of hydrochloric acid and nitric acid, were irradiated within and without cadmium covers in the Tehran Research Reactor. The measured value of the thermal neutron cross-section relative to the {sup 55}Mn(n,γ){sup 56}Mn and {sup 59}Co(n,γ){sup 60}Co monitor reactions (with thermal neutron cross-section of 13.3 ± 0.1b and 37.18 ± 0.06b) was 58.6 ± 1.8b. The result was in a good agreement with the most previously reported values. Also the resonance integral was determined relative to the {sup 55}Mn(n,γ){sup 56}Mn and {sup 59}Co(n,γ){sup 60}Co monitor reactions with the reference value of 14.0 ± 0.3 and 75.9 ± 2.0, respectively. The measured resonance integral of the {sup 165}Ho(n,γ){sup 166}Ho reaction at the cadmium cut-off energy of 0.55 eV was 650 ± 31. The result was measured with high precision and compared with other measurements in the literature.

  17. Corrective Action Investigation Plan for Corrective Action Unit 165: Areas 25 and 26 Dry Well and Washdown Areas, Nevada Test Site, Nevada (including Record of Technical Change Nos. 1, 2, and 3) (January 2002, Rev. 0)

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office (NNSA/NV)

    2002-01-09

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 165 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 165 consists of eight Corrective Action Sites (CASs): CAS 25-20-01, Lab Drain Dry Well; CAS 25-51-02, Dry Well; CAS 25-59-01, Septic System; CAS 26-59-01, Septic System; CAS 25-07-06, Train Decontamination Area; CAS 25-07-07, Vehicle Washdown; CAS 26-07-01, Vehicle Washdown Station; and CAS 25-47-01, Reservoir and French Drain. All eight CASs are located in the Nevada Test Site, Nevada. Six of these CASs are located in Area 25 facilities and two CASs are located in Area 26 facilities. The eight CASs at CAU 165 consist of dry wells, septic systems, decontamination pads, and a reservoir. The six CASs in Area 25 are associated with the Nuclear Rocket Development Station that operated from 1958 to 1973. The two CASs in Area 26 are associated with facilities constructed for Project Pluto, a series of nuclear reactor tests conducted between 1961 to 1964 to develop a nuclear-powered ramjet engine. Based on site history, the scope of this plan will be a two-phased approach to investigate the possible presence of hazardous and/or radioactive constituents at concentrations that could potentially pose a threat to human health and the environment. The Phase I analytical program for most CASs will include volatile organic compounds, semivolatile organic compounds, Resource Conservation and Recovery Act metals, total petroleum hydrocarbons, polychlorinated biphenyls, and radionuclides. If laboratory data obtained from the Phase I investigation indicates the presence of contaminants of concern, the process will continue with a Phase II investigation to define the extent of contamination. Based on the

  18. NOGA-guided analysis of regional myocardial perfusion abnormalities treated with intramyocardial injections of plasmid encoding vascular endothelial growth factor A-165 in patients with chronic myocardial ischemia: subanalysis of the EUROINJECT-ONE multicenter double-blind randomized study.

    Science.gov (United States)

    Gyöngyösi, Mariann; Khorsand, Aliasghar; Zamini, Sholeh; Sperker, Wolfgang; Strehblow, Christoph; Kastrup, Jens; Jorgensen, Eric; Hesse, Birger; Tägil, Kristina; Bøtker, Hans Erik; Ruzyllo, Witold; Teresiñska, Anna; Dudek, Dariusz; Hubalewska, Alicja; Rück, Andreas; Nielsen, Søren Steen; Graf, Senta; Mundigler, Gerald; Novak, Jacek; Sochor, Heinz; Maurer, Gerald; Glogar, Dietmar; Sylven, Christer

    2005-08-30

    The aim of this substudy of the EUROINJECT-ONE double-blind randomized trial was to analyze changes in myocardial perfusion in NOGA-defined regions with intramyocardial injections of plasmid encoding plasmid human (ph)VEGF-A(165) using an elaborated transformation algorithm. After randomization, 80 no-option patients received either active, phVEGF-A165 (n=40), or placebo plasmid (n=40) percutaneously via NOGA-Myostar injections. The injected area (region of interest, ROI) was delineated as a best polygon by connecting of the injection points marked on NOGA polar maps. The ROI was projected onto the baseline and follow-up rest and stress polar maps of the 99m-Tc-sestamibi/tetrofosmin single-photon emission computed tomography scintigraphy calculating the extent and severity (expressed as the mean normalized tracer uptake) of the ROI automatically. The extents of the ROI were similar in the VEGF and placebo groups (19.4+/-4.2% versus 21.5+/-5.4% of entire myocardium). No differences were found between VEGF and placebo groups at baseline with regard to the perfusion defect severity (rest: 69+/-11.7% versus 68.7+/-13.3%; stress: 63+/-13.3% versus 62.6+/-13.6%; and reversibility: 6.0+/-7.7% versus 6.7+/-9.0%). At follow-up, a trend toward improvement in perfusion defect severity at stress was observed in VEGF group as compared with placebo (68.5+/-11.9% versus 62.5+/-13.5%, P=0.072) without reaching normal values. The reversibility of the ROI decreased significantly at follow-up in VEGF group as compared with the placebo group (1.2+/-9.0% versus 7.1+/-9.0%, P=0.016). Twenty-one patients in VEGF and 8 patients in placebo group (Por =5% increase in the normalized tracer uptake of the ROI. Projection of the NOGA-guided injection area onto the single-photon emission computed tomography polar maps permits quantitative evaluation of myocardial perfusion in regions treated with angiogenic substances. Injections of phVEGF A165 plasmid improve, but do not normalize, the stress

  19. How do country risk and national cultural differences between partners affect the survival of international alliances in emerging countries? Longitudinal analysis of 165 international joint ventures in Brazil 1974 to 2005

    Directory of Open Access Journals (Sweden)

    Pierre-Xavier Meschi

    2007-06-01

    Full Text Available This article aims at identifying the individual and joint impact of two « country-level variables », namely national distance and country risk, on the survival of international joint ventures in emerging countries. Research hypotheses predicting the negative impact of national distance and country risk on survival are formulated in this article. These research hypotheses are tested in a sample of 165 international joint ventures that were formed in Brazil between 1974 and 2003. These joint ventures were subjected to an event history analysis over a period of time ranging from 1974 to 2005. The empirical results show that the intercultural dynamics increases the instability of international joint ventures whereas the survival of these alliances does not seem to be affected by the economic and political uncertainty of Brazil. Furthermore, the national distance between local and foreign partners has effects on survival that are variable according to the life cycle of international joint ventures.

  20. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_TAO165E0N in the North Pacific Ocean and South Pacific Ocean from 2010-02-23 to 2013-02-03 (NODC Accession 0113238)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0113238 includes chemical, meteorological, physical and time series data collected from MOORING_TAO165E0N in the North Pacific Ocean and South Pacific...

  1. Terapia gênica com fator de crescimento endotelial vascular 165 para pacientes com angina refratária: mobilização de células progenitoras endoteliais

    Directory of Open Access Journals (Sweden)

    Clarissa G. Rodrigues

    2013-08-01

    Full Text Available FUNDAMENTO: O fator de crescimento endotelial vascular (VEGF - vascular endothelial growth factor induz a mobilização de células progenitoras endoteliais (CPEs com capacidade de proliferação e diferenciação em células endoteliais, contribuindo, dessa forma, para o processo angiogênico. OBJETIVO: Buscamos avaliar o comportamento de CPEs em pacientes com doença cardíaca isquêmica e angina refratária que receberam injeções intramiocardicas de 2000 µg de VEGF165 como terapia única. MÉTODOS: O estudo foi uma subanálise de um ensaio clínico. Pacientes com doença cardíaca isquêmica avançada e angina refratária foram avaliados para inclusão no estudo. Os critérios de inclusão foram: sinais e sintomas de angina e/ou insuficiência cardíaca apesar de tratamento medicamentoso máximo e área de isquemia miocárdica de, no mínimo, 5% conforme avaliado por uma tomografia computadorizada por emissão de fóton único (TCEFU. Os critérios de exclusão foram: idade > 65 anos, fração de ejeção do ventrículo esquerdo < 25% e cancer diagnosticado. Os pacientes cujos níveis de CPE foram avaliados foram incluídos. A intervenção consistiu na administração de 2000 µg de VEGF 165 de plasmídeo injetado no miocárdio isquêmico. A frequência de células CD34+/KDR+ foi analisada por citometria de fluxo antes e 3, 9, e 27 dias após a intervenção. RESULTADOS: Um total de 9 pacientes foram incluídos, 8 homens, média de idade de 59,4 anos, fração de ejeção ventricular esquerda de 59,3%, e classe de angina predominante III. Observou-se um aumento significativo dos níveis de CPEs no terceiro dia após a intervenção. Todavia, 9 e 27 dias após a intervenção, os níveis de CPEs foram similares aos basais. CONCLUSÃO: Identificamos uma mobilização transitória de CPE, com pico no terceiro dia após a intervenção com VEGF 165 em pacientes com angina refratária. Todavia, os níveis de CPEs apresentaram-se semelhantes

  2. Contribution to the study of samarium-151 excited levels; Contribution a l'etude des niveaux excites du samarium-151

    Energy Technology Data Exchange (ETDEWEB)

    Locard, P. [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

    1967-07-01

    The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces transitions, nous avons donc entrepris des experiences de coincidences gamma-gamma (et de ''spectre de somme'') a l'aide d'un ensemble de spectrometrie a scintillation realise au laboratoire (chapitre 2). L'etude des intensites de ces coincidences (chapitre 3) nous amene a modifier le dernier schema propose: nous supprimons les niveaux a 405,5 et 650 keV, nous ajoutons des niveaux a 245,6 - 306,6 - 522 - 952 et 962 keV. Nous avons egalement verifie la multipolarite des principales transitions et mesure la duree de vie de certains des niveaux (chapitre 3) (nous trouvons une periode de 1,1 {+-} 0,5) nanoseconde pour le niveau a 167,7 keV). Le chapitre 4 est enfin consacre a la comparaison de nos resultats avec les predictions des differents modeles decrits au chapitre 1. (auteur)

  3. Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV

    Science.gov (United States)

    Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.

    2017-09-01

    Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.

  4. Experimental test of a newly developed single-moderator, multi-detector, directional neutron spectrometer in reference monochromatic fields from 144 keV to 16.5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Gómez-Ros, J.M. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Pola, A.; Bortot, D. [Politecnico di Milano, Dipartimento di Energia, via La Masa 34, 20156 Milano (Italy); INFN – Milano, Via Celoria 16, 20133 Milano (Italy); Gentile, A. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Introini, M.V. [Politecnico di Milano, Dipartimento di Energia, via La Masa 34, 20156 Milano (Italy); INFN – Milano, Via Celoria 16, 20133 Milano (Italy); Buonomo, B. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Lorenzoli, M. [Politecnico di Milano, Dipartimento di Energia, via La Masa 34, 20156 Milano (Italy); INFN – Milano, Via Celoria 16, 20133 Milano (Italy); Mazzitelli, M. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Sacco, D. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); INAIL – DPIA, Via di Fontana Candida n.1, 00040 Monteporzio Catone (Italy)

    2015-05-11

    A new directional neutron spectrometer called CYSP (CYlindrical SPectrometer) was developed within the NESCOFI@BTF (2011–2013) collaboration. The device, composed by seven active thermal neutron detectors located along the axis of a cylindrical moderator, was designed to simultaneously respond from the thermal domain up to hundreds of MeV neutrons. The new spectrometer condenses the performance of the Bonner Sphere Spectrometer in a single moderator; thus requiring only one exposure to determine the whole spectrum. The CYSP response matrix, determined with MCNP, has been experimentally evaluated with monochromatic reference neutron fields from 144 keV to 16.5 MeV, plus a {sup 252}Cf source, available at NPL (Teddington, UK). The results of the experiment confirmed the correctness of the response matrix within an overall uncertainty of ±2.5%. The new active spectrometer CYSP offers an innovative option for real-time monitoring of directional neutron fields as those produced in neutron beam-lines.

  5. Study of the peripheral projectile-like fragments from the reaction {sup 129}Xe on {sup 27}Al, {sup nat}Cu, {sup 139}La and {sup 165}Ho, at E/A = 50 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Solis, E.J.; Russ, D.E.; Madani, H. [Univ. of Maryland, College Park, MD (United States)] [and others

    1996-02-01

    There are several reaction mechanisms identified for peripheral heavy-ion collisions. For low bombarding energies (E/A {approx} 10 MeV) the predominant reaction channel is the deep-inelastic reaction mechanism. In this process, the projectile and target form a rotating binary system, interchanging nucleons and angular momentum until they separate. At higher bombarding energies (E/A {approx} 50 to 100 MeV) incomplete fusion is thought to be the prevailing reaction channel. In this type of interaction part of the projectile merges with the target during the collision. Finally, for energies greater than 100 MeV/A, the main reaction channel is characterized by the formation of a highly-excited separate fragment (fireball) produced during the overlap between the projectile and the target. The data set studied was from an experiment designed to characterize the projectile-like products of the {sup 27}Al, {sup nat}Cu, {sup 139}La, and {sup 165}Ho reactions at E/A = 50 MeV, which was performed at the Michigan State University Super Cyclotron Laboratory (MSU-NSCL). The Maryland Forward Array (MFA), was used to measure projectile-like fragments in coincidence with target-like fragments and light-charge particles in the MSU 4{pi} detector.

  6. Evidence on climatic variability and prehistoric human activities between 165 B.C. and A.D. 1400 derived from subfossil Scots pines (Pinus sylvestris L. found in a lake in Utsjoki, northernmost Finland

    Directory of Open Access Journals (Sweden)

    Zetterberg, P.

    1994-12-01

    Full Text Available Samples from 1265 subfossil pines have been collected from small lakes and peat deposits in the forest-limit zone of northern Fennoscandia in order to study past variations of climate. Many of the subfossils have been dated by dendrochronology and the chronology constructed from the measured ring-width data extends as a continuous master curve from the present back until 165 B.C. and after a short gap until about 7000 years before the present time. This material has greatly increased the number of dated pine megafossils in northern Finland which had previously been restricted only to radiocarbon-dated samples. In addition to the year-by-year information provided by tree-ring width data, the temporal distribution of pine megafossils found in the vicinity of the forest-limit zone also provides information on past climatic changes. The 102 pine subfossils collected from Lake Ailigas, in Utsjoki, form part of the above material. They provide information about past variations in pine growth caused, to a large degree, by changing climate at this one site, but they also give glimpses of the local activities of Prehistoric Man. The data from 90 of these trees have been successfully dated using dendrochronological techniques and the results show that all of them grew during the time period beginning 3000 years before present, and that 79 pines lived during the time span 165 B.C. to A.D. 1952. In several lakes in the forest-limit zone, some subfossil trees are much older than those in Lake Ailigas. The relatively young ages of the subfossils at this site indicates that the lake has been in existence probably only during the past 3000 years, forming when climate turned more humid than in earlier times. The present continuous master curve is about 600 years longer than the earlier published pine chronology for northern Sweden, though this has recently been extended to A.D. 1. In the present study, the life spans of individual dated pines are considered in

  7. Ngugi phenotypic 165-173.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    were high yielding as revealed by the means of panicle branches (43), panicle length (21cm), and grain weight (1.5 g). Majority of the sorghums ... Phenotypic cluster analysis gave two major ... révélé les moyennes de branches de panicles (43), longueur des panicles (21cm), et le poids de grains (1.5 g). La majorité de ...

  8. Publications | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Collective mark to improve local value chains for Peru's smallholder organic products (annex 25 of final technical report) (restricted access). The collective ... Water resources and adaptation to climate change in North China Plain and Poyang Lake region in China : preliminary findings and research plan (restricted access).

  9. Reference: 165 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available the specific drug fumagillin impaired plant development, with particularly strong effects on the root system. Re...d out by two types of Met aminopeptidases (MAPs), MAP1 and MAP2, in eukaryotes. Three enzymes, MAP1A, MAP2A,...liana). MAP transcript quantification revealed a predominance of MAP2B and developmental and organ-specific re...gulation of both MAP1A and MAP2s. By combining reverse genetics and reverse chemogenomics in transgenic pl...ant lines, we have devised specific and reversible switches for the investigation

  10. 32 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Defense. Production costs for the foreign military sales program and known direct commercial sales... additional effort applicable to the sale model or technology is necessary or planned. It does not include... incurred under a foreign military sale at the request of, or for the benefit of, a foreign customer to...

  11. 21 CFR 173.165 - Candida lipolytica.

    Science.gov (United States)

    2010-04-01

    ..., under ultraviolet light to detect any residual fluorescent contamination. As a precautionary measure it.... Separatory funnels, 500-milliliter capacity, equipped with tetrafluoroethylene polymer stopcocks. 3. Chromatographic tubes: (a) 80-millimeter ID × 900-millimeter length equipped with tetrafluoroethylene polymer...

  12. 40 CFR 51.165 - Permit requirements.

    Science.gov (United States)

    2010-07-01

    ... industrial grouping, are located on one or more contiguous or adjacent properties, and are under the control... CO2 concentrations), and calculate and record the mass emissions rate (for example, lb/hr) on a... currents) and other information (for example, gas flow rate, O2 or CO2 concentrations), and to record...

  13. 20 CFR 655.165 - Partial certification.

    Science.gov (United States)

    2010-04-01

    ... EMPLOYMENT OF FOREIGN WORKERS IN THE UNITED STATES Labor Certification Process for Temporary Agricultural... otherwise. The number of workers certified will be reduced by one for each referred U.S. worker who is able... the number of H-2A workers requested has been reduced; (b) Offer the applicant an opportunity to...

  14. 40 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... and that is designed and constructed for one-time use and is not intended to be filled again with a... containers for the purposes of this part. Containment pad means any structure that is designed and... area. Containment structure means either a secondary containment unit or a containment pad. Custom...

  15. Environmental Radiation Data (ERD) Journal Report 165

    Science.gov (United States)

    RadNet environmental radiation monitoring data report for the period of January - March 2015. The report includes results for air, drinking water and precipitation samples collected as part of EPA's RadNet monitoring program.

  16. 33 CFR 165.2030 - Pacific Area.

    Science.gov (United States)

    2010-07-01

    ... States, whether the large U.S. naval vessel is underway, anchored, moored, or within a floating dry dock... patrol. When within a naval vessel protection zone, no vessel or person is allowed within 100 yards of a... command, or official patrol. (e) To request authorization to operate within 100 yards of a large U.S...

  17. Publications | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research ... Designing, developing and testing of a seeder for tree seeding and in situ water harvesting (restricted access). Current methods of collection and ...

  18. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    Administrator

    Key Laboratory for Special Functional Aggregate Materials of Education Ministry,. School of Chemistry and Chemical ... been flourishing since its excellent electric properties were discovered in the 1980s.1 At present SDC is ... absolute ethanol three times and dried in an electric oven at 60°C overnight, and then calcined at ...

  19. Trichloridotris{N-[phenyl(pyridin-2-ylmethylidene]hydroxylamine-κ2N,N′}samarium(III

    Directory of Open Access Journals (Sweden)

    Yahong Li

    2012-03-01

    Full Text Available The SmIII ion in the title compound, [SmCl3(C12H10N2O3], shows a coordination number of nine with a slightly distorted tricapped trigonal prismatic geometry based on a Cl3N6 donor set. The molecular structure is stabilized by three intramolecular O—H...Cl hydrogen bonds.

