WorldWideScience

Sample records for samarium 148 target

  1. Determination of the nuclear