  20. Biological studies of samarium-153 bleomycin complex in human breast cancer murine xenografts for therapeutic applications

    Energy Technology Data Exchange (ETDEWEB)

    Bahrami-Samani, A. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Ghannadi-Maragheh, M. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran); Jalilian, A.R.; Mazidi, M. [Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran)

    2010-07-01

    In this work, a potential therapeutic DNA targeting agent, {sup 153}Sm-bleomycin complex ({sup 153}Sm-BLM), was developed and the tumor accumulation studies were performed using single photon emission computed tomography (SPECT) and scarification studies. {sup 153}Sm-BLM was prepared at optimized conditions (room temperature, 4-8 h, 0.1 mg bleomycin for 740-3700 MBq {sup 153}SmCl{sub 3}, radiochemical purity over 98%, HPLC, specific activity = 55 TBq/mmol). {sup 153}Sm-BLM was administered into human breast cancer murine xenografts and the biodistribution and imaging studies were performed up to 48 h. {sup 153}Sm-BLM demonstrated superior tumor accumulation properties in contrast with the other radiolabeled bleomycins with tumor:blood ratios of 41, 72 and 182 at 4, 24 and 48 h, respectively, and tumor:muscle ratios of 23, 33 and > 1490 at 4, 24 and 48 h, respectively, while administered intravenously. The SPECT images also demonstrated the obvious tumor uptake at the chest region of the breast-tumor bearing mice. These initial experiments demonstrate significant accumulation of {sup 153}Sm-BLM in tumor tissues. (orig.)

  1. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    CSIR Research Space (South Africa)

    Mandiwana, V

    2015-09-01

    Full Text Available .63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems...

  2. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    National Research Council Canada - National Science Library

    Gangu, Kranthi Kumar; Maddila, Suresh; Maddila, Surya Narayana; Jonnalagadda, Sreekantha B

    2016-01-01

    ...) and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp) were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine...

  3. Samarium(III) picrate tetraethylene glycol complex: Photoluminescence study and active material in monolayer electroluminescent

    Energy Technology Data Exchange (ETDEWEB)

    Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I. [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Za' aba, Noor K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)

    2011-09-15

    A mononuclear Sm(III) complex involving Pic and EO4 (where Pic=picrate anion and EO4=tetraethylene glycol) has been studied. It shows a bright-orange emission when used as active material in a monolayer electroluminescent device of ITO/EO4-Sm-Pic/Al. The crystal structure of the complex consists of [Sm(Pic){sub 2}(H{sub 2}O)(EO4)]{sup +} cation and [Pic]{sup -} anion. The Sm(III) ion is coordinated with nine oxygen atoms from one EO4 ligand in a pentadentate mode, two Pic anions each in bidentate and monodentate modes, and one water molecule. Both the terminal alcohol groups of the acyclic EO4 ligand were involved in the O-H...O hydrogen bonding by infinite one-dimensional (1D) chain within a symmetry direction [0 1 0]. The photoluminescence (PL) spectrum of the thin film shows the typical spectral features of the Sm(III) ion ({sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} transitions). The root-mean-square (rms) of the roughness of thin film is 30.605 nm and indicates that the formation of the monolayer electroluminescent device is not uniform and retains a high crystallinity. Typical semiconductor current-voltage (I-V) property was also observed in this device with threshold and turn voltages of 2.8 and 6.2 V, respectively. The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex can be applied as a luminescent center in OLED for bright-orange emission. - Highlights: > The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in monolayer device structure of ITO/EO4-Sm-Pic/Al. > The photoluminescence spectrum of the crystalline and thin film shows a bright-orange emission. > The current-voltage property showed the turn on voltage of 6.2 V.

  4. Pulsed laser deposition and optical characterizations of the magnetic samarium orthoferrite

    Energy Technology Data Exchange (ETDEWEB)

    Berini, Bruno, E-mail: bruno.berini@uvsq.fr [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France); Mistrik, Jan [Institute of Applied Physics and Mathematics, Faculty of Chemical Technology, University of Pardubice, Studentska 84, 532 10 Pardubice (Czech Republic); Dumont, Yves; Popova, Elena; Fouchet, Arnaud; Scola, Joseph; Keller, Niels [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France)

    2012-01-01

    Pulsed Laser Deposition of magnetically ordered polycrystalline SmFeO{sub 3} films has been optimized onto SiO{sub 2} glass substrates as function of substrate temperature, oxygen pressure and pulsed laser fluency. Using a KrF excimer laser, crystallization temperature is found to be about 1048 K for a weak fluency of only 1.7 J cm{sup -2}. We show that this growth temperature can be reduced using higher fluency and that it is possible to obtain a film texturation along the c axis by reducing the oxygen pressure at given temperature and fluency. In a second part, we focus on the SmFeO{sub 3} optical constants determined by in situ ellipsometry using a stacking model and the Cauchy dispersion relation for SmFeO{sub 3} layer. We show a good correlation between the transmission and reflection calculated from these data and measured by ex situ spectrophotometry in the visible range.

  5. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    Directory of Open Access Journals (Sweden)

    Kranthi Kumar Gangu

    2016-09-01

    Full Text Available An investigation was conducted into the influence of the amino acids as organic modifiers in the facile synthesis of metal incorporated fluorapatites (FAp and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine. The materials were characterized by various techniques including X-ray diffraction (XRD, Fourier transform infra-red spectroscopy (FT-IR, field emission scanning electron microscopy (FE-SEM, energy-dispersive X-ray spectroscopy (EDX, high resolution transmission electron microscopy (HR-TEM, N2-adsorption/desorption isotherm, temperature programmed desorption (TPD and fluorescence spectrophotometry. Under similar conditions, Sm-FAp prepared using different amino acids exhibited distinctly different morphological structures, surface area and pore properties. Their activity as catalysts was assessed and Sm-FAp/Glycine displayed excellent efficiency in the synthesis of 1,2,4-triazole catalyzing the reaction between 2-nitrobenzaldehyde and thiosemicarbazide with exceptional selectivity and 98% yield in a short time interval (10 min. The study provides an insight into the role of organic modifiers as controllers of nucleation, growth and aggregation which significantly influence the nature and activity of the catalytic sites on Sm-FAp. Sm-FAp could also have potential as photoactive material.

  6. Body composition analysis by DEXA by using dynamically changing samarium filtration

    DEFF Research Database (Denmark)

    Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

    1997-01-01

    , which depends on the current-absorber thickness. With this system we found a good agreement (r = 0.99) between reference and measured amounts of tissue or fat percentages in a plastic phantom and in smaller (approximately 0.5-4 kg) and larger (approximately 5-20 kg) piles of tissue (ox muscle and lard......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

  7. Synthesis, thermal and photoluminescent properties of ZnSe- based oxyfluoride glasses doped with samarium

    Science.gov (United States)

    Kostova, I.; Okada, G.; Pashova, T.; Tonchev, D.; Kasap, S.

    2014-12-01

    Rare earth (RE) doped glasses and glass ceramic materials have recently received considerable attention because of their potential or realized applications as X-ray intensifying screens, phosphors, detectors, waveguides, lasers etc. [1]. In this work, we present a new RE doped ZnO-ZnSe-SrF2-P2O5-B2O3-Sm2O3-SmF3 (ZSPB) glass system synthesized by melt quenching technique. The resulting glasses were visually fully transparent and stable with glass the transition temperatures around 530°C. The thermal properties of this glass system were characterized by Modulated Differential Scanning Calorimetry (MDSC) measurements before and after annealing at 650°C. We have characterized these glasses by Raman spectroscopy and photoluminescence (PL) measurements over the UV-VIS range using light emitting diodes (LED) and laser diodes (LD) excitation sources. We have also irradiated thermally treated and non-treated glass samples by X-rays and have studied the resulting PL. We discuss the results in terms of previously reported models for Sm-doped Zn-borophosphate oxide, oxyfluoride and oxyselenide glasses.

  8. Laser-Induced Luminescence Study of Samarium(III) Thiodiglycolate Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Dong Yong; Lee, Eil Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kimura, Takaumi [Japan Atomic Energy Research Institute, Ibaraki-ken (Japan)

    2003-09-15

    The hydration number of Sm(III) has been obtained by using the difference in the decay rate constants in H{sub 2}O and D{sub 2}O solutions. In general, k{sub obs}(H{sub 2}O) >> k{sub obs}(D{sub 2}O), k{sub obs}(D{sub 2}O) ≅ constant, and ligands are not as effective in causing non-radiative de-excitation of the excited state. For Sm(III), a relationship has been proposed in which the hydration number is related directly to the decay rate constant in H{sub 2}O. If there is no contribution from the ligand to the de-excitation of the luminescence excited state, the hydration of Sm(III) in the different complexes can be obtained directly from the values of k{sub obs} measured in H{sub 2}O. The number and the geometric distribution of solvent molecules around a metal ion in solution are an important factor in the structural and chemical behavior of cation. Indeed, such information has been utilized to design novel ionophores and receptors. However, there have been few studies of hydration structure for lanthanides. The fact that many f-element salts which have relatively large lattice energies are fairly soluble in water is a reflection of the strength of the interactions between the metal cations and water molecules.

  9. Oxygen Fugacity of the Martian Mantle from Pigeonite/Melt Partitioning of Samarium, Europium and Gadolinium

    Science.gov (United States)

    Musselwhite, S.; Jones, J. H.; Shearer, C.

    2004-01-01

    This study is part of an ongoing effort to calibrate the pyroxene/melt Eu oxybarometer for conditions relevant to the martian meteorites. There is fairly good agreement between a determinations using equilibria between Fe-Ti oxides and the estimates from Eu anomalies in shergottite augites in tenns of which meteorites are more or less oxidized. The Eu calibration was for angrite composition pyroxenes which are rather extreme. However, application of a calibration for martian composition augites 113 does not significantly reduce the discrepancy between the two methods. One possible reason for this discrepancy is that augites are non-liquidus. The use of pigeonite rather than augite as the oxy-barometer phase is considered. We have conducted experiments on martian composition pigeonite/melt REE partitioning as a function of fO2.

  10. Doping controlled spin reorientation in dysprosium-samarium orthoferrite single crystals

    Science.gov (United States)

    Cao, Shixun; Zhao, Weiyao; Kang, Baojuan; Zhang, Jincang; Ren, Wei

    2015-03-01

    As one of the most important phase transitions, spin reorientation (SR) in rare earth transition metal oxides draws much attention of emerging materials technologies. The origin of SR is the competition between different spin configurations which possess different free energy. We report the control of spin reorientation (SR) transition in perovskite rare earth orthoferrite Dy1-xSmxFeO3, a whole family of single crystals grown by optical floating zone method from x =0 to 1. Temperature dependence of the magnetizations under zero-field-cooling (ZFC) and field-cooling (FC) processes are studied. We have found a remarkable linear change of SR transition temperature in Sm-rich samples for x>0.2, which covers an extremely wide temperature range including room temperature. The a-axis magnetization curves under FCC process bifurcate from and then jump down to that of warming process (ZFC and FCW curves) in single crystals when x =0.5-0.9, suggesting complicated 4f-3d electron interactions among Dy3+-Sm3+, Dy3+-Fe3+, and Sm3+-Fe3+ sublattices of diverse magnetic configurations for materials physics and design. The magnetic properties and the doping effect on SR transition temperature in these single crystals might be useful in the spintronics device application. This work is supported by the National Key Basic Research Program of China (Grant No. 2015CB921600), and the National Natural Science Foundation of China (NSFC, Nos. 51372149, 50932003, 11274222).

  11. Synthesis, crystal structure and luminescent properties of a new samarium-fluorescein metal-organic framework

    Science.gov (United States)

    Thomas, Jesty; Ambili, K. S.

    2015-10-01

    A new metal-organic framework with empirical formula C43H30NO12Sm was solvothermally synthesized using SmCl3, fluorescein and N, N-Dimethyl formamide (DMF) and characterized by single crystal X-ray diffraction, powder X-ray diffraction, infrared spectroscopy, UV-Visible spectroscopy, scanning electron microscopy, optical microscopy, photoluminescence spectroscopy, CHN elemental analysis and thermogravimetric analysis. Single crystal X-ray diffraction revealed that the crystal structure belongs to the triclinic system, P-1 space group with a = 12.113 (6) Å, b = 12.1734 (7) Å, c = 13.2760(8) Å, α = 67.930(3)⁰, β = 87.779(3)⁰, γ = 77.603(3)⁰ and V = 1769.71 (17) Å3. The photoluminescence spectrum showed emission peaks at 550 nm, 600 nm and 647 nm due to the characteristic transitions 4G5/2 to 6H5/2, 4G5/2 to 6H7/2 and 4G5/2 to 6H9/2 respectively, when excited at 398 nm.

  12. High-temperature heat capacity of samarium and erbium titanates with pyrochlore structure

    Science.gov (United States)

    Denisova, L. T.; Chumilina, L. G.; Denisov, V. M.; Ryabov, V. V.

    2017-12-01

    Titanates Sm2Ti2O7 and Er2Ti2O7 with pyrochlore structure have been prepared by solid-phase synthesis in air from stoichiometric Sm2O3 (Er2O3)-TiO2 mixtures sequentially at 1673 and 1773 K. Hightemperature heat capacity of the oxide compounds has been determined by differential scanning calorimetry. Their thermodynamic properties have been calculated from experimental temperature dependence C p = f( T).

  13. AAV vector encoding human VEGF165–transduced pectineus muscular flaps increase the formation of new tissue through induction of angiogenesis in an in vivo chamber for tissue engineering: A technique to enhance tissue and vessels in microsurgically engineered tissue

    Directory of Open Access Journals (Sweden)

    Silvia Moimas

    2015-12-01

    Full Text Available In regenerative medicine, new approaches are required for the creation of tissue substitutes, and the interplay between different research areas, such as tissue engineering, microsurgery and gene therapy, is mandatory. In this article, we report a modification of a published model of tissue engineering, based on an arterio-venous loop enveloped in a cross-linked collagen–glycosaminoglycan template, which acts as an isolated chamber for angiogenesis and new tissue formation. In order to foster tissue formation within the chamber, which entails on the development of new vessels, we wondered whether we might combine tissue engineering with a gene therapy approach. Based on the well-described tropism of adeno-associated viral vectors for post-mitotic tissues, a muscular flap was harvested from the pectineus muscle, inserted into the chamber and transduced by either AAV vector encoding human VEGF165 or AAV vector expressing the reporter gene β-galactosidase, as a control. Histological analysis of the specimens showed that muscle transduction by AAV vector encoding human VEGF165 resulted in enhanced tissue formation, with a significant increase in the number of arterioles within the chamber in comparison with the previously published model. Pectineus muscular flap, transduced by adeno-associated viral vectors, acted as a source of the proangiogenic factor vascular endothelial growth factor, thus inducing a consistent enhancement of vessel growth into the newly formed tissue within the chamber. In conclusion, our present findings combine three different research fields such as microsurgery, tissue engineering and gene therapy, suggesting and showing the feasibility of a mixed approach for regenerative medicine.

  14. Radiological response of lanthanum guiding seeds in brachytherapy implants; Resposta radiologica de sementes guia de lantanio em implantes braquiterapicos

    Energy Technology Data Exchange (ETDEWEB)

    Silva, L.S.R.; Machado, E.D.P., E-mail: lais26@globo.com [Centro Federal de Educacao Tecnologica de Minas Gerais, Belo Horizonte, MG (Brazil). Departamento de Engenharia de Materiais; Campos, T.P.R. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Roberto, W.S. [Centro Federal de Educacao Tecnologica de Minas Gerais, Belo Horizonte, MG (Brazil). Departamento de Fisica e Matematica

    2013-08-15

    Ceramic seeds with La-139 incorporated were synthesized to be used as radiological guides in brachytherapy implants. The synthesis was performed based on the sol-gel method. The seeds were subjected to characterization by Scanning Electron Microscopy, X-ray diffraction and Energy-Dispersive X-ray Spectroscopy. Furthermore, the contrast from a radiographic film was evaluated to lanthanum, samarium and holmium seeds. Radiological response on a phantom at different depths with lanthanum seeds and metal seeds was also investigated. Based on the values of contrast, the synthesized lanthanum seeds can be considered efficient as radiological guides when implanted together with pure Ho-165 and Sm-152 seeds. (author)

  15. The effectiveness of patient-controlled epidural analgesia with ropivacaine 0.165% with fentanyl 2.0 miroc g/ml or levobupivacaine 0.125% with fentanyl 2.0 micro g/ml as a method of postoperative analgesia after major orthopaedic surgery.

    Science.gov (United States)

    Misiran, Karis Bin; Yahaya, Lenie Suryani Binti

    2013-02-01

    This prospective randomized single-blinded study was conducted to determine whether there were differences in consumption, demand dosing and postoperative analgesia quality between PCEA using ropivacaine and levobupivacaine. Seventy patients with ASA classification I and II aged 18 to 80 years old scheduled for elective total knee replacement or total hip replacement were studied. All patients received CSE and then were randomly allocated to receive either ropivacaine 0.165% (Group A) or levobupivacaine 0.125% (Group B) both added with fentanyl 2.0 mcro g/ml via epidural route. PCEA regime was offered for 48 hours with additional standard orthopaedic practice of oral analgesia (etoricoxib 120 mg OD and paracetamol 1.0 gm QID) on the second postoperative day. Basal infusion of PCEA was at 3.0 ml/hour and discontinued after 24 hours following started of PCEA. The consumption of local anaesthetics used within the first 24 hours (basal + demand) and 48 hours (total basal + total demand) were recorded. The VAS pain score, sedation score, side effects and vital signs (blood pressure, heart rate and respiratory rate) were also recorded every four hours for 48 hours. This study showed that the total volume of drug used was significantly higher in Group A (163.31+/- 29.01 ml) than Group B (142.69 +/- 30.93ml) (phours after surgery was 251.43 +/- 70.02mg and was significantly greater than the mean dose of Group B (178.91 +/-42.33 mg) (pnumbers of PCEA boluses delivered (D) and PCEA attempts (A) were higher in the Group A (22.37 +/-7.32 and 27.66 +/- 9.12) in contrast to Group B (17.63 +/- 7.71 and 24.40 +/- 11.51) but the differences were not statistically significant. The ratio D/A showed significantly higher in Group A (0.83 +/- 0.13) than Group B (0.74 +/- 0.15) (pstudy showed that both PCEA using ropivacaine 0.165% with fentanyl 2.0 micro g/ml and levobupivacaine 0.125% with fentanyl 2.0 micro g/ml provided effective postoperative analgesia within the first 48 hours of

  16. Fluorescence enhancement of samarium (III) perchlorate by 1,10-phenanthroline on Phenylnaphthoylmethyl sulfoxide complex and luminescence mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com; Feng, Shu-Yan; Liu, Yu; Zhang, Jing; Xin, Xiao-Dong; Ao, Bo-Yang; Li, Ying-Jie

    2013-11-15

    A novel ligand, Phenylnaphthoylmethyl sulfoxide, was synthesized by a new method. Its novel binary complex, SmL{sub 5}·(ClO{sub 4}){sub 3}·2H{sub 2}O, and the ternary complex, SmL{sub 4}·L′(ClO{sub 4}){sub 3}·2H{sub 2}O, had been synthesized (using Phenylnaphthoylmethyl sulfoxide as the first ligand L, 1,10-phenanthroline as the second ligand L′). The complexes were characterized by element analysis, coordination titration, molar conductivity, IR, TG-DSC, {sup 1}HNMR and UV spectra. Their fluorescence emission mechanism, fluorescence intensities and phosphorescence spectra of the two ligands were also investigated by comparison. Fluorescent spectra illustrated that the ternary rare-earth complex presented stronger fluorescence intensity than the binary rare-earth complex in such material. The strongest characteristic fluorescence emission intensity of the ternary system was 1.81 times as strong as that of the binary system. By the analysis of fluorescence and phosphorescence spectra, it was found that the Phenylnaphthoylmethyl sulfoxide and phen had the advantage to absorb and transfer energy to Sm (III) ions effectively, and then the complexes emitted the characteristic fluorescence of Sm (III) ions. The phosphorescence spectra and fluorescence lifetime of the complexes were also measured. -- Highlights: • A novel ligand, Phenylnaphthoylmethyl sulfoxide, has been synthesized. • Its novel ternary complex and the binary complex have been synthesized. • The fluorescence emission intensity of ternary rare earth complex exhibit obvious enhancement. • The fluorescence emission mechanism and phosphorescence spectra are also investigated.

  17. Polypropylene oil as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-03-01

    The research focusses on converting polypropylene oil as pyrolysis product of polypropylene plastic into an electricity. The converter was a direct liquid fuel-solid oxide fuel cell (SOFC) with cerium oxide based material as electrolyte. The polypropylene vapor flowed into fuel cell, in the anode side and undergo oxidation reaction, meanwhile, the Oxygen in atmosphere reduced into oxygen ion at cathode. The fuel cell test was conducted at 400 - 600 °C. According to GC-MS analysis, the polypropylene oil consist of C8 to C27 hydrocarbon chain. The XRD analysis result shows that Na2CO3 did not change the crystal structure of SDC even increases the electrical conductivity. The maximum power density is 0.079 mW.cm-2 at 773 K. The open circuite voltage is 0.77 volt. Chemical stability test by analysing the single cell at before and after fuel cell test found that ionic migration occured during fuel cell operation. It is supported by the change of elemental composition in the point position of electrolyte and at the electrolyte-electrode interface

  18. A distribution pattern of cadmium, gadolinium and samarium in Phaseolus vulgaris (L) plants as assessed by dynamic neutron radiography

    Science.gov (United States)

    Kőrösi, Ferenc; Balaskó, Márton; Sváb, Erzsébet

    1999-11-01

    The qualitative and semi-quantitative distributions, presumably apoplast transport patterns for the Gd, Sm and Cd were investigated in the primordial leaf tissues of the bean using dynamic neutron radiography. According to the applied 3D, 2D images and the pixel count distribution histograms of the considered gray levels, peculiar distribution patterns were postulated for the elements. Main and lateral vascular systems for Gd, the cell walls as well as intercellular spaces for Sm and the main leaf vein for Cd assumed to be the apoplast transport spaces and volumes.

  19. Ab initio calculation of the migration free energy of oxygen diffusion in pure and samarium-doped ceria

    Science.gov (United States)

    Koettgen, Julius; Schmidt, Peter C.; Bučko, Tomáš; Martin, Manfred

    2018-01-01

    We have studied the free energy migration barriers Δ F‡ for oxygen diffusion in pure ceria and Sm-doped ceria for the temperatures 300, 700, and 1000 K. We used the density functional theory in the generalized gradient approximation and an additional Hubbard U parameter for the Ce 4 f electronic states. We compare the results for the free energy deduced from three different methods. First, a static harmonic approach is applied in which the temperature dependent vibrational contributions to energy and entropy are deduced from the phonon frequencies of supercells with a fixed volume. Second, a static quasiharmonic approach is used in which a part of the anharmonicity effect is introduced via an implicit dependence of the harmonic frequencies on the thermally expanding cell volume. Third, the free energy barriers are calculated using metadynamics and molecular dynamics in which anharmonicity effects are naturally taken into account. The three methods examined in this study lead to distinctly different results. According to the harmonic approximation, the migration free energy difference Δ F‡ increases with increasing temperature due to an increasing entropic contribution. According to the quasiharmonic approximation, the migration free energy is independent of temperature. Finally, molecular dynamics predicts a thermally induced increase in the migration free energy. We conclude that temperature dependent experimental lattice constants cancel out the increasing entropic contribution with increasing temperature in the static quasiharmonic approach. The full consideration of anharmonicity effects in the metadynamics method again leads to a temperature dependent migration free energy.

  20. Studies on the preparation and stability of samarium-153 propylene diamine tetramethylene phosphonate (PDTMP) complex as a bone seeker

    Energy Technology Data Exchange (ETDEWEB)

    Majali, M.A. E-mail: mythili@magnum.barc.ernet.in; Mathakar, A.R.; Shimpi, H.H.; Banerjee, Sharmila; Samuel, Grace

    2000-12-15

    Propylene diamine tetra methylene phosphonate (PDTMP) was synthesised by modifying a method reported for the synthesis of EDTMP. Complexation of the synthesised phosphonate ligand with {sup 153}Sm was carried out by varying the experimental parameters and the complex was radiochemically characterized. Biodistribution studies showed that the uptake by bone in rats was 2% per g of bone, which was retained up to 48 h. The uptake by other organs was insignificant, except by the liver which showed a slightly higher absorption.

  1. Crystal structure of a samarium(III nitrate chain cross-linked by a bis-carbamoylmethylphosphine oxide ligand

    Directory of Open Access Journals (Sweden)

    Julie A. Stoscup

    2014-10-01

    Full Text Available In the title compound poly[aquabis(μ-nitrato-κ4O,O′:O,O′′tetrakis(nitrato-κ2O,O′{μ4-tetraethyl [(ethane-1,2-diylbis(azanediylbis(2-oxoethane-2,1-diyl]diphosphonate-κ2O,O′}disamarium(III], [Sm2(NO36(C14H30N2O8P2(H2O]n, a 12-coordinate SmIII and a nine-coordinate SmIII cation are alternately linked via shared bis-bidentate nitrate anions into a corrugated chain extending parallel to the a axis. The nine-coordinate SmIII atom of this chain is also chelated by a bidentate, yet flexible, carbamoylmethylphoshine oxide (CMPO ligand and bears one water molecule. This water molecule is hydrogen bonded to nitrate groups bonded to the 12-coordinate SmIII cation. The CMPO ligand, which lies about an inversion center, links neighboring chains along the c axis, forming sheets parallel to the ac plane. Hydrogen bonds between the amide NH group and metal-bound nitrate anions are also present in these sheets. The sheets are packed along the b axis through only van der Waals interactions.

  2. Structure, reactivity, electronic configuration and magnetism of samarium atomic layers deposited on Si(0 0 1) by molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Gheorghe, Nicoleta G.; Lungu, George A.; Husanu, Marius A.; Costescu, Ruxandra M.; Macovei, Dan [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania); Teodorescu, Cristian M., E-mail: teodorescu@infim.ro [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania)

    2013-02-15

    The surface structure, interface reactivity, electron configuration and magnetic properties of Sm layers deposited on Si(0 0 1) at various temperatures are investigated by low-energy electron diffraction (LEED), X-ray photoelectron spectroscopy (XPS), X-ray absorption spectroscopy (XAS) and magneto-optical Kerr effect (MOKE). It is found that metal Sm is present on samples prepared at low temperature, with an interface layer containing SmSi{sub 2} and Sm{sub 4}Si{sub 3}. When samples are prepared at high temperature, much less metal Sm is found, with an increasing amount of SmSi{sub 2}. Room temperature ferromagnetism is observed for all prepared layers, with a decrease of the saturation magnetization when samples are prepared at high temperature. It is found that ferromagnetism implies mostly a compound with approximate stoichiometry Sm{sub 4}Si{sub 3}. Also, the decrease in the intensity of the XAS 2p{sub 3/2} → 3d white lines with the corresponding increasing amount of SmSi{sub 2} may be explained by assuming a higher occupancy of Sm 5d orbitals (5d{sup 2} configuration), most probably due to hybridation effects.

  3. Calculation and comparison of xenon and samarium reactivities of the HEU, LEU core in the low power research reactor.

    Science.gov (United States)

    Dawahra, S; Khattab, K; Saba, G

    2015-07-01

    Comparative studies for the conversion of the fuel from HEU to LEU in the Miniature Neutron Source Reactor (MNSR) have been performed using the MCNP4C and GETERA codes. The precise calculations of (135)Xe and (149)Sm concentrations and reactivities were carried out and compared during the MNSR operation time and after shutdown for the existing HEU fuel (UAl4-Al, 90% enriched) and the potential LEU fuels (U3Si2-Al, U3Si-Al, U9Mo-Al, 19.75% enriched and UO2, 12.6% enriched) in this paper using the MCNP4C and GETERA codes. It was found that the (135)Xe and (149)Sm reactivities did not reach their equilibrium reactivities during the daily operating time of the reactor. The (149)Sm reactivities could be neglected compared to (135)Xe reactivities during the reactor operating time and after shutdown. The calculations for the UAl4-Al produced the highest (135)Xe reactivity in all the studied fuel group during the reactor operation (0.39 mk) and after the reactor shutdown (0.735 mk), It followed by U3Si-Al (0.34 mk, 0.653 mk), U3Si2-Al (0.33 mk, 0.634 mk), U9Mo-Al (0.3 mk, 0.568 mk) and UO2 (0.24 mk, 0.448 mk) fuels, respectively. Finally, the results showed that the UO2 was the best candidate for fuel conversion to LEU in the MNSR since it gave the lowest (135)Xe reactivity during the reactor operation and after shutdown. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Development of samarium [{sup 32}P] phosphate colloid for radiosynoviorthesis applications: Preparation, biological and preliminary clinical studies experience

    Energy Technology Data Exchange (ETDEWEB)

    Prabhakar, G. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India)], E-mail: gantipk47@rediffmail.com; Sachdev, Satbir S.; Umamaheswari, S.; Sivaprasad, N.; Bhatia, Manohar H. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India); Chaudhari, Pradip R. [Laboratory Nuclear Medicine Services, BARC, Mumbai 400 012 (India); Solav, Srikant V. [Spect Lab, Nuclear Medicine Services, Opposite Dinanath Mangeshkar Hospital, Pune 411004 (India)

    2007-12-15

    A new therapeutic radio colloid for radiosynoviorthesis (RS) applications is reported. The method of preparation involves the reaction of SmCl{sub 3} carrier with carrier added [{sup 32}P]H{sub 3}PO{sub 4} in the presence of gelatin. The pure colloid was recovered by dialysis purification leading to radiochemical yield of around 90%. The radiochemical purity of the pure colloid formulated in isotonic saline was over 98%, for the usage period of 14 days, as assessed by paper chromatography. Ninety percent of colloid particles were in the size of 1-10 {mu}m as evident from the laser diffraction particle size analysis, ideally suitable for the intended end use. Animal studies revealed complete retention of the radio colloid in the rabbit knee joint. The results of clinical trials in humans are satisfactory and encouraging, satisfactory retention of the colloid in the knee joint and negligible leakage into the systemic circulation.

  5. All projects related to | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Improving Knowledge Management and Utilization of Research Results in Ecohealth Projects. Project. This study brings together lead investigators from 11 past and ongoing Ecohealth projects across Latin America who are interested in achieving better development outcomes guided by research results. End Date: August ...

  6. 29 CFR 1910.165 - Employee alarm systems.

    Science.gov (United States)

    2010-07-01

    ... emergency action plan, or for reaction time for safe escape of employees from the workplace or the immediate... light levels by all employees in the affected portions of the workplace. Tactile devices may be used to... in the workplace. For those employers with 10 or fewer employees in a particular workplace, direct...

  7. Incomplete fusion reactions in 16 O· 165 Ho

    Indian Academy of Sciences (India)

    Detailed Monte Carlo simulation of recoil range distributions of products were performed with the help of PACE2 code, in order to extract the contributions of incomplete fusion in the individual channels. The results clearly show the incomplete fusion contributions in the tantalum and thulium products. This is confirmed by the ...

  8. Dicty_cDB: SFI165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 2001.11.22 Translated Amino Acid sequence ---IEEEKINLIXQLKELEDXQKSTEDKEKETXQLLIESENKLNLTIESLHQEFDSKIST...Translated Amino Acid sequence (All Frames) Frame A: ---IEEEKINLIXQLKELEDXQKSTEDKEKETXQLLIESENKLNLTIESLHQEFDSKIST

  9. 33_162 - 165_CHM 006 Aliyu SM

    African Journals Online (AJOL)

    userpc

    Aliyu S. M. ent of Chemistry, Federal College of Education, Kano, Nigeria baffasma@gmail.com; +234 7037729095 d at titrimetric determination of Arsenic concentration in samp les and irrigation channels of Hadejia Emirate council, Jigawa Sta samples were randomly collected using standard techniqu rmined immediately ...

  10. What we do | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Expanding Access to Insurance by the Poor : Policy, Regulation and Supervision of Micro Insurance. This project aims to facilitate poor people's access to insurance products and services as a means of addressing their vulnerability to risk. China, Colombia, India, Indonesia, Mali, South Africa. PROJECT ...

  11. Dicty_cDB: SHB165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 231 from Patent WO0168911. 40 0.015 2 BD460434 |BD460434.1 Diagnosis of Diseases Associated with Cell Cycle.... 40 0.015 2 BD452356 |BD452356.1 Diagnosis of Diseases Associated with Cell Cycle

  12. Vegetation - Anza-Borrego Desert State Park [ds165

    Data.gov (United States)

    California Department of Resources — The Anza Borrego Desert State Park (ABDSP) Vegetation Map depicts vegetation within the Park and its surrounding environment. The map was prepared by the Department...

  13. Dicty_cDB: SFD165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TLLAYKLLYPNHMHLTRGNH ETTDMNRFYGFQGEVVAKYSEMVFDLFSELFNWFPLAFVLDESFMVVHGGLFGKDGVTLD DIRKIKRNAPDPKDNELV...TLLAYKLLYPNHMHLTRGNH ETTDMNRFYGFQGEVVAKYSEMVFDLFSELFNWFPLAFVLDESFMVVHGGLFGKDGVTLD DIRKIKRNAPDPKDNELV

  14. 33 CFR 165.755 - Safety Zone; Guayanilla, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ... Zone; Guayanilla, Puerto Rico (a) The following area is established as a safety zone during the... the Eco-Electrica waterfront facility in Guayanilla Bay, Puerto Rico. The safety zone remains in... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Guayanilla, Puerto...

  15. Dicty_cDB: SSE165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' similar to TR:O49447 O49447 ADP, A...TP CARRIER-LIKE PROTEIN. ;, mRNA sequence. 40 2e-06 3 AW509174 |AW509174.1 sh92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS...DP, ATP CARRIER-LIKE PROTEIN. ;, mRNA sequence. 40 3e-06 3 AW395111 |AW395111.1 sh40a06.y1 Gm-c1017 Glycine max cDNA clone GENOME SYS...TEMS CLONE ID: Gm-c1017-4139 5' similar to TR:O49447 O49447 ADP, ATP CARRIER-LIKE P

  16. Dicty_cDB: VHI165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nlifqel*lqiei*lnglqlnyicivildqnhqeih gvvhy*qfsqsfhqielfyhhqkvnlhvlsmqyy*lmkhqsml...EQQTQQ*lskkykq*kn*kn*nkiflnk ir Translated Amino Acid sequence (All Frames) Frame A: ---ivsqmlqk*lkimvqislvy

  17. Dicty_cDB: VFG165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BE471638.1 EST416491 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA29J22, mRNA...|BE343505.1 EST408667 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA25K17, mRNA

  18. 33 CFR 165.1308 - Columbia River, Vancouver, WA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Columbia River, Vancouver, WA..., Vancouver, WA. (a) Location. The following area is a safety zone: All waters of the Columbia River at Vancouver, Washington, bounded by a line commencing at the northern base of the Interstate 5 highway bridge...

  19. 47 CFR 22.165 - Additional transmitters for existing systems.

    Science.gov (United States)

    2010-10-01

    .... (b) Antenna structure registration. Certain antenna structures must be registered with the Commission... contours of the additional transmitter(s) must be totally encompassed by the composite interfering contour... composite service area contour and predicted interfering contour, respectively, of the existing station on...

  20. Dicty_cDB: VHJ165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10 Translated Amino Acid sequence ---CIECXTHSFMSNICKDFMRELGCNICQMFMYATTLCIGLNCTNTI*xqynlfcgfxt nfrlv...Acid sequence (All Frames) Frame A: ---CIECXTHSFMSNICKDFMRELGCNICQMFMYATTLCIGLNCTNTI*xqynlfcgfxt nfrlv

  1. Dicty_cDB: VHD165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Diploid Ustilago maydis cDNA 3', mRNA sequence. 58 6e-04 1 DX751003 |DX751003.1 2209995 VV03 Ustilago maydis...58 6e-04 1 DX663648 |DX663648.1 2273936 VV02 Ustilago maydis genomic clone 932366, genomic survey sequence...58 6e-04 1 DX660012 |DX660012.1 2007873 VV02 Ustilago maydis genomic clone 818001, genomic survey sequence...58 6e-04 1 DX654619 |DX654619.1 2293968 VV02 Ustilago maydis genomic clone 832521, genomic survey sequence...58 6e-04 1 DX641930 |DX641930.1 1930348 VV02 Ustilago maydis genomic clone 790799, genomic survey sequence

  2. 40 CFR 165.45 - Refillable container standards.

    Science.gov (United States)

    2010-07-01

    ... liquid pesticide or equal to or greater than 4,000 pounds (1,818 kilograms) of dry pesticide is located... foresight, each stationary pesticide container (for liquid and dry pesticides) and its appurtenances must... thick to not fail and that are resistant to corrosion, puncture, or cracking. (ii) Each stationary...

  3. What we do | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Part of Canada's foreign affairs and development efforts, IDRC invests in knowledge, innovation, and solutions to improve the lives of people in the developing ... on Basic Education (1996), a study that is widely known as the PROBE report, has made a significant contribution to public policy on primary education in India.

  4. Conjunctival tumors in children: histopathologic diagnosis in 165 cases.

    Science.gov (United States)

    Zimmermann-Paiz, Martin A; García de la Riva, Juan Carlos

    2015-01-01

    Conjunctival tissue tumors have a varied presentation, and few series studies on pediatric patients have been published. The objective of this paper is to report the histopathologic diagnoses (spanning over 1988-2013) of conjunctival tumors in children younger than 14 years. We conducted a retrospective, descriptive, and observational study by reviewing the database of all children in whom a conjunctival tumor was surgically removed at Hospital de Ojos y Oídos "Dr. Rodolfo Robles V.," Benemérito Comité Pro Ciegos y Sordos de Guatemala. The data pertaining to gender, age, and histopathologic diagnosis of all cases was collected. The same ocular pathologist made all diagnoses. One hundred sixty-five cases were found, with a mean age of 7.88 years, being 91 (55.15%) male subjects. Melanocytic lesions were the most common tumors found (30.91% of cases), with only one case (0.60%) being malignant. Melanocytic lesions were the most common tumors found, and of all the cases, only one was malignant; this was in a patient with xeroderma pigmentosum. These findings are consistent with those reported in other studies regarding the frequencies of the histopathology of conjunctival tumors in the pediatric population.

  5. Conjunctival tumors in children: histopathologic diagnosis in 165 cases

    Directory of Open Access Journals (Sweden)

    Martin A. Zimmermann-Paiz

    2015-12-01

    Full Text Available ABSTRACT Purpose: Conjunctival tissue tumors have a varied presentation, and few series studies on pediatric patients have been published. The objective of this paper is to report the histopathologic diagnoses (spanning over 1988-2013 of conjunctival tumors in children younger than 14 years. Methods: We conducted a retrospective, descriptive, and observational study by reviewing the database of all children in whom a conjunctival tumor was surgically removed at Hospital de Ojos y Oídos "Dr. Rodolfo Robles V.," Benemérito Comité Pro Ciegos y Sordos de Guatemala. The data pertaining to gender, age, and histopathologic diagnosis of all cases was collected. The same ocular pathologist made all diagnoses. Results: One hundred sixty-five cases were found, with a mean age of 7.88 years, being 91 (55.15% male subjects. Melanocytic lesions were the most common tumors found (30.91% of cases, with only one case (0.60% being malignant. Conclusions: Melanocytic lesions were the most common tumors found, and of all the cases, only one was malignant; this was in a patient with xeroderma pigmentosum. These findings are consistent with those reported in other studies regarding the frequencies of the histopathology of conjunctival tumors in the pediatric population.

  6. Dicty_cDB: AFO165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CVVGGKEIRTGDVQKQLICSDHNKVLATFHQANAELLKLAVENSMESKAQWESLPFEARS AVFLKAADLLNTKYRYDVLASTMLGQGKTVWQAEIDAAAEGIDFLRFNVKYAQEIYQQQP...CVVGGKEIRTGDVQKQLICSDHNKVLATFHQANAELLKLAVENSMESKAQWESLPFEARS AVFLKAADLLNTKYRYDVLASTMLGQGKTVWQAEIDAAAEGIDFLRFNVKYAQEIYQQQP

  7. Publications | Page 165 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  8. 40 CFR 165.23 - Scope of pesticide products included.

    Science.gov (United States)

    2010-07-01

    ... systems, surfaces, water, or other chemical substances from contamination, fouling, or deterioration... causes or could reasonably be expected to cause an unreasonable adverse effect on the environment. (iv... equipment; residential and public access premises; medical premises and equipment; human drinking water...

  9. 40 CFR 165.43 - Scope of pesticide products included.

    Science.gov (United States)

    2010-07-01

    ... to cause an unreasonable adverse effect on the environment. (iv) Complying with the container... microbiological organisms; or protect inanimate objects, industrial processes or systems, surfaces, water, or other chemical substances from contamination, fouling, or deterioration caused by bacteria, viruses...

  10. 40 CFR 165.63 - Scope of pesticide products included.

    Science.gov (United States)

    2010-07-01

    ... systems, surfaces, water, or other chemical substances from contamination, fouling, or deterioration..., surfaces, water, or other chemical substances from contamination, fouling, or deterioration caused by... could reasonably be expected to cause an unreasonable adverse effect on the environment. (iv) Complying...

  11. 49 CFR 1.65 - Authority to classify information.

    Science.gov (United States)

    2010-10-01

    ....65 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND... Communications Watch or comparable readiness state. (1) OST. Deputy Secretary; Assistant Secretary for... direction of” a designated official. The formal appointment or assignment of an individual to one of the...

  12. 165 Arab Spring: The Genesis, Effects and Lessons for the ...

    African Journals Online (AJOL)

    First Lady

    2013-01-28

    Jan 28, 2013 ... On December 17, 2010, local Tunisian authorities seized the vegetable .... economic difficulties, political rights and rising food prices vis-à-vis ..... slowdown expected from tourism, which is the country's economic mainstay.

  13. 40 CFR 165.25 - Nonrefillable container standards.

    Science.gov (United States)

    2010-07-01

    ...: (1) Bung, 2 inch pipe size (2.375 inches in diameter), external threading, 11.5 threads per inch, National Pipe Straight (NPS) standard. (2) Bung, 2 inch pipe size (2.375 inches in diameter), external... per inch. The cap may fit on a separate rigid spout or on a flexible pull-out plastic spout. (e) What...

  14. Dicty_cDB: VSF165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IRIGSSALTSRGLKEADFEKIADFLDRIVSISLEIQGRVGKKLVDFVVEINKSKELLDLR KEVEEXSSKFTLPGI*i Translated Amino Acid... IRIGSSALTSRGLKEADFEKIADFLDRIVSISLEIQGRVGKKLVDFVVEINKSKELLDLR KEVEEXSSKFTLPGI*i Frame B: rqfkglelias

  15. Dicty_cDB: VSA165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N BQ507669 |BQ507669.2 EST615084 Generation of a set of potato cDNA clones for microarray analyses ...ence. 32 0.070 3 BQ507668 |BQ507668.1 EST615083 Generation of a set of potato cDNA clones for microarray ana

  16. People’s Republic of China Scientific Abstracts, Number 165.

    Science.gov (United States)

    1977-03-24

    Section, Institute of Oncology , Chinese Academy of Medical Sciences TITLE: "Somatic Chromosome Banding Pattern Among Normal Chinese" SOURCE: Peking I...injections, massage and physiotherapy . Of 331 cases thus treated, the cured and improved rate was 88.2%. Adding penicillin and prednisone in another

  17. 21 CFR 16.5 - Inapplicability and limited applicability.

    Science.gov (United States)

    2010-04-01

    ... under section 801(a) of the act and § 1.94, or of an electronic product under section 360(a) of the... Public Health Service Act (42 U.S.C. 264), and § 118.12 of this chapter. (b) If a regulation provides a...

  18. 40 CFR 80.165 - Certification test procedures and standards.

    Science.gov (United States)

    2010-07-01

    ..._locations.html. Copies of this material may be obtained from ASTM, 1916 Race St., Philadelphia, PA 19103. (2... from ASTM, 1916 Race St., Philadelphia, PA 19103. (c) If conducted using test fuels meeting all... Board, “Test Method for Evaluating Port Fuel Injector (PFI) Deposits in Vehicle Engines”, March 1, 1991...

  19. What we do | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic(s): Environmental Health, Water Pollution, Waste Waters, Waste Treatment, Solid Wastes, Waste Disposal, Sanitation Services, Health Hazards, Child Welfare. Region(s): Africa, Cameroon, South Of Sahara. The first phase of the project was funded after qualifying in a competition for projects featuring an ecosystem ...

  20. 27 CFR 70.165 - Production of books.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Production of books. 70... books. If a levy has been made or is about to be made on any property or rights to property, any person, having custody or control of any books or records containing evidence or statements relating to the...

  1. 50 CFR 216.165 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... one who has graduated from a veterinary school accredited by the American Veterinary Medical Association Council on Education, has a certificate by the American Veterinary Graduates Association's Education Commission for Foreign Veterinary Graduates, or has received equivalent formal education, as...

  2. 21 CFR 133.165 - Parmesan and reggiano cheese.

    Science.gov (United States)

    2010-04-01

    ... equivalent curd formation, or both, with or without purified calcium chloride in a quantity not more than 0... with potassium alum, calcium sulfate, and magnesium carbonate; but the weight of the benzoyl peroxide... alum, calcium sulfate, and magnesium carbonate, singly or combined, is not more than six times the...

  3. Dicty_cDB: SHH165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Medicago truncatula clone MTYF9_FA... 33 2.2 BT050875_1( BT050875 |pid:none) Medicago truncatula...|pid:none) Medicago truncatula clone MTYF5_F6... 32 6.4 BT051012_1( BT051012 |pid:none) Medicago truncatula...|pid:none) Medicago truncatula clone MTYFD_FE... 32 6.4 BT050752_1( BT050752 |pid:none) Medicago truncatula...|pid:none) Medicago truncatula clone MTYFT1G-... 32 6.4 BT050896_1( BT050896 |pid:none) Medicago truncatula...MTYF9_FA... 32 6.4 BT050816_1( BT050816 |pid:none) Medicago truncatula clone MTYF5_F6... 32 6.4 protein update

  4. Isolation and Structural Characterization of a Mackay 55-Metal-Atom Two-Shell Icosahedron of Pseudo-Ih Symmetry, Pd55L12(μ3-CO)20 (L = PR3, R = Isopropyl): Comparative Analysis with Interior Two-Shell Icosahedral Geometries in Capped Three-Shell Pd145, Pt-Centered Four-Shell Pd-Pt M165, and Four-Shell Au133 Nanoclusters.

    Science.gov (United States)

    Erickson, Jeremiah D; Mednikov, Evgueni G; Ivanov, Sergei A; Dahl, Lawrence F

    2016-02-10

    We present the first successful isolation and crystallographic characterization of a Mackay 55-metal-atom two-shell icosahedron, Pd55L12(μ3-CO)20 (L = PPr(i)3) (1). Its two-shell icosahedron of pseudo-Ih symmetry (without isopropyl substituents) enables a structural/bonding comparison with interior 55-metal-atom two-shell icosahedral geometries observed within the multi-shell capped 145-metal-atom three-shell Pd145(CO)72(PEt3)30 and 165-metal-atom four-shell Pt-centered (μ12-Pt)Pd164-xPtx(CO)72(PPh3)20 (x ≈ 7) nanoclusters, and within the recently reported four-shell Au133(SC6H4-p-Bu(t))52 nanocluster. DFT calculations carried out on a Pd55(CO)20(PH3)12 model analogue, with triisopropyl phosphine substituents replaced by H atoms, revealed a positive +0.84 e charge for the entire Pd55 core, with a highly positive second-shell Pd42 surface of +1.93 e.

  5. Tetrakis(μ-propanoato-κ2O:O′bis[(1,10-phenanthroline-κ2N,N′(propanoato-κ2O,O′samarium(III

    Directory of Open Access Journals (Sweden)

    Chun-Xiang Wang

    2008-01-01

    Full Text Available The title complex, [Sm2(C3H5O26(C12H8N22], is a dinuclear centrosymmetric molecule, in which two crystallographically equivalent Sm atoms, separated by 3.9502 (2 Å, are bridged by four propanoate anions. Each Sm atom is coordinated by two N atoms from one chelating phenanthroline ligand and seven carboxylate O atoms from five propanoate anions, to form a distorted tricapped trigonal prism.

  6. Processing of composites based on NiO, samarium-doped ceria and carbonates (NiO-SDCC as anode support for solid oxide fuel cells

    Directory of Open Access Journals (Sweden)

    Lily Siong Mahmud

    2017-09-01

    Full Text Available NiO-SDCC composites consisting of NiO mixed with Sm-doped ceria (SDC and carbonates (Li2CO3 and Na2CO3 were sintered at different temperatures and reduced at 550 °C. The influence of reduction on structure of the NiO-SDCC anode support for solid oxide fuel cells (SOFCs was investigated. Raman spectra of the NiO-SDCC samples sintered at 500, 600 and 700 °C showed that after reducing at 550 °C NiO was reduced to Ni. In addition, SDC and carbonates (Li2CO3 and Na2CO3 did not undergo chemical transformation after reduction and were still detected in the samples. However, no Raman modes of carbonates were identified in the NiO-SDCC pellet sintered at 1000 °C and reduced at 550 °C. It is suspected that carbonates were decomposed at high sintering temperature and eliminated due to the reaction between the CO32– and hydrogen ions during reduction in humidified gases at 550 °C. The carbonate decomposition increased porosity in the Ni-SDCC pellets and consequently caused formation of brittle and fragile structure unappropriated for SOFC application. Because of that composite NiO-SDC samples without carbonates were also analysed to determine the factors affecting the crack formation. In addition, it was shown that the different reduction temperatures also influenced the microstructure and porosity of the pellets. Thus, it was observed that Ni-SDC pellet reduced at 800 °C has higher electrical conductivity of well-connected microstructures and sufficient porosity than the pellet reduced at 550 °C.

  7. The single cell of low temperature solid oxide fuel cell with sodium carbonate-SDC (samarium-doped ceria) as electrolyte and biodiesel as fuel

    Science.gov (United States)

    Rahmawati, F.; Nuryanto, A.; Nugrahaningtyas, K. D.

    2016-02-01

    In this research NSDC (composite of Na2CO3-SDC) was prepared by the sol-gel method to produce NSDC1 and also by the ceramic method to produce NSDC2. The prepared NSDC then were analyzed by XRD embedded with Le Bail refinement to study the change of characteristic peaks, their crystal structure, and their cell parameters. Meanwhile, the measurement of impedance was conducted to study the electrical conductivity of the prepared materials. A single cell was prepared by coating NSDC-L (a composite of NSDC with Li0.2Ni0.7Cu0.1O2) on both surfaces of NSDC. The NSDC-L was used as anode and cathode. The ionic conductivity of NSDC1 and NSDC2 at 400 oC are 4.1109 x 10-2 S.cm-1 and 1.6231 x 10-2 S.cm-1, respectively. Both electrolytes have ionic conductivity higher than 1 x 10-4 S.cm-1, therefore, can be categorized as good electrolyte [1]. However, the NSDC1 shows electrodeelectrolyte conduction. It indicates the existence of electronic migration from electrolyte- electrode or vice versa. Those may cause a short circuit during fuel cell operation and will reduce the fuel cell performance fastly. The single cell tests were conducted at 300, 400, 500 and 600 °C. The single fuel cell with NSDC1 and NSDC2 as electrolyte show maximum power density at 400 °C with the power density of 3.736 x 10-2 mW.cm-2 and 2.245 x 10-2 mW.cm-2, respectively.

  8. Samarium-neodymium chronology and rubidium-strontium systematics of an Allende calcium-aluminum-rich inclusion with implications for 146Sm half-life

    Science.gov (United States)

    Marks, N. E.; Borg, L. E.; Hutcheon, I. D.; Jacobsen, B.; Clayton, R. N.

    2014-11-01

    Calcium-aluminum-rich inclusions (CAIs) are primitive objects that formed within the protoplanetary disk surrounding the young Sun. Recent Pb-Pb chronologic studies have demonstrated that CAIs are the oldest solar system solids, crystallizing 4567 Ma ago (Amelin et al., 2002; Connelly et al., 2012). The isotope systematics of CAIs therefore provide critical insight into the earliest history of the Solar System. Although Sm-Nd and Rb-Sr geochronometers are highly effective tools for investigating cosmochemical evolution in the early Solar System, previous studies of CAIs have revealed evidence for isotopically disturbed systems. Here we report new age data for Allende CAI Al3S4 derived from both the long-lived (147Sm-143Nd) and short-lived (146Sm-142Nd) isotopic systems. The 147Sm-143Nd chronometer yields an age of 4560 ± 34 Ma that is concordant with 207Pb-206Pb ages for CAIs and indicates that the Sm-Nd system was not significantly disturbed by secondary alteration or nucleosynthetic processes. The slope of the 146Sm-142Nd isochron defines the Solar System initial 146Sm/144Sm of 0.00828 ± 0.00044. This value is significantly different from the value of 0.0094 determined by Kinoshita et al. (2012). Ages recalculated from all published 146Sm-142Nd isochron data using the traditional 103 Ma half-life and the initial 146Sm/144Sm value determined here closely match Pb-Pb and 147Sm-143Nd ages determined on the same samples. In contrast, ages recalculated using the 68 Ma half-life determined by Kinoshita et al. (2012) and either of the initial 146Sm/144Sm values are often anomalously old. This is particularly true for the youngest samples with 146Sm-142Nd isochron ages that are most sensitive to the choice of 146Sm half-life used in the age calculation. In contrast to the Sm-Nd isotope system, the Rb-Sr system is affected by alteration but yields an apparent isochron with a slope corresponding to a much younger age of 4247 ± 110 Ma. Although the Rb-Sr system in CAIs appears to be disturbed, the initial 87Sr/86Sr value determined from the isochron is 0.698942 ± 0.000008, and closely approximates estimates of the initial Solar System value. Although this isochron may be a mixing line, it might also record alteration on the Allende parent body in which Rb was added to the Al3S4 CAI that was initially largely devoid of Rb.

  9. Anthropogenic dissolved and colloid/nanoparticle-bound samarium, lanthanum and gadolinium in the Rhine River and the impending destruction of the natural rare earth element distribution in rivers

    Science.gov (United States)

    Kulaksız, Serkan; Bau, Michael

    2013-01-01

    The strong increase in the consumption of rare earth elements (REE) in high-tech products and processes is accompanied by increasing amounts of REE released into the environment. Following the first report of Gd contamination of the hydrosphere in 1996, anthropogenic Gd originating from contrast agents has now been reported worldwide from river and estuarine waters, coastal seawater, groundwater and tap water. Recently, microcontamination with La, that is derived from a point source where catalysts for petroleum refining are produced, has been detected in the Rhine River in Germany and the Netherlands. Here we report the occurrence of yet another REE microcontamination of river water: in addition to anthropogenic Gd and La, the Rhine River now also shows significant amounts of anthropogenic Sm. The anthropogenic Sm, which enters the Rhine River north of Worms, Germany, with the same industrial wastewater that carries the anthropogenic La, can be traced through the Middle and Lower Rhine to the Netherlands. At Leverkusen, Germany, some 250 km downstream from the point source at Worms, anthropogenic Sm still contributes up to 87% of the total dissolved Sm concentration of the Rhine River. Results from ultrafiltration suggest that while the anthropogenic Gd is not particle-reactive and hence exclusively present in the truly dissolved REE pool (Worms get close to and well-above, respectively, the levels at which ecotoxicological effects have been documented. Because of the increasing use of REE and other formerly "exotic" trace elements in high-tech applications, these critical metals have now become emerging contaminants that should be monitored, and it appears that studies of their biogeochemical behavior in natural freshwaters might soon no longer be possible.

  10. Ultra-Sensitive Nano Optical Sensor Samarium-Doxycycline Doped in Sol Gel Matrix for Assessment of Glucose Oxidase Activity in Diabetics Disease.

    Science.gov (United States)

    Tharwat, Marwa M; Attia, M S; Alghamdi, M S; Mahros, Amr M

    2017-07-11

    A low cost and very sensitive method for the determination of the activity of glucose oxidase enzyme in different diabetics serum samples was developed. The method based on the assessment of the H2O2 concentration produced from the reaction of the glucose oxidase (GOx) enzyme with glucose as substrate in the serum of diabetics patients by nano optical sensor Sm-doxycycline doped in sol gel matrix. H2O2 enhances the luminescence intensity of all bands of the nano Sm-doxycycline complex [Sm-(DC)2](+) doped in sol-gel matrix, especially the 645 nm band at λex = 400 nm and pH 7.0 in water. The influence of the different analytical parameters that affect the luminescence intensity of the nano optical sensor, e.g. pH, H2O2 concentration and foreign ions concentrations were studied. The remarkable enhancement of the luminescence intensity of nano optical sensor [Sm-(DC)2](+) complex in water at 645 nm by the addition of various concentrations of H2O2 was successfully used as an optical sensor for the assessment of the activity of the glucose oxidase enzyme in different diabetics serum samples. The calibration plot was achieved over the activity range 0.1-240 U/L with a correlation coefficient of 0.999 and a detection limit of 0.05 U/L.

  11. Effect of Mg doping and sintering temperature on structural and morphological properties of samarium-doped ceria for IT-SOFC electrolyte

    Science.gov (United States)

    Ahmad, Syed Ismail; Mohammed, Tasneem; Bahafi, Amal; Suresh, Madireddy Buchi

    2017-06-01

    Samples of Sm and Mg co-doped ceria electrolyte of Ce1- x Sm x- y Mg y O2- δ ( x = 0.2; y = 0.00, 0.05, 0.1, 0.15, and 0.175) were synthesized by sol-gel process. The prepared samples were sintered at 1100 and 1400 °C for 4 h. The bulk densities were measured by Archimedes method. XRD measurements indicate that the synthesized samples were in single-phase cubic fluorite structure (space group Fm3m). The cell parameters decrease with the concentration of Mg, and 2 θ values slightly shift towards right. The particle sizes obtained were between 7.14 and 17.44 nm. The sintered sample achieved 95% of theoretical density. FTIR spectra of samples sintered at 1400 °C indicates weak interactions between 3550-3400 cm-1 and 1600-1300 cm-1 are attributed to O-H stretching modes and strong bonds 850-450 cm-1 are assigned to characteristic Ce-O vibrations. The surface morphology and chemical composition were analyzed by SEM and EDS, SEM micrographs show spherical faceted grains, and the samples were crack free, dense material with some pores on surface which are inconsistent with density results. The average grain size obtained was 0.5 μm. Particle size obtained by TEM was in agreement with that obtained by XRD. The high-density ceria co-doped ceramic can be used as electrolyte in SOFC.

  12. Synthesis, spectroscopic, thermal and antimicrobial studies of neodymium(III) and samarium(III) complexes derived from tetradentate ligands containing N and S donor atoms

    Science.gov (United States)

    Ain, Qurratul; Pandey, S. K.; Pandey, O. P.; Sengupta, S. K.

    2015-04-01

    Trivalent lanthanide complexes of the type [Ln(L)Cl(H2O)2] (where Ln = Nd(III) or Sm(III) and LH2 = Schiff bases derived by the condensation of 3-(phenyl/substitutedphenyl)-4-amino-5-mercapto-1,2,4-triazole with diacetyl/benzil) have been synthesized by the reactions of anhydrous lanthanide(III) chloride with Schiff bases in methanol. The structures of the complexes have been proposed on the basis of elemental analysis, electrical conductance, magnetic moment, spectroscopic measurements (IR, 1H, 13C NMR and UV-vis spectra) and X-ray diffraction studies. The spectral data reveal that the Schiff base ligands behave as dibasic tetradentate chelating agents having coordination sites at two thiol sulfur atoms and two azomethine nitrogen atoms. The presence of coordinated water in metal complexes was confirmed by thermal and IR data of the complexes. All the Schiff bases and their metal complexes have also been screened for their antibacterial activity against Bacillus subtilis, Staphylococcus aureus and antifungal activities against Aspergillus niger, Curvularia pallescens and Colletotrichum capsici.

  13. Logarithmic temperature dependence of samarium ion valence in the heavy-fermion S mxL a1 -xO s4S b12

    Science.gov (United States)

    Fushiya, Kengo; Miyazaki, Ryoichi; Higashinaka, Ryuji; Yamada, Akira; Mizumaki, Masaichiro; Tsutsui, Satoshi; Nitta, Kiyofumi; Uruga, Tomoya; Suemitsu, Bunya; Sato, Hideyuki; Aoki, Yuji

    2015-08-01

    We have measured x-ray absorption spectra at the Sm L3 edge to investigate the Sm-ion valence of (S mxL a1 -x) O s4S b12 , in which field-insensitive heavy-fermion behavior appears at low temperatures for x =1 . It has been found that the Sm-ion valance shifts to 2 + with La ion substitution; from v =+2.78 (x =1 ) to v =+2.73 (x =0.2 ) at 10 K. For all x investigated, its temperature dependence shows a logT behavior, indicating that the valence change is caused by "an unconventional Kondo effect" associated with Sm 4 f -electron charge degrees of freedom. Almost x independence of "the associated Kondo temperature" (T˜K=56 ±10 K ) indicates that the Kondo effect has a local nature, attributable to the cage structure of the filled skutterudite.

  14. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water

    Energy Technology Data Exchange (ETDEWEB)

    Merschel, Gila, E-mail: g.merschel@jacobs-university.de; Bau, Michael

    2015-11-15

    High-technology metals — such as the rare earth elements (REE) — have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. - Highlights: • Corbicula fluminea shells are bioarchives of dissolved geogenic REE in rivers. • Anthropogenic La and Sm in the Rhine River are bioavailable, hence incorporated. • Anthropogenic Gd from contrast agents is not incorporated, i.e. not bioavailable. • REE concentrations in Corbicula shells decrease with increasing size, i.e. age.

  15. Mechanically induced strong red emission in samarium ions doped piezoelectric semiconductor CaZnOS for dynamic pressure sensing and imaging

    Science.gov (United States)

    Wang, Wei; Peng, Dengfeng; Zhang, Hanlu; Yang, Xiaohong; Pan, Caofeng

    2017-07-01

    Piezoelectric semiconductor with optical, electrical and mechanical multifunctions has great potential applications in future optoelectronic devices. The rich properties and applications mainly encompass the intrinsic structures and their coupling effects. Here, we report that lanthanide ions doped piezoelectric semiconductor CaZnOS:Sm3+ showing strong red emission induced by dynamic mechanical stress. Under moderate mechanical load, the doped piezoelectric semiconductor exhibits strong visible red emission to the naked eyes even under the day light. A flexible dynamic pressure sensor device is fabricated based on the prepared CaZnOS:Sm3+ powders. The mechanical-induced emission properties of the device are investigated by the optical fiber spectrometer. The linear characteristic emissions are attributed to the 4G5/2→6H5/2 (566 nm), 4G5/2→6H7/2 (580-632 nm), 4G5/2→6H9/2 (653-673 nm) and 4G5/2→6H11/2 (712-735 nm) f-f transitions of Sm3+ ions. The integral emission intensity is proportional to the value of applied pressure. By using the linear relationship between integrated emission intensity and the dynamic pressure, the real-time pressure distribution is visualized and recorded. Our results highlight that the incorporation of lanthanide luminescent ions into piezoelectric semiconductors as smart materials could be applied into the flexible mechanical-optical sensor device without additional auxiliary power, which has great potential for promising applications such as mapping of personalized handwriting, smart display, and human machine interface.

  16. Investigation of oxidative coupling of methane over bismuth oxychloride, samarium chloride, or manganese chloride supported on lithium carbonate-magnesia systems

    Energy Technology Data Exchange (ETDEWEB)

    Khan, A.Z.; Ruckenstein, E. (State Univ. of New York, Buffalo, NY (United States))

    1992-11-01

    The magnesia-supported bismuth oxychloride with lithium carbonate present is significantly more effective and stable with time-on-stream than the unsupported or supported systems free of Li[sub 2]CO[sub 3] in the oxidative coupling of methane at 750[degrees]C, P[sub CH[sub 4

  17. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water.

    Science.gov (United States)

    Merschel, Gila; Bau, Michael

    2015-11-15

    High-technology metals - such as the rare earth elements (REE) - have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Samario-153-Lexidronam (EDTMP) en el tratamiento de las metástasis óseas Samarium-153-Lexidronam (EDTMP) for the management of bone metastases

    OpenAIRE

    F. Torre; C. Gómez-Vega; A. Callejo; J. Genolla

    2004-01-01

    Las metástasis óseas son una complicación frecuente en pacientes neoplásicos, en este sentido, el tejido óseo ocupa el tercer lugar de todos los órganos y sistemas con metástasis después del pulmón e hígado. Aproximadamente un 75% de los enfermos con metástasis óseas sufrirán dolor, siendo estas la causa más frecuente de dolor en pacientes con cáncer. El dolor óseo aumenta con los movimientos y a la presión, limitando la autonomía del enfermo y su calidad de vida. El tratamiento incluye vario...

  19. Morphology and orientation of β-BaB{sub 2}O{sub 4} crystals patterned by laser in the inside of samarium barium borate glass

    Energy Technology Data Exchange (ETDEWEB)

    Nishii, Akihito; Shinozaki, Kenji; Honma, Tsuyoshi; Komatsu, Takayuki, E-mail: komatsu@mst.nagaokaut.ac.jp

    2015-01-15

    Nonlinear optical β-BaB{sub 2}O{sub 4} crystal lines (β-BBO) were patterned in the inside of 8Sm{sub 2}O{sub 3}–42BaO–50B{sub 2}O{sub 3} glass by irradiations of continuous-wave Yb:YVO{sub 4} lasers with a wavelength of 1080 nm (power: P=0.8–1.0 W, scanning speed: S=0.2–2.5 μm/s), in which the laser focal position was moved gradually from the surface to the inside. The morphology, size, and orientation of β-BBO crystals were examined from polarization optical microscope and birefringence imaging observations. It was demonstrated that c-axis oriented β-BBO crystals with long lengths (e.g., 20 mm) were patterned in the inside of the glass. The morphology of β-BBO in the cross-section of lines was a rectangular shape with rounded corners, and the volume of β-BBO formed increased with increasing laser power and with decreasing laser scanning speed. The maximum depth in the inside from the surface for β-BBO patterning increased with increasing laser power, e.g., D{sub max}∼100 μm at P=0.8 W, D{sub max}∼170 μm at P=0.9 W, and D{sub max}∼200 μm at P=1 W. The present study proposes that the laser-induced crystallization opens a new door for applied engineering in glassy solids. - Graphical abstract: This figure shows the POM photographs for β-BaB{sub 2}O{sub 4} crystal lines patterned by cw Yb:YVO{sub 4} fiber laser irradiations with a laser power of P=0.8 W and a laser scanning speed S=2 μm/s in the glass. The laser focal point was moved gradually from the surface into the inside. The results shown in Fig. 1 demonstrate that it is possible to pattern highly oriented β-BaB{sub 2}O{sub 4} crystals even in the inside of glasses. - Highlights: • β-BaB{sub 2}O{sub 4} crystal lines were patterned in the inside of a glass by lasers. • Laser focal position was moved gradually from the surface to the inside. • Birefringence imaging was observed. • Morphology, size, and orientation of crystals were clarified. • Crystal lines with long lengths (e.g., 20 mm) were patterned at the depth of 200 μm.

  20. 10 CFR Appendix C to Part 20 - Quantities 1 of Licensed Material Requiring Labeling

    Science.gov (United States)

    2010-01-01

    ... Samarium-151 10 Samarium-153 100 Samarium-155 1,000 Samarium-156 1,000 Europium-145 100 Europium-146 100 Europium-147 100 Europium-148 10 Europium-149 100 Europium-150 (12.62h) 100 Europium-150 (34.2y) 1 Europium-152m 100 Europium-152 1 Europium-154 1 Europium-155 10 Europium-156 100 Europium-157 100 Europium-158 1...

  1. An experiment using neutron activation analysis and a rare earth element to mark cotton plants and two insects that feed on them

    Energy Technology Data Exchange (ETDEWEB)

    Showler, Allan T. [USDA-ARS IFNRRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States)]. E-mail: ashowler@weslaco.ars.usda.gov; James, William D. [Elemental Analysis Laboratory, 3144 Texas A and M University, College Station, TX 77843-3144 (United States); Armstrong, John S. [USDA-ARS BIRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States); Westbrook, John K. [USDA-ARS APMRU, 2771 F and B Road, College Station, TX 77845-4966 (United States)

    2006-08-15

    Studies on insect dispersal and other behaviors can benefit from using markers that will not alter flight and fitness. Rare earth elements, such as samarium (Sm), have been used as ingested markers of some insects and detected using neutron activation analysis (NAA). In this study, samarium nitrate hexahydrate was mixed into artificial diet for boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), at different dosages and in water used to irrigate cotton, Gossypium hirsutum L. Samarium was detected in adult boll weevils fed on the samarium-labeled diet, but not after 5 or 10 days of being switched to non-labeled diet, even if the insects were given labeled diet for as long as 7 consecutive days. Introduced in irrigation water, 1% samarium (m/m) was detectable in cotton squares and leaf tissue. However, boll weevil adults fed samarium-labeled squares did not retain detectable levels of samarium, nor did boll weevil adults reared to adulthood from samarium-labeled squares. Fourth instar beet armyworms, Spodoptera exigua (Huebner) (Noctuidae: Lepidoptera), fed on samarium-labeled cotton leaves obtained enough samarium for NAA detection, but adult moths reared from them did not have detectable amounts of samarium. Although samarium can be useful as a marker when insects are presented with a continuous pulse of the label, elements that are assimilated by the insect would be more useful if a continuous infusion of the marker cannot be provided.

  2. Microspheres of polyester loaded with Holmium-165: effect of gamma irradiation on the polymeric structure

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, Mariangela de Burgos M. de; Pires, Geovanna; Lira, Rafael A. de; Geraldes, Adriana N.; Nascimento, Nanci; Melo, Vitor Hugo Soares de, E-mail: mbmazevedo@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Kodama, Yasko [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Biotecnologia

    2011-07-01

    Biodegradable polymers containing radioactive isotopes have potential applications as delivery vehicles of beta radiation to the cancer tumors by brachytherapy. 166-Ho is an example of such radioisotope emitting high-energy beta particles, and also its gamma rays allow nuclear imaging in everywhere is applied. Among the biodegradable polymers, different types of poly(lactide) have been investigated in our laboratory, and poly(L-lactide) (PLLA) was used as substrate to prepare microparticles loaded with holmium acetylacetonate HoAcAc (PLLA-HoAcAc-MP). The aim of this study was to evaluate the stability of these microparticles to gamma radiation. The PLLA-HoAcAc-MP were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP, and their stability studied out with gamma radiation of 25, 50 and 100 kGy doses. MP were characterized before and after irradiation by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TGA), scanning electron microscopy (SEM), X-ray diffraction (XRD) and con focal laser scanning microscopy (CLSM). Preliminary results showed that gamma radiation did not damage morphologically the prepared PLLA-HoAcAc-MP in the dose range studied, and this procedure may be an important tool for knowing the stabilities of the polymers studied as MP for possible application in brachytherapy. (author)

  3. Pregnancy-related acute kidney injury: An analysis of 165 cases

    Directory of Open Access Journals (Sweden)

    E Mahesh

    2017-01-01

    Full Text Available Pregnancy-related acute kidney injury (PRAKI contributes to 3–7% of overall acute kidney injury (AKI cases in Indian subcontinent. The aim of this study was to determine the outcomes of PRAKI and risk factors associated with renal injury and maternal mortality. One hundred and sixty-five patients with PRAKI, seen at M. S. Ramaiah Medical College between 2005 and 2014, were included in this, observational study. AKI was analyzed in terms of maximal stage of renal injury attained as per Risk, Injury, Failure, Loss of function, and End-stage renal disease (RIFLE criteria. Outcomes included requirement for renal replacement therapy (RRT, maternal, and fetal mortality. Incidence of PRAKI was 1.56%, and the mean age of the study population was 25 years. Fifty percent of the patients were diagnosed with PRAKI during their first pregnancy. PRAKI was observed most commonly in the postpartum period (60%, followed by third trimester (32%; as per RIFLE criteria, failure was seen in 36% and injury in 34%. Thirty percent of cases required RRT. Sepsis (59%, pre-eclampsia, and eclampsia (56% were the leading causes of PRAKI, while sepsis was the leading cause of maternal mortality. Maternal and fetal mortality were 20% and 22%, respectively. In univariate analysis, shock, hemorrhage requiring transfusion of >5 units packed red blood cells, oliguria, and “Loss” category of RIFLE were significantly associated with mortality. Majority of the patients (57% required Intensive Care Unit care with a mean duration of admission at 7.3 days, and 75% was diagnosed with AKI at the time of admission. We report the lowest incidence of PRAKI in contemporary Indian literature. PRAKI was associated with high maternal and fetal mortality, with sepsis being the leading cause. No association was noted between mortality and initial stages of RIFLE criteria.

  4. 33 CFR 165.100 - Regulated Navigation Area: Navigable waters within the First Coast Guard District.

    Science.gov (United States)

    2010-07-01

    ...) Any tank barge with a capacity of less than 25,000 barrels, operating in an area with limited depth or... pilot, assist tug, berth, and line-handlers, depth of berth at mean low water, danger areas, and... entrance, except that the area of New Bedford harbor within the confines (north) of the hurricane barrier...

  5. 33 CFR 165.711 - Safety Zone: Port Everglades, Fort Lauderdale, FL.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: Port Everglades....711 Safety Zone: Port Everglades, Fort Lauderdale, FL. (a) Regulated area. A moving safety zone is established in the following area: (1) The waters around naval aircraft carriers entering Port Everglades in...

  6. 40 CFR 16.5 - Request for correction or amendment of record.

    Science.gov (United States)

    2010-07-01

    ... by EPA by submitting a request in writing to the Freedom of Information Office, or via the Agency's Privacy Act Web site at http://www.epa.gov/privacy or by fax, (202) 566-1639. The following information...

  7. SU-E-T-165: Characterization of Dose Distributions in High-Dose-Rate Surface Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Buzurovic, I; Hansen, J; Bhagwat, M; O’Farrell, D; Damato, A; Friesen, S; Devlin, P; Cormack, R [Dana-Farber/Brigham and Women’s Cancer Center, Harvard Medical School, Boston, MA (United States)

    2015-06-15

    Purpose: To characterize dose distributions in high-dose-rate(HDR) surface brachytherapy using an Ir-125 source for different geometries, field sizes and topology of the clinical targets(CT). To investigate the depth doses at the central axis(CAX), edges of the treatment fields(E), and lateral dose distributions(L) present when using flap applicators in skin cancer treatments. Methods: When malignancies diagnosed on the skin are treated, various geometries of the CT require proper adaptation of the flap or custom-made applicators to the treatment site. Consequently, the dose at the depth on CAX and field edges changes with variation of the curvatures and size of the applicators. To assess the dose distributions, we created a total of 10 treatment plans(TP) for 10×10 and 20×20 field sizes(FS) with a step size of 1cm. The geometry of the applicators was: planar(PA), curved to 30(CA30) and 60(CA60) degrees with respect to the CAX, half-cylinder(HC), and cylindrical shape(CS). One additional TP was created in which the applicators were positioned to form a dome shape(DS) with a diameter of 16cm. This TP was used to emulate treatment of the average sized scalp. All TPs were optimized to deliver a prescription dose at 8mm equidistantly from the planes containing the dwell positions. This optimization is equivalent to the clinical arrangement since the SSD for the flap applicators is 5mm and the prescription depth is 3mm in the majority of clinical cases. Results: The depths (in mm) of the isodose lines were: FS(10×10):PA[90%(9.1CAX,8.0E,7.6L),50%(28.3CAX,20E,17.3L), 25%(51.1CAX,40E,27L)],CA30[90%(10.3CAX,8.2E,7.9L),50%(32.1CAX, 16.2E,15.8L),25%(61.3CAX,36.7E,31.8L)],CA60[90%(12.2CAX,6.1E,6.3L ),50%(47CAX,14E,16.6L),25%(70.8CAX,31.9E,35.4L)],HC[90%(11.1CA X,6.3E,7.3L),50%(38.3CAX,14.6E,16.1L),25%(66.2CAX,33.8E,34.2L)];FS (20×20):PA[90%(11.1CAX,9.0E,7.0L),50%(34.4CAX,21.9E,15.3L),25%(7 0.4CAX,50.9E,34.8L)],CA30[90%(10.9CAX,7.5E,7.1L),50%(38.8CAX,16. 7E,15.4L),25%(80.7CAX,39.9E,35.7L)],HC[90%(11.1CAX,10.9E,10.6L),5 0%(34.4CAX,38.8E,47.2L),25%(70.4CAX,80.7E,96.6L);DS[90%(12.1CA X,8.5E,6.8L),50%(60.6CAX,17.7E,15.8L),25%(109.6CAX,40.3E,34.3L)]. Conclusion: These results can be used for the approximate calculation and quick assessment of the radiation dose to the organs-at-risk at depth (heart,brain,thyroid, optical nerve) or at the surface distance from the CT (breast,eyes, gonads), and only the geometry of the CT needs to be measured. Understanding of the dose distributions in HDR surface brachytherapy may improve clinical decision making process.

  8. 33 CFR 165.150 - New Haven Harbor, Quinnipiac River, Mill River.

    Science.gov (United States)

    2010-07-01

    ... bridge is greater than twenty knots, and (iii) With the barge being towed on a hawser, stern first. (4..., bow first, with a second tug standing by to assist at the bow. (7) Nothing in this section is intended...

  9. 33 CFR 165.756 - Regulated Navigation Area; Savannah River, Georgia.

    Science.gov (United States)

    2010-07-01

    ...'s hull. Fire Wire means a length of wire rope or chain hung from the bow and stern of a vessel in... the waterline, both on the off-shore bow and quarter of the ship. LNG vessels equipped with waterline...

  10. 33 CFR 165.515 - Safety Zone: Cape Fear River, Wilmington, North Carolina.

    Science.gov (United States)

    2010-07-01

    ...′54″ N 77°57′06″ W (2) The safety zone boundary can be described as follows: starting at the stern of... moorings, down along the east bank of the Cape Fear River to the bow of the tug CAPTAIN JOHN TAXIS Memorial... Cape Fear River to the stern of the Battleship USS NORTH CAROLINA. (b) Definitions. The designated...

  11. FCJ-165 Obama Trolling: Memes, Salutes and an Agonistic Politics in the 2012 Presidential Election

    Directory of Open Access Journals (Sweden)

    Benjamin Burroughs

    2013-12-01

    Full Text Available During the 2012 presidential campaign an explosion of photo-shopped images circulated that depicted President Obama as unpatriotic. The ‘crotch salute’, ‘left-hand salute’, and ‘Veterans Day non-salute’ serve as case studies for understanding the role of trolling in the public sphere and Internet politics in an era of social networks and circulation. This paper tracks the cultural practices and logics of ‘sharing’ political memes and conceptualises memes as part of an agonistic public sphere and media ecology. Obama trolling is facilitated through the techno-cultural affordances of memes, which can only become public because of their mimetic form and sterilised partial anonymity. The paper seeks to conceptualise trolling as a broader cultural practice, which can be considered political. Normative assumptions about these memes would portray this trafficking as destructive to deliberative democracy but when understood as a generative cultural practice, trolling becomes central to articulating political emotions in social networks. Photo-shopped Obama salutes, in addition to Big Bird, binder, and bayonet memes, express not only political identities but also larger cultural values within networked popular culture.

  12. 33 CFR 165.1704 - Prince William Sound, Alaska-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... the designated VTS frequency, one of which is capable of battery operation; (3) When steady wind... Area, limit speed to 12 knots except between Middle Rock and Potato Point where the speed limit shall...

  13. 33 CFR 165.810 - Mississippi River, LA-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... capable of monitoring the propulsion system, communicating with the bridge, and implementing manual... immediate damage to the propulsion machinery are capable of being overridden immediately. (iv) Main... continuously manned pilothouse; and (ii) Monitor river activities and marine VHF, emergency and working...

  14. 33 CFR 165.506 - Safety Zones; Fifth Coast Guard District Fireworks Displays.

    Science.gov (United States)

    2010-07-01

    ... 4th Pasquotank River, Elizabeth City, NC, Safety Zone. All waters of the Pasquotank River within a 300..., radio, flashing light or other means, the operator of a vessel shall proceed as directed. (b... all appropriate means to effect the widest publicity among the affected segments of the public...

  15. 165 An International Multi-Disciplinary Journal, Ethiopia Vol. 3 (5 ...

    African Journals Online (AJOL)

    Nekky Umera

    , labor laws, foreign ... company trade among corporate subsidiaries “accounted for 46% of the. $1.33 trillion US imports and 31% of .... diversification gives global firms the ability to obtain below market rates on financial lending and hedging ...

  16. FCJ-165 Obama Trolling: Memes, Salutes and an Agonistic Politics in the 2012 Presidential Election

    OpenAIRE

    Benjamin Burroughs

    2013-01-01

    During the 2012 presidential campaign an explosion of photo-shopped images circulated that depicted President Obama as unpatriotic. The ‘crotch salute’, ‘left-hand salute’, and ‘Veterans Day non-salute’ serve as case studies for understanding the role of trolling in the public sphere and Internet politics in an era of social networks and circulation. This paper tracks the cultural practices and logics of ‘sharing’ political memes and conceptualises memes as part of an agonistic public sphere ...

  17. : tous les projets | Page 165 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: VIOLENCE. Région: Indonesia, Myanmar, Nepal, Sri Lanka. Programme: Governance and Justice. Financement total : CA$ 527,241.00. Élaboration de protocoles facilitant l'application des lois en matière de violence sexuelle et de violence conjugale. Projet. En Inde, les crimes contre les femmes sont à la hausse.

  18. 33 CFR 165.151 - Safety Zones; Long Island Sound annual fireworks displays.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones; Long Island Sound...′30″ N, 072°49′22″ W. (20) Vietnam Veterans Local 484/Town of East Haven Fireworks Safety Zone. All... locations will also have a sign on their port and starboard side labeled “FIREWORKS—STAY AWAY”. Displays...

  19. SU-E-J-165: Dosimetric Impact of Liver Rotations in Stereotactic Body Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Pinnaduwage, D; Paulsson, A; Sudhyadhom, A; Chen, J; Chang, A; Anwar, M; Gottschalk, A; Yom, S S.; Descovich, M [University of California San Francisco, San Francisco, CA (United States)

    2015-06-15

    Purpose: Often in liver stereotactic body radiotherapy a single fiducial is implanted near the tumor for image-guided treatment delivery. In such cases, rotational corrections are calculated based on the spine. This study quantifies rotational differences between the spine and liver, and investigates the corresponding dosimetric impact. Methods: Seven patients with 3 intrahepatic fiducials and 4DCT scans were identified. The planning CT was separately co-registered with 4 phases of the 4DCT (0%, 50%, 100% inhale and 50% exhale) by 1) rigid registration of the spine, and 2) point-based registration of the 3 fiducials. Rotation vectors were calculated for each registration. Translational differences in fiducial positions between the 2 registrations methods were investigated. Dosimetric impact due to liver rotations and deformations was assessed using critical structures delineated on the 4DCT phases. For dose comparisons, a single fiducial was translationally aligned following spine alignment to represent what is typically done in the clinic. Results: On average, differences between spine and liver rotations during the 0%, 50%, 100% inhale, and 50% exhale phases were 3.23°, 3.27°, 2.26° and 3.11° (pitch), 3.00°, 2.24°, 3.12° and 1.73° (roll), and 1.57°, 1.98°, 2.09° and 1.36° (yaw), respectively. The maximum difference in rotations was 12°, with differences of >3° seen in 14/28 (pitch), 10/28 (roll), and 6/28 (yaw) cases. Average fiducial displacements of 2.73 (craniocaudal), 1.04 (lateral) and 1.82 mm (vertical) were seen. Evaluating percent dose differences for 5 patients at the peaks of the respiratory cycle, the maximum dose to the duodenum, stomach, bowel and esophagus differed on average by 11.4%, 5.3%, 11.2% and 49.1% between the 2 registration methods. Conclusion: Lack of accounting for liver rotation during treatment might Result in clinically significant dose differences to critical structures. Both rotational and translational deviations should be considered in planning margins when using spine alignment for liver treatments.

  20. 33 CFR 165.1303 - Puget Sound and adjacent waters, WA-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ..., traffic density, radar contacts, and environmental conditions. (3) In an emergency, the master, pilot, or... Light to New Dungeness Light and all points in the Puget Sound area north and south of these lights. (b... Sound Vessel Traffic Service (PSVTS) may, upon verbal request, authorize a onetime deviation from...

  1. Amang et al., Afr J Tradit Complement Altern Med. (2014) 11(1):165 ...

    African Journals Online (AJOL)

    cadewumi

    The Biuret method (Henry et al., 1974) was used to measure pepsin hydrolytic activity in gastric juice after incubating a solution of albumin (50 ... activity was measured using a standard method (Misra and Fridovich, 1972) and expressed in U/mg of protein, while catalase (CAT) was ..... Colorimetric assay of catalase. Anal.

  2. 33 CFR 165.830 - Regulated Navigation Area; Reporting Requirements for Barges Loaded with Certain Dangerous...

    Science.gov (United States)

    2010-07-01

    ...) The following bulk liquids— (i) Acetone cyanohydrin, (ii) Allyl alcohol, (iii) Chlorosulfonic acid...&D 18 (vii) L&D 21 (viii) L&D 25 (ix) Arriving Melvin Price L&D (downbound) (x) Departing Melvin Price L&D (upbound) (xi) M 150.0-145.0 (xii) M 66.0-61.0 (3) Missouri River (MOR), between Mile Markers...

  3. 33 CFR 165.1402 - Apra Outer Harbor, Guam-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... beginning. (Based on WGS 84 Datum) (b) Regulations: (1) Except for public vessels of the United States...″ E; thence to latitude 13°26′30.8″ N, longitude 144°39′44.4″ E. (Based on WGS 84 Datum) (5) Vessels...

  4. How High Schools Explain Students' Initial Colleges and Majors. Working Paper 165

    Science.gov (United States)

    Darolia, Rajeev; Koedel, Cory

    2017-01-01

    We use statewide administrative data from Missouri to examine the role of high schools in explaining students' initial college and major placements at 4-year public universities. To facilitate our investigation of postsecondary sorting, we develop a "preparation and persistence index" (PPI) for each university-by-major cell in the…

  5. 40 CFR 165.65 - Registrants who distribute or sell pesticide products in refillable containers.

    Science.gov (United States)

    2010-07-01

    ... application, the refilling residue removal procedure must describe how to manage any rinsate resulting from... must visually inspect the exterior and (if possible) the interior of the container and the exterior of...

  6. 40 CFR 165.85 - Design and capacity requirements for new structures.

    Science.gov (United States)

    2010-07-01

    ... are easy to see. (3) The containment structure must be constructed with sufficient freeboard to... area to extend completely beneath any container on it, with the exception of transport vehicles... delivery hose or device couples to the vehicle. This exception does not apply to transport vehicles that...

  7. 1,65 miljardi dollari eest edevust ning näpatud saateid / Kalle Kose

    Index Scriptorium Estoniae

    Kose, Kalle

    2006-01-01

    Interneti sotsiaalvõrgustikust YouTube ja selle liitumisest Google'iga. Vt. ka: Intervjuu kasutajaga : "YouTube'i pärast on jäänud nii mõndagi tegemata." Aktsiakaupleja Oliver Peek räägib YouTube'i kasutamisest teleri asendajana. Diagramm: Videovahetuse keskkondade turuosad. Graafik: Videovahetuskeskkondade turuosa kasv USA-s

  8. Working Paper 165 - Tax resource mobilization and its impact on household living standards evidence from Niger

    OpenAIRE

    Ahmed Moummi

    2013-01-01

    La politique fiscale constitue l’un des instruments par lesquels l’action publique peut avoir un impact sur la réduction de la pauvreté. Cela peut se traduire à la fois par ses impacts sur la croissance mais également sur son effet de redistribution de la richesse.Un bref aperçu sur l’évolution des recettes fiscales, montre que le Niger demeure en bas de classement dans la zone UEMOA. Plusieurs arguments peuvent être avancés pour expliquer cette situation mais il semble que deux facteurs cons...

  9. 49 CFR 572.165 - Upper and lower torso assemblies and torso flexion test procedure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Upper and lower torso assemblies and torso flexion... assemblies and torso flexion test procedure. (a) Upper/lower torso assembly. The test objective is to... torso assembly of a seated dummy is subjected to a force continuously applied at the head to neck pivot...

  10. 33 CFR 165.910 - Security Zones; Captain of the Port Lake Michigan.

    Science.gov (United States)

    2010-07-01

    ... beginning. (3) Donald C. Cook Nuclear Power Plant. All waters of Lake Michigan around the Donald C. Cook...) Palisades Nuclear Power Plant. All waters of Lake Michigan around the Palisades Nuclear Power Plant within a... Michigan. (2) Dresden Nuclear Power Plant. All waters of the Illinois River in the vicinity of Dresden...

  11. 41 CFR 102-85.165 - What are standard levels of service?

    Science.gov (United States)

    2010-07-01

    ..., before the beginning of the customer's regular one-shift work schedule, and shutdown services after the... supporting automatic elevator systems, lights and small office and business machines including personal...

  12. 33 CFR 165.928 - Security Zone; Mackinac Bridge, Straits of Mackinac, Michigan.

    Science.gov (United States)

    2010-07-01

    ...°43.731 W, which is the northwest corner; thence east to 45°50.705 N: 084°43.04 W, which is the... established in this section. Vessels with an operable Automatic Identification System (AIS) unit should seek... AIS unit may contact VTS St. Marys River (Soo Traffic) on VHF channel 12. Vessels without an operable...

  13. DA Masolo A Short History of African Philosophy, a Review pp165-171

    African Journals Online (AJOL)

    DA Masolo

    compliments Samuel Oluoch Imbo's Introduction to African Philosophy (1998). I should add, in conclusion, that even as book prices continue to be affected upwards just like most other things in the current state of world economy, students and scholars of African philosophy, and of African studies generally, should find the ...

  14. 33 CFR 165.120 - Safety Zone: Chelsea River, Boston Inner Harbor, Boston, MA.

    Science.gov (United States)

    2010-07-01

    ... is a safety zone: The waters of the Chelsea River, Boston Inner Harbor, for 100 yards upstream and... the Jenny Dock (approximate position latitude 42°23′05.2″ N., longitude 71°01′35.8″ W.)—or the Mobile...

  15. 33 CFR 165.814 - Security Zones; Captain of the Port Houston-Galveston Zone.

    Science.gov (United States)

    2010-07-01

    ... yards of connecting waterways. (2) Morgan's Point, Texas. The Barbours Cut Ship Channel and Turning... Facility docks, containing all waters within 100′ of a line drawn from a point on shore at Latitude 28°55...

  16. Evaluation of Massey Ferguson Model 165 Tractor Drivers exposed to whole-body vibration

    Directory of Open Access Journals (Sweden)

    P. Nassiri

    2013-12-01

    Conclusion: This study shows that the need to provide intervention , controlling and managing measures to eliminate or reduce exposure to whole body vibration among tractor drivers its necessary. And, preventing main disorder Including musculoskeletal disorders, discomfort and early fatigue is of circular importance. More studies are also necessary to identify the sources of vibration among various of tractors.

  17. Yeast Interacting Proteins Database: YKL002W, YDL165W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available integral membrane proteins into lumenal vesicles of multivesicular bodies, and for delivery of newly synthes...ins into lumenal vesicles of multivesicular bodies, and for delivery of newly synthesized vacuolar enzymes t

  18. Yeast Interacting Proteins Database: YGR165W, YBR034C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available prey as bait (0) Literature on bait (YPD) 5 Literature on prey (YPD) 22 Literature shared by bait and...and prey 2 Literature sharing score 2 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,YPD)

  19. 40 CFR 165.82 - Scope of pesticide dispensing areas included.

    Science.gov (United States)

    2010-07-01

    ... liquid pesticide or equal to or greater than 4,000 pounds (1,818 kilograms) of dry pesticide for any purpose, including refilling or emptying for cleaning. This applies when pesticide is dispensed from the...) The pesticide dispensing area is used solely for dispensing pesticide from a rail car which does not...

  20. Gammaübergänge und Energieniveaus in Dy165

    DEFF Research Database (Denmark)

    Schult, O.; Maier, B.; Gruber, U.

    1964-01-01

    /2 states. Gammavibrational bands built on these Nilsson orbits were observed with their band heads at 538.6, 573.5 and 570.2 keV. TheI=5/2 term at 533 keV can be considered as the 5/2−[523] Nilsson state. The branching ratios allowed the determination of (g K−gR)2-factors for the [633], [521] and [512...

  1. Obtention of Samarium and Gadolinium concentrates by solvent extraction using mono-2-ethylhexyl ester of 2-ethylhexyl phosphonic acid; Obtencao de concentrados de samario e gadolinio via extracao por solventes com o ester mono-2-etilhexil do acido 2-etilhexilfosfonico

    Energy Technology Data Exchange (ETDEWEB)

    Miranda Junior, Pedro

    1996-07-01

    The rare earth chlorides solution employed in this study, which is constituted by medium and heavy fractions, is derived from monazite processing accomplished by NUCLEMON-Mineroquimica (SP). This solution shows an acidity about 1.18 M and 189 g/L of rare earth oxides, containing as main constituents: Sm(34.55%), Gd(23.85%), Dy (6.82%), and Y (24.45%). It was used, as organic phase, 2-ethylhexyl phosphonic acid, mono-2-ethylhexylester diluted to 1 M in isododecane. (author)

  2. Poly(dl)lactic acid/polyglycolic acid/iron and poly(dl)lactic acid/polyglycolic acid/samarium cobalt composites for use as a delivery mechanism for magnetically directed chondrogenesis

    Science.gov (United States)

    Oppermann, Dean Alan

    Magnetically directed chondrogenesis (MDC) is a fundamental approach to articular cartilage repair. In MDC a magnet is implanted into the subchondral trabecular bone underlying a cartilage defect and used to attract chondrocytes, magnetically tagged with Fe nanoparticles, to the defect site. Pilot studies by Halpern, Crimp and Grande, using solid neodymium (Nd) magnets, indicated optimistic results by producing a hyaline-like articular cartilage after 8 weeks implantation. Since solid Nd magnets introduce long-term biocompatibility issues, the focus of this dissertation was to develop P(dl)A/PGA/Fe and P(dl)A/PGA/SmCo 5 implants for use in MDC. The effect of implant porosity, implant composition and magnetic material (Fe or SmCo5) on the initial and degraded magnetic properties were evaluated. The biocompatibility of P(dl)A/PGA/Fe implants were investigated by implantation into New Zealand white rabbits for 8 weeks. The effect of hydrogen peroxide (H2O2) and ethylene oxide (EO) sterilization techniques on the molecular weight and chemical structure of P(dl)A/PGA polymers were evaluated using gel permeation chromatography and Fourier transform infrared spectroscopy. The effect of implant morphology, size and number on the von Mises stress in the trabecular bone surrounding the implant was evaluated using a finite element model. In general, SmCo5 implants resulted in higher magnetic fields initially and after 8 weeks of degradation than comparable Fe implants. Increases in magnetic field strength were achieved by increasing the volume fraction of magnetic material and by increasing the PGA concentration. The magnetic field strength degradation rate decreased with increases in volume fraction of magnetic material and increases in PLA concentration. Implantation studies indicated that 50/50 P(dl)A/PGA were more bioactive than 75/25 P(dl)A/PGA with an increased cellular response that is specific to bone growth. The compressive strength and elastic modulus of porous implants were comparable to trabecular bone, and the compressive strength and elastic modulus of solid implants was higher than trabecular bone but less than cortical bone. Finite element modeling showed that the implantation of solid and porous P(dl)A/PGA/Fe implants did not significantly increase the von Mises stress concentration adjacent to the implant. The von Mises stress surrounding porous implants was higher than the solid implants which predicts faster bone remodeling. Comparing single implants to multiple implants indicated a significant decrease in von Mises stress between the implants. This would predict bone resorption in that area. H2O2 sterilization resulted in a gradual decrease in the molecular weight of P(dl)A/PGA polymers that was a result of hydrolytic scission of the ester bonds present between the individual monomers. The polymers were less affected by EO sterilization with only the 75/25 P(dl)A/PGA, indicating a decrease in molecular weight. From these results, it was concluded that solid 50/50 P(dl)A/PGA/SmCo 5 implants that span the entire width of the cartilage defect should be used to optimize the attraction potential and bioactivity of the implant. Also ethylene oxide, which caused less premature implant degradation, should be used for sterilization.

  3. Fabrication of a new samarium(III) ion-selective electrode based on 3-{l_brace}[2-oxo-1(2h)-acenaphthylenyliden]amino{r_brace}-2-thioxo -1,3-thiazolidin-4-one

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali [Islamic Azad University, Quchan (Iran, islamic Republic of). Quchan Branch. Dept. of Chemistry]. E-mail: haszamani@yahoo.com; Ganjali, Mohammad Reza [Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of). Endocrine and Metabolism Research Center; Adib, Mehdi [University of Tehran, Tehran (Iran, Islamic Republic of). Faculty of Chemistry. Center of Excellence in Electrochemistry

    2007-07-01

    This paper introduces the development of an original PVC membrane electrode, based on 3-{l_brace}[2-oxo-1(2H)-acenaphthylenyliden]amino{r_brace}-2-thioxo-1,3-thiazolidin-4-one (ATTO) which has revealed to be a suitable carrier for Sm{sup 3+} ions. The resulting data illustrated that the electrode shows a Nernstian slope of 19.3 {+-} 0.6 mV per decade for Sm{sup 3+} ions over a broad working concentration range of 1.0 X 10{sup -6} to 1.0 X 10{sup -1} mol L{sup -1}. The lower detection limit was found to be equal to (5.5{+-} 0.3) X 10{sup -7} mol L{sup -}'1 in the pH range of 3.5-7.5, and the response time was very short ({approx}10 s). The potentiometric sensor displayed good selectivities for a number of cations such as alkali, alkaline earth, transition and heavy metal ions. (author)

  4. BASIC RESEARCH ON THE SEPARATION OF SCANDIUM YTTRIUM, AND THE RARE EARTHS BY SOLVENT EXTRACTION.

    Science.gov (United States)

    RARE EARTH ELEMENTS, * SOLVENT EXTRACTION ), (*CHELATE COMPOUNDS, RARE EARTH ELEMENTS), PURIFICATION, ATOMIC SPECTROSCOPY, SCANDIUM, YTTRIUM, PRASEODYMIUM, SAMARIUM, EUROPIUM, GADOLINIUM, TERBIUM, FLUORINE COMPOUNDS, KETONES

  5. Preparation of the Nanostructured Radioisotope Metallic Oxide by Neutron Irradiation for Use as Radiotracers

    Directory of Open Access Journals (Sweden)

    Sang-Ei Seo

    2017-10-01

    Full Text Available Metallic oxides manganese dioxide (MnO2, samarium oxide (Sm2O3, and dysprosium oxide (Dy2O3 with nanorod-like structures were synthesized by the hydrothermal synthesis method, respectively. Subsequently, the nanostructured radioisotopes MnO2 with Mn-56, Sm2O3 with Sm-153, and Dy2O3 with Dy-165 were prepared by neutron irradiation from the HANARO research reactor, respectively. The three different elements, Mn, Sm, and Dy, were selected as radiotracers because these elements can be easily gamma-activated from neutrons (activation limits: 1 picogram (Dy, 1–10 picogram (Mn, 10–100 picogram (Sm. Furthermore, the synthesized radioisotopes can be used as radiotracers in Prompt Gamma Neutron Activation Analysis as the rare earth metals Dy and Sm were not present in the Korean environment. The successful synthesis of the radioisotope metallic oxides was confirmed by Transmission Electron Microscopy (TEM, Energy Dispersive X-ray Spectrometry (EDS, X-ray Diffraction (XRD analysis, and gamma spectroscopy analysis. The synthesized nanostructured radioisotope metallic oxides may be used as radiotracers in scientific, environmental, engineering, and industrial fields.

  6. The Effect of Ethnocentrism and Image of Asian Industrialised Countries on Perceived Relative Quality (P.165-177

    Directory of Open Access Journals (Sweden)

    Sulhaini Sulhaini

    2016-03-01

    Full Text Available The study examined the effects of consumer ethnocentrism and country image on perceived relative quality. The respondents of the study were consumers at a shopping mall in Mataram, Indonesia.  They compared the quality of televisions from three industrialised Asian countries, i.e. Japan, South Korea and China, to those from Indonesia. The result of the study was that image of those countries has a significant effect on perceived relative quality. Indonesian consumers perceived televisions from those countries to be more favourable in terms of quality compared to Indonesian televisions. Indonesian consumers have a similar perception on the quality of televisions made in those main Asian countries relative to those of Indonesia. The image of those countries is favourable leading to a better perception on quality of televisions made in the countries relative to domestically made. Domestic consumers view that those countries have better capabilities in producing higher quality televisions. However, consumer ethnocentrism do not lead them to negatively perceive the quality of imported televisions. Indeed, the image of those countries has a greater role in Indonesian consumers’ quality evaluation. The result calls for a substantial improvement in quality of domestically made televisions.Keywords: country image, consumer ethnocentrism, relative product quality perception 

  7. 33 CFR 165.153 - Regulated Navigation Area: Long Island Sound Marine Inspection and Captain of the Port Zone.

    Science.gov (United States)

    2010-07-01

    ... Frequency (VHF) radio channel 16 upon approach to the following locations: (i) Inbound approach to Cerberus... run on a frequent schedule between two points over the most direct water route; and (4) Offers a... (UNCLOS), 21 I.L.M. 1261. Normally, the territorial sea baseline is the mean low water line along the...

  8. 33 CFR 165.T09-0452 - Safety Zone; Festivals & Fireworks Celebration, East Moran Bay, Lake Huron, St. Ignace, MI.

    Science.gov (United States)

    2010-07-01

    ... safety zone: All waters of Lake Huron within a 600-foot radius from the fireworks launch site in East... from 9 p.m. through 11 p.m. (x) September 4, 2010 from 9 p.m. through 11 p.m. with an alternate date...

  9. 33 CFR 165.1321 - Security Zone; Protection of Military Cargo, Captain of the Port Zone Puget Sound, WA.

    Science.gov (United States)

    2010-07-01

    ... any employee or agent of the United States government who has the authority to carry firearms and make..., which is the approximate location of a private buoy on the end of the sewage outfall; then southeasterly... the approximate location of a private buoy on the end of the sewage outfall; then southwesterly to 47...

  10. Encapsulation of VEGF165 into magnetic PLGA nanocapsules for potential local delivery and bioactivity in human brain endothelial cells

    Czech Academy of Sciences Publication Activity Database

    Carenza, E.; Jordan, O.; Martinez-San Segundo, P.; Jiřík, Radovan; Starčuk jr., Zenon; Borchard, G.; Rosell, A.; Roig, A.

    2015-01-01

    Roč. 3, č. 12 (2015), s. 2538-2544 ISSN 2050-750X R&D Projects: GA ČR GAP102/12/2380; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : superparamagnetic iron-oxide * human serum-albumin * VEGF Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 4.872, year: 2015

  11. 33 CFR 165.1301 - Puget Sound and Adjacent Waters in Northwestern Washington-Regulated Navigation Area.

    Science.gov (United States)

    2010-07-01

    ... from the vessel on all-round (32-point) white light visible for a minimum of two nautical miles and... Bridge, to include the waters within a one-half nautical mile radius of the center of the main ship..., recreational fishing derbies, regattas, or permitted marine events. (1) Vessels engaged in fishing or other...

  12. 33 CFR 165.169 - Safety and Security Zones: New York Marine Inspection Zone and Captain of the Port Zone.

    Science.gov (United States)

    2010-07-01

    ... Hudson River within 25 yards of the West 30th Street Heliport and the Jersey City/Newport Helistop, areas... Nuclear Power Station (IPNPS). All waters of the Hudson River within a 300-yard radius of the IPNPS pier...) Definition. For the purposes of this section, Part 105 Facility means any facility subject to the regulations...

  13. 33 CFR 165.1405 - Regulated Navigation Areas and Security Zones; Designated Escorted Vessels-Philippine Sea and...

    Science.gov (United States)

    2010-07-01

    ... Security Zones; Designated Escorted Vessels-Philippine Sea and Apra Harbor, Guam (including Cabras Island... Areas and Security Zones; Designated Escorted Vessels-Philippine Sea and Apra Harbor, Guam (including... point of origin. (2) Apra Harbor, Guam—All waters from surface to bottom of Apra Harbor, Guam, shoreward...

  14. 33 CFR 165.760 - Security Zones; Tampa Bay, Port of Tampa, Port of Saint Petersburg, Port Manatee, Rattlesnake...

    Science.gov (United States)

    2010-07-01

    ..., including on land portions of Chemical Formulators Chlorine Facility, where the fenced area is bounded by a... span encompassed by a line connecting the following points: 27°37.30′ N, 082°39.38′ W to 27°37.13′ N...°26.11′ W; east northeast to 27°54.19′ N, 082°26.00′ W; then northeast to 27°54.37′ N, 082°25.72′ W...

  15. Synthesis and evaluation of tetraphosphonates labelled with {sup 212}Bi, {sup 212}Pb and {sup 165}Er

    Energy Technology Data Exchange (ETDEWEB)

    Hassfjell, S.P

    1997-08-01

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. {sup 212}Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a {alpha}-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to {sup 153}Sm-EDTMP, which is now formally approved in several countries, most recently in the US. {sup 212}Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the {alpha}-emitter, although loss of some of the in vivo generated {sup 212}Bi may be a problem. A generator has been developed for the production of the {alpha}-emitting radionuclide {sup 212}Bi and its parent nuclide {sup 212}Pb. The generator is based on the emanation of {sup 220}Rn from ({sup 228}Th)barium stearate. The decay product of {sup 220}Rn, {sup 212}Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety.

  16. The Effect of Ethnocentrism and Image of Asian Industrialised Countries on Perceived Relative Quality (P.165-177)

    OpenAIRE

    Sulhaini Sulhaini; Lalu Edy Herman Mulyono

    2016-01-01

    The study examined the effects of consumer ethnocentrism and country image on perceived relative quality. The respondents of the study were consumers at a shopping mall in Mataram, Indonesia.  They compared the quality of televisions from three industrialised Asian countries, i.e. Japan, South Korea and China, to those from Indonesia. The result of the study was that image of those countries has a significant effect on perceived relative quality. Indonesian consumers perceived televisions fro...

  17. 33 CFR 165.T09-1080 - Safety Zone and Regulated Navigation Area, Chicago Sanitary and Ship Canal, Romeoville, IL.

    Science.gov (United States)

    2010-07-01

    ... exterior water. Potable water is water treated and stored aboard the vessel that is suitable for human... conditions or other circumstances are such that application of this section is unnecessary or impractical for...

  18. 33 CFR 165.501 - Chesapeake Bay entrance and Hampton Roads, VA and adjacent waters-Regulated Navigation Area.

    Science.gov (United States)

    2010-07-01

    ... vessel. (B) Has a connecting device that can receive a shackle pin of at least two inches in diameter. (C... that can receive a shackle pin of at least two inches in diameter. (C) Be fitted with recovery pickup... enter the Regulated Navigation Area, unless it has on board: (i) Corrected charts of the Regulated...

  19. Development and Characterization of VEGF165-Chitosan Nanoparticles for the Treatment of Radiation-Induced Skin Injury in Rats

    Directory of Open Access Journals (Sweden)

    Daojiang Yu

    2016-10-01

    Full Text Available Radiation-induced skin injury, which remains a serious concern in radiation therapy, is currently believed to be the result of vascular endothelial cell injury and apoptosis. Here, we established a model of acute radiation-induced skin injury and compared the effect of different vascular growth factors on skin healing by observing the changes of microcirculation and cell apoptosis. Vascular endothelial growth factor (VEGF was more effective at inhibiting apoptosis and preventing injury progression than other factors. A new strategy for improving the bioavailability of vascular growth factors was developed by loading VEGF with chitosan nanoparticles. The VEGF-chitosan nanoparticles showed a protective effect on vascular endothelial cells, improved the local microcirculation, and delayed the development of radioactive skin damage.

  20. K1.65V1.78W0.22O2(AsO42

    Directory of Open Access Journals (Sweden)

    Sabrina Belkhiri

    2009-09-01

    Full Text Available The title potassium vanadium tungsten bis(arsenate oxide was synthesized by a solid-state reaction at 973 K. The crystal structure is isotypic with KVOPO4 and contains a [MVAs2O10]∞ framework built up from single MO6 (M = V+W octahedra sharing corners with single VO6 octahedra and AsO4 tetrahedra. This structure shows the existence of infinite [VAsO8]∞ and [MAsO8]∞ chains running along the a and c directions, respectively. All atoms are located on general positions. The metal position M is statistically occupied by 78% V and 22% W.

  1. Abnormal Histone Methylation is Responsible for Increased VEGF165a Secretion from Airway Smooth Muscle Cells in Asthma

    Science.gov (United States)

    Clifford, Rachel L.; John, Alison E.; Brightling, Christopher E.; Knox, Alan J.

    2012-01-01

    Vascular Endothelial Growth Factor (VEGF), a key angiogenic molecule, is aberrantly expressed in several diseases including asthma where it contributes to bronchial vascular remodelling and chronic inflammation. Asthmatic human airway smooth muscle (HASM) cells hypersecrete VEGF but the mechanism is unclear. Here we defined the mechanism in HASM cells from non-asthmatic (NA) and asthmatic (A) patients. We found that asthmatic cells lacked a repression complex at the VEGF promoter which was present in non-asthmatic cells. Recruitment of G9A, trimethylation of histone H3 at lysine 9 (H3K9me3) and a resultant decrease in RNA polymerase II (RNA pol II) at the VEGF promoter was critical to repression of VEGF secretion in non-asthmatic cells. At the asthmatic promoter H3K9me3 was absent due to failed recruitment of G9a; RNA pol II binding, in association with TAF1, was increased, H3K4me3 was present and Sp1 binding was exaggerated and sustained. In contrast DNA methylation and histone acetylation were similar in A and NA cells. This is the first study to show that airway cells in asthma have altered epigenetic regulation of remodelling gene(s). Histone methylation at genes such as VEGF may be an important new therapeutic target. PMID:22689881

  2. Autonomous Surface Vehicle Sidescan-sonar mosaic from Cat Point Bar, St. George Sound, Florida (ASV165.TIF)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These data were collected under a cooperative mapping program between the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration Coastal...

  3. Assessment of Non-Traditional Isotopic Ratios by Mass Spectrometry for Analysis of Nuclear Activities

    Science.gov (United States)

    2016-03-01

    distinguish between commercial nuclear reactor fuel cycles, fuel cycles for weapons grade plutonium , and products from nuclear weapons explosions. Methods will...Isotopic ratios will be calculated for radionuclides produced in commercial nuclear reactor fuel cycles, fuel cycles for weapons grade plutonium , and... chemistry for analysis of samarium. The chemical form of samarium required for analysis varies for different mass spectrometry techniques

  4. The Critical Technologies Project Executive Summary

    Science.gov (United States)

    1981-01-01

    Materials with the Not covered Chalcopyrite Structure 7.8.23 Rare Earth- Transition Metal Permanent Not covered I Magnets (exanple: samarium cobalt and... Transition Metal Permanent - Magnets (example: samarium cobalt I and substituted samarium cobalt) New 7.8.24 Gadolinium Gallium Garnet (GGG) - - and...III T i mm~ 1.W 8 Chwn..cal Poesse Maclw Tools 1110 1129. 1131 133 1142 0 F -~, oO 16.qm P c Metals 1145, 1203, 1236 4203 1365 00, awm.wq *4 1303 1311

  5. sup 8 sup 9 Sr and sup 1 sup 5 sup 3 Sm-EDTMP therapy of disseminated skeletal metastasis

    CERN Document Server

    Zhang Jun Ning; Zhu Shou Peng

    2001-01-01

    A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

  6. General Information about Osteosarcoma and Malignant Fibrous Histiocytoma of Bone

    Science.gov (United States)

    ... providers who are experts in treating cancer in children. Treatment for osteosarcoma or malignant fibrous histiocytoma may cause side effects. Four types of standard treatment are used: Surgery Chemotherapy Radiation therapy Samarium New types of treatment are ...

  7. Treatment Option Overview (Osteosarcoma and Malignant Fibrous Histiocytoma of Bone)

    Science.gov (United States)

    ... providers who are experts in treating cancer in children. Treatment for osteosarcoma or malignant fibrous histiocytoma may cause side effects. Four types of standard treatment are used: Surgery Chemotherapy Radiation therapy Samarium New types of treatment are ...

  8. Maximum Permissible Concentrations and Negligible Concentrations for Rare Earth Elements (REEs)

    NARCIS (Netherlands)

    Sneller FEC; Kalf DF; Weltje L; Wezel AP van; CSR

    2000-01-01

    In dit rapport worden maximaal toelaatbare risiconiveaus (MTR) en verwaarloosbare risiconiveaus (VR) afgeleid voor zeldzame aardmetalen (ZAM). De geselecteerde ZAMs zijn Yttrium (Y), Lanthanum (La), Cerium (Ce), Praseodymium (Pr), Neodymium (Nd), Samarium (Sm), Gadolinium (Gd), en Dysprosium

  9. Bulletin of the Chemical Society of Ethiopia - Vol 31, No 3 (2017)

    African Journals Online (AJOL)

    A novel samarium complex with interesting photoluminescence and semiconductive properties · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D. W. Zhang, W. T. Chen, Y. F.Wang, 435-444 ...

  10. Specialty Metals: DOD Dissemination of National Security Waiver Information Could Enhance Awareness and Compliance with Restrictions

    Science.gov (United States)

    2014-10-01

    Restrictions Why GAO Did This Study Specialty metals—such as titanium, certain steel alloys , and samarium- cobalt alloy magnets—are essential to DOD...highly magnetic, lightweight, corrosion resistant, or having high durability. Among these metals are samarium- cobalt alloy magnets used to make radar...the following elements: aluminum, chromium , cobalt , columbium, molybdenum, nickel, titanium, tungsten, or vanadium. Specialty metals were added

  11. Corrigendum to "Preparation of Nafion-sulfonated clay nanocomposite membrane for direct menthol fuel cells via a film coating process" [J. Power Sources 165 (2007) 1-2

    Science.gov (United States)

    Kim, Tae Kyoung; Kang, Myeongsoon; Choi, Yeong Suk; Kim, Hae Kyung; Lee, Wonmok; Chang, Hyuk; Seung, Doyoung

    The author regrets that the above paper was printed with an error in the title. The correct title reads: "Preparation of Nafion-sulfonated clay nanocomposite membrane for direct methanol fuel cells via a film coating process".

  12. Comment on "Astronomical constraints on the duration of the Early Jurassic Pliensbachian Stage and global climatic fluctuations" [Earth Planet. Sci. Lett. 455 (2016) 149-165

    Science.gov (United States)

    Smith, David G.; Bailey, Robin J.

    2018-01-01

    Astrochronology employs spectral analysis of stratigraphic data series to substantiate and quantify depositional cyclicity, and thus to establish a probable causal link between cases of rhythmic bedding and periodic orbitally-forced climate change. Vaughan et al. (2011 - not cited by Ruhl et al.) showed that the spectral methods conventionally used in cyclostratigraphy will generate false positive results - they will identify multiple cycles that are not present in the data. Tests with synthetic random datasets are both a simple and an essential way to prove this. Ruhl et al. (2016) used the methods to which these criticisms apply in their analysis of XRF-compositional data series from the Early Jurassic of the Mochras borehole, Wales. We use properly corrected methods to re-examine some of their data, showing that their spectral results are not valid, thus casting doubt on their proposed calibration of Pliensbachian time.

  13. 45 CFR 287.165 - What are the data collection and reporting requirements for Public Law 102-477 Tribes that...

    Science.gov (United States)

    2010-10-01

    ... programs? (a) Currently, there is a single reporting system for all programs operated by a Tribe under Public Law 102-477. This system includes a program report, consisting of a narrative report, a... PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES THE NATIVE...

  14. 33 CFR 165.929 - Safety Zones; Annual events requiring safety zones in the Captain of the Port Lake Michigan zone.

    Science.gov (United States)

    2010-07-01

    ... Aerospace Challenge Sport Rocket Launch; Muskegon, MI—(i) Location. All waters of Muskegon Lake, near the... p.m. (9) Harborfest Music and Family Festival; Racine, WI—(i) Location. All waters of Lake Michigan...

  15. Altmetric: 165More detailArticle | OPENClimate change-induced increases in precipitation are reducing the potential for solar ultraviolet radiation to inactivate pathogens in surface waters

    Science.gov (United States)

    Climate change is accelerating the release of dissolved organic matter (DOM) to inland and coastal waters through increases in precipitation, thawing of permafrost, and changes in vegetation. Our modeling approach suggests that the selective absorption of ultraviolet radiation (U...

  16. Connecting Past to Present and Watersheds to Ocean: Modeling 165 Years of Incremental Changes to Flows into the San Francisco Bay Delta System

    Science.gov (United States)

    MacVean, L. J.; Thompson, S. E.; Huttom, P. H.; Sivapalan, M.

    2016-02-01

    California's Sacramento-San Joaquin Delta sits at the intersection of vast agricultural and population centers, and supplies fresh water for the diverse and often competing needs of ecosystems, farmers, and millions of Californians. Managing and allocating this resource is a complex feat of economics, politics, and engineering, made increasingly contentious by the ongoing drought. The objective of this research is to augment the scientific foundation of management decisions by addressing the question of how flows into the Delta have evolved in response to human intervention since 1850. In particular, quantifying the dynamic components of water usage through vegetative uptake and evapotranspiration, groundwater recharge, flood conveyance, and water exports at incremental levels of development is a key ambition. This approach emphasizes the built environment, which is subject to the local regulatory framework, rather than climate change, which is generally considered immovable without united global effort. This work encompasses the creation of a hydrologic model representing the watersheds of the San Francisco Bay-Delta system, and quantifies the impacts of changes in land use and the gradual construction of levees, reservoirs, and diversion infrastructure. The model is run using the same climatological forcing at each level of development, thus elucidating the effects of local anthropogenic activity on the Delta and the inflows to the San Francisco Bay estuary. Our results provide a timeline of change, giving decision-makers a scientifically established baseline to aid in the sustainable management of the Bay-Delta system.

  17. Advertising powder soap Omo in 1957 and 2007: a model for the production of meaning doi:10.5007/1807-1384.2010v7n2p165

    Directory of Open Access Journals (Sweden)

    Marina Aparecida Espinosa Negri

    2010-07-01

    Full Text Available This article draws a parallel between the lines of communication used in advertising powder soap Omo in two specific periods of time: the years 1957 and 2007, in order to draw the production of meaning of each of the emissions. Considering the contexts in which both campaigns were produced, the development of the study wants to check not only the theoretical components of discourse analysis, on the concepts adopted as described in the book Elements of Discourse Analysis by Jose Luiz Fiorin, but also the practices in relation to certain social characteristics of these periods, and the consequent alignment of advertising manifested with it.

  18. Non-viral VEGF(165) gene therapy--magnetofection of acoustically active magnetic lipospheres ('magnetobubbles') increases tissue survival in an oversized skin flap model

    National Research Council Canada - National Science Library

    Holzbach, Thomas; Vlaskou, Dialekti; Neshkova, Iva; Konerding, Moritz A; Wörtler, Klaus; Mykhaylyk, Olga; Gänsbacher, Bernd; Machens, H-G; Plank, Christian; Giunta, Riccardo E

    2010-01-01

    .... We prepared perfluoropropane-filled magnetic lipospheres ('magnetobubbles') from Tween60-coated magnetic nanoparticles, Metafectene, soybean-oil and cDNA and studied the effect in an oversized random-pattern-flap model in the rats (n= 46...

  19. 33 CFR 165.761 - Security Zones; Port of Palm Beach, Port Everglades, Port of Miami, and Port of Key West, Florida.

    Science.gov (United States)

    2010-07-01

    ... SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS Specific Regulated Navigation Areas and.... The eastern boundary is formed by an imaginary line from the traffic light located at Bridge road, in... restrictions. The Captain of the Port will notify the public via Marine Safety Radio Broadcast on VHF Marine...

  20. 33 CFR 165.T01-0315 - Safety zones; Marine Events within the Captain of the Port Sector Northern New England Area of...

    Science.gov (United States)

    2010-07-01

    ... 200 foot radius around all participants; for all regattas, power boat races, row and paddle boat races....3The Great Race • Event Type: Row and Paddle Boat Race. • Sponsor: The Great Race Committee. • Date...): 44°47′18″ N, 073°10′27″ W. 44°47′10″ N, 073°08′51″ W. 7.4Moosabec Lobster Boat Races • Event Type...

  1. Measurement of the Elastic Ep Cross Section at Q2 = 0.66, 1.10, 1.51 and 1.65 Gev2

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yang [College of William and Mary, Williamsburg, VA (United States)

    2017-08-01

    The nucleon form factors have been investigated by physicists for decades because of their fundamental importance. The world data of the proton magnetic form factor GMp has been focused on Q2 lower than 5 GeV2 and they have large uncertainties at higher Q2. Jefferson Lab experiment E12-07-108 aims to improve the accuracy of the e ? p elastic cross section to better than 2% over a Q2 range of 7 ? 14 GeV2. From 2015 to 2016, the e ? p elastic cross section was measured over a wide range of Q2 from 0.66 ? 12.56 GeV2 at the Thomas Jefferson National Accelerator Facility in Virginia, USA. An unpolarized electron beam was scattered o? a cryogenic hydrogen target and the scattered electron was detected in the high resolution spectrometers. This thesis focuses on the cross section calculations of the data taken in the spring of 2015, where Q2 = 0.66, 1.10, 1.51 and 1.66 GeV2. At Q2 = 0.66 GeV2, an uncertainty < 3% was achieved and < 5% was achieved for the other three Q2 at the moment. The results were compared with the world data and the good agreement provides confidence for the experimental measurements at higher Q2.

  2. Abnormal histone methylation is responsible for increased vascular endothelial growth factor 165a secretion from airway smooth muscle cells in asthma.

    Science.gov (United States)

    Clifford, Rachel L; John, Alison E; Brightling, Christopher E; Knox, Alan J

    2012-07-15

    Vascular endothelial growth factor (VEGF), a key angiogenic molecule, is aberrantly expressed in several diseases including asthma where it contributes to bronchial vascular remodeling and chronic inflammation. Asthmatic human airway smooth muscle cells hypersecrete VEGF, but the mechanism is unclear. In this study, we defined the mechanism in human airway smooth muscle cells from nonasthmatic and asthmatic patients. We found that asthmatic cells lacked a repression complex at the VEGF promoter, which was present in nonasthmatic cells. Recruitment of G9A, trimethylation of histone H3 at lysine 9 (H3K9me3), and a resultant decrease in RNA polymerase II at the VEGF promoter was critical to repression of VEGF secretion in nonasthmatic cells. At the asthmatic promoter, H3K9me3 was absent because of failed recruitment of G9a; RNA polymerase II binding, in association with TATA-binding protein-associated factor 1, was increased; H3K4me3 was present; and Sp1 binding was exaggerated and sustained. In contrast, DNA methylation and histone acetylation were similar in asthmatic and nonasthmatic cells. This is the first study, to our knowledge, to show that airway cells in asthma have altered epigenetic regulation of remodeling gene(s). Histone methylation at genes such as VEGF may be an important new therapeutic target.

  3. Development of a methodology for the separation of europium and samarium from a mixture of rare earth oxides by electroreduction/ precipitation; Desenvolvimento de uma metodologia para a separacao de samario e europio a partir de mistura de oxidos de terras raras por reducao eletroquimica/precipitacao

    Energy Technology Data Exchange (ETDEWEB)

    Chepcanoff, Vera

    2006-07-01

    The rare earths (RE) were first used in 1903, when Welsbach developed a lighter that is still used today. Nowadays, the RE are employed in many different fields, as in the production of super-alloys , as catalysts for petroleum industry, in the manufacture of non-ferrous alloys, color television tubes, x-ray screens, special glasses, ceramics, computer industries, nuclear medicine, lasers, pigments, etc., moving, in the last decade , a market of US$ 2 billions per year. Due to their similar properties, the RE elements are very difficult to separate, requiring complex processes, what make the products very expensive. Elements like Eu and Sm, which contents in the minerals are low (0.05% and 2.0%, respectively, in monazite) are extremely expensive, but their field of application justifies the research for looking for other processes, more simple and/or more effective. Trivalent state is a characteristic of all RE, but some of them presents oxidation state +2, like Ce, Eu, Sm and Yb. In the case of Eu and Sm, the focus of the present work, the divalent state is achieved by electro-reduction in the potentials -0.65 and -1.55 (SCE), respectively. This makes possible the separation of these elements from the other rare earths and from each other. Thus, making use of this characteristic, a process for the individual separation of Eu and Sm in (NH{sub 4}){sub 2}SO{sub 4} solution by electro-reduction/precipitation is proposed, where Sm is first separated from the solution as sulfate, and Eu, that remains in the solution, is precipitated after the decrease of temperature and potential applied. The process developed from a synthetic Eu and Sm solution was applied to a mixture of semi-heavy RE oxide, produced at IPEN-CNEN/SP, obtaining the separation of Sm. This product was analyzed by spectrophotometry, showing high purity. (author)

  4. Tetrakis[μ-2-(3,4-dimethoxyphenylacetato]-κ4O:O′;κ3O,O′:O;κ3O:O,O′-bis{[2-(3,4-dimethoxyphenylacetato-κ2O,O′](1,10-phenanthroline-κ2N,N′samarium(III}

    Directory of Open Access Journals (Sweden)

    Jia-Lu Liu

    2010-11-01

    Full Text Available In the centrosymmetric dinuclear title complex, [Sm2(C10H11O46(C12H8N22], the SmIII ion is nine-coordinated by seven O atoms of five 2-(3,4-dimethoxyphenylacetate (DMPA ligands and two N atoms of one bis-chelating 1,10-phenanthroline (phen ligand, forming a distorted tricapped trigonal-prismatic environment. The DMPA ligands coordinate in bis-chelate, bridging and bridging tridentate modes. An intramolecular C—H...O hydrogen bond occurs. Intermolecular C—H...O interactions are also present in the crystal.

  5. Preparation, and Luminescence Properties of SiO2@Sm(MABA-Siphen Core-Shell Structure Nanometer Composite

    Directory of Open Access Journals (Sweden)

    Feng Li-Na

    2018-01-01

    Full Text Available A novel ternary samarium complex was prepared using HOOCC6H4N(CONH(CH23Si- (OCH2CH332 (MABA-Si as first ligand, and phen as second ligand. The corresponding SiO2@Sm(MABA-Siphen core-shell structure nanometer composite was synthesized as well, and the silica spheres was the core, and the ternary samarium complex was the shell layer. The ternary samarium complex has been characterized by element analysis, molar conductivity and IR spectra. The results show that the chemical formula of the complex is Sm(MABA-Si(phen2(ClO43·2H2O. The fluorescent spectra illustrat that the luminescence properties of the samarium complex are superior. The core-shell structure of SiO2@Sm(MABA-Siphen nanometer composite is characterized by SEM, TEM and IR spectra. The SiO2@Sm(MABA-Siphen core-shell structure composites exhibit stronger emission intensity than the ternary samarium complex. The fluorescence lifetime of the complex and core-shell structure composite is measured as well.

  6. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ILEAIHYCALTRGFSGNNDREY Sbjct: 1 ... MRLDSISIANFRNHTLLEFEPGHSITNIYGRNGSGKTSILEAIHYCALTRGFSGNNDREY 60 ... Query: 121 REMVIINGAPAERRRFID...TAICQYDRKYLSDLLLYRRILQQRNAL 165 ... REMVIINGAPAERRRFIDTAICQYDRKYLSDLLLYRRILQQRNAL Sbjct: 121 REMVIINGAPAERRRFIDTAICQYDRKYLSDLLLYRRILQQRNAL 165 ...

  7. Udvikling af materialer til brintpermeable membraner

    DEFF Research Database (Denmark)

    Bentzer, Henrik Karnøe

    Due to global warming as well as other factors, it is necessary to find alternatives to the current consumption of fossil fuels. Oxide materials with high protonic conductivity can potentially find application within many different technological fields in a society that is based on renewable energy...... doped samarium titanate, lanthanum magnesium titanate and strontium cerate doped with yttrium and nickel. Concentration cell measurements were used to estimate transport numbers for protons and oxide ions in yttrium doped strontium cerate and calcium doped samarium titanate. Furthermore, the voltage...

  8. {6,6′-Dimethoxy-2,2′-[ethane-1,2-diylbis(nitrilomethylidyne]diphenolato-1κ4O1,O1′,O6,O6′:2κ4O1,N,N′,O1′}(ethanol-1κO-μ-nitrato-1:2κ2O:O′-dinitrato-1κ4O,O′-samarium(IIIzinc(II

    Directory of Open Access Journals (Sweden)

    Qiang Huang

    2009-10-01

    Full Text Available In the title heteronuclear ZnII–SmIII complex, [SmZn(C18H18N2O4(NO33(CH3CH2OH], with the hexadentate Schiff base compartmental ligand N,N′-bis(3-methoxysalicylideneethylenediamine (H2L, the SmIII and ZnII ions are triply bridged by two phenolate O atoms from the Schiff base ligand and one nitrate anion. The five-coordinate ZnII ion is in a square-pyramidal geometry formed by the donor centers of two imine N atoms, two phenolate O atoms and one of the bridging nitrate O atoms. The SmIII center is in a ten-fold coordination of O atoms, involving the phenolate O atoms, two methoxy O atoms, one ethanol O atom, and two O atoms from two nitrate anions and one from the bridging nitrate anion. In the crystal, intermolecular O—H...O and C—H...O interactions generate a layer structure extending parallel to (101.

  9. A 1.2-V 165-μW 0.29-mm² Multibit Sigma-Delta ADC for Hearing Aids Using Nonlinear DACs and With Over 91 dB Dynamic-Range

    DEFF Research Database (Denmark)

    Custódio, José R.; Goes, João; Paulino, Nuno

    2013-01-01

    in a 130 nm digital CMOS technology, which includes the proposed modulator with nonlinear DACs and a modulator with conventional linear DACs, for comparison purposes. The measured results show that the ΣΔM using nonlinear DACs achieves an enhancement of the DR around 8.4 dB (to 91.4 dB). Power dissipation...... and silicon area are about the same for the two cases. The performance achieved is comparable to that of the best reported multibit ΣΔ ADCs, with the advantage of occupying less silicon area (7.5 times lower area when compared with the most energy efficient ΣΔM)....

  10. A 1.2-V 165-μW 0.29-mm2 multibit Sigma-Delta ADC for hearing aids using nonlinear DACs and with over 91 dB dynamic-range.

    Science.gov (United States)

    Custodio, José R; Goes, João; Paulino, Nuno; Oliveira, João P; Bruun, Erik

    2013-06-01

    This paper describes the design and experimental evaluation of a multibit Sigma-Delta (ΣΔ) modulator (ΣΔM) with enhanced dynamic range (DR) through the use of nonlinear digital-to-analog converters (DACs) in the feedback paths. This nonlinearity imposes a trade-off between DR and distortion, which is well suited to the intended hearing aid application. The modulator proposed here uses a fully-differential self-biased amplifier and a 4-bit quantizer based on fully dynamic comparators employing MOS parametric pre-amplification to improve both energy and area efficiencies. A test chip was fabricated in a 130 nm digital CMOS technology, which includes the proposed modulator with nonlinear DACs and a modulator with conventional linear DACs, for comparison purposes. The measured results show that the ΣΔM using nonlinear DACs achieves an enhancement of the DR around 8.4 dB (to 91.4 dB). Power dissipation and silicon area are about the same for the two cases. The performance achieved is comparable to that of the best reported multibit ΣΔ ADCs, with the advantage of occupying less silicon area (7.5 times lower area when compared with the most energy efficient ΣΔM).

  11. Corrigendum to “Relative humidity effects on water vapour fluxes measured with closed-path eddy-covariance systems with short sampling lines” [Agric. Forest Meteorol. 165 (2012) 53–63

    DEFF Research Database (Denmark)

    Fratini, Gerardo; Ibrom, Andreas; Arriga, Nicola

    2012-01-01

    It has been formerly recognised that increasing relative humidity in the sampling line of closed-path eddy-covariance systems leads to increasing attenuation of water vapour turbulent fluctuations, resulting in strong latent heat flux losses. This occurrence has been analyzed for very long (50 m)...

  12. Reply to the Comment on "Astronomical constraints on the duration of the Early Jurassic Pliensbachian Stage and global climatic fluctuations" [Earth Planet. Sci. Lett. 455 (2016) 149-165

    Science.gov (United States)

    Hinnov, Linda A.; Ruhl, Micha; Hesselbo, Stephen P.

    2018-01-01

    Smith and Bailey (2018) (henceforth SB17) criticize methods employed in our recent study of a highly cyclic calcium (Ca) series measured through the Early Jurassic, Pliensbachian-age, marine succession of the Llanbedr (Mochras Farm) core, referred to as Mochras (Ruhl et al., 2016, henceforth R16). In particular SB17 focus on the red noise spectral models calculated in R16. Here we clarify the red noise models displayed in Fig. 5 and Supplementary Figs. 4 and 5 of R16, and comment further on estimating power spectra and AR1 red noise model spectra. We highlight effects from nonrandom data variation, sampling and pre-whitening on red noise model estimation, and concur with SB17 that red noise modeling should not be applied with a "boiler-plate" approach. Using the Mochras Ca series as an example, we discuss practical solutions that can be used for other cyclostratigraphic data presenting similar issues. In summary, whereas SB17 advocate alternative red noise models, e.g., bent power law models, we show that modest adjustments to the data can dramatically improve the fit between AR1 red noise and data spectra.

  13. Dynamics of heavy nucleus collisions in the reaction {sup 86}Kr+{sup 165}Ho at 60 MeV/n by means of the DeMoN neutron multi-detector; Etude de la dynamique des collisions entre noyaux lourdes dans la reaction {sup 86}Kr + {sup 165}Ho a 60 MeV/n a l`aide du multidetecteur de neutron DeMoN

    Energy Technology Data Exchange (ETDEWEB)

    Dorvaux, Olivier [Centre de Recherches Nucleaires de Strasbourg-Cronenbourg, 67 (France)

    1997-01-14

    This work is dedicated to the study of binary dissipative collisions for the system Kr + Ho at 60 AMeV. The first chapter is devoted to the used experimental set-up. In particular, the neutron detector DeMoN and a new parallel plate avalanche counter, achieved for this experiment are described. In the next chapters we analyse the neutron energy spectra. The study is fulfilled through a simulation taking into account two, and then, three sources in order to upraise the excitation energy sharing between the two residual fragments. The final results of the equal excitation energy sharing is compared to the predictions of a statistical model and a participant-spectator one. This study also underlines an intermediate velocity source which has the main characteristics of a neck emission. In the last chapter the neutron energy spectra analysed in the frame of the projectile-like-fragment (PLF) show the existence of the light particle emission component called pre-thermalization. It means that, in a first step of the collision there is a competition between the deposit of energy in the system and its removal. From this analysis we can say that the temperature of the residual fragments is usually overestimated. The resulting temperature of the PLF is quite low, and is about 3.5 MeV. (author) 47 refs., 52 figs., 5 tabs.

  14. Performance Characterization of a Novel Plasma Thruster to Provide a Revolutionary Operationally Responsive Space Capability with Micro- and Nano-Satellites

    Science.gov (United States)

    2011-03-24

    Einstein Spontaneous Emission Rate Coefficient Electrical Utilization Efficiency Electron Electron Density...0.135 Tesla samarium cobalt (SmCo) permanent magnet from Electron Energy Corp. in Landisville, PA. Encapsulating the assembly is a simple aluminum...unlike some well-developed technologies, such as solid fueled rocket motors , an electric propulsion system could simultaneously contribute to all three

  15. Xe-135 and Sm-149 Isotopic Evolution Analysis Xesamo code; Analisis de la Evolucion Isotopica del Xe-135 y Sm-149. Programa Xesamo

    Energy Technology Data Exchange (ETDEWEB)

    Caro, R.; Gallego, J.; Martinez Fanegas, R.

    1977-07-01

    In this report the time evolution analysis of the nuclides concentration Xe-135 and Sm-149 as a function of the neutron flux is carried out. The neutron flux may be any function of time. It is analyzed as well the reactivity changes associated with the xenon and samarium concentration variations. (Author) 5 refs.

  16. Thermoluminescence characteristics of Sm doped NaYF4 crystals

    Indian Academy of Sciences (India)

    2006-06-28

    Jun 28, 2006 ... temperature peaks also vary in relation to the Sm3+ con- centration in NaYF4. This indicates a probable change in the trap structure of NaYF4 with the doping concentration of samarium impurity. This observation is in conformity with the earlier studies (Narasimha Reddy et al 1987;. Gopal Reddy et al 1988; ...

  17. Multiplet effects in the electronic structure of light rare-earth metals

    NARCIS (Netherlands)

    Lebegue, S.; Svane, A.; Katsnelson, M.I.; Lichtenstein, A.I.; Eriksson, O.

    2006-01-01

    The excited-state properties of the light rare-earth elemental metals praseodymium, neodymium, and samarium are studied within the Hubbard-I formalism. This method describes the multiplets of the rare-earth f shell by an exact diagonalization of the two-body part of the Hamiltonian. Subsequently,

  18. Structural, dielectric and electrical properties of Sm-modified Pb ...

    Indian Academy of Sciences (India)

    It is observed that. the dielectric permittivity () and loss tangent (tan ) are dependent on frequency,; the temperature of dielectric permittivity maximum shifts toward lower temperature side with the increase of samarium ion (Sm+3) concentration at the Pb sites, and; observed and calculated -values of XRD patterns show ...

  19. Ironless-armature brushless motor

    Science.gov (United States)

    Fisher, R. L.

    1977-01-01

    Device uses 12-pole samarium cobalt permanent-magnet rotor and three Hall-effect sensors for commutation. In prototype motor, torque constant (3-phase delta) is 65 oz-in/amp; electrical time constant (L/R) is 0.2 x 0.001 sec, and armature resistance is 20 ohms.

  20. Measurement of total angular momentum values of high-lying even ...

    Indian Academy of Sciences (India)

    Measurement of total angular momentum values of high-lying even-parity atomic states of samarium by spectrally resolved laser-induced fluorescence technique. A K PULHANI∗, M L SHAH, G P GUPTA and B M SURI. Laser and Plasma Technology Division, Bhabha Atomic Research Centre,. Mumbai 400 085, India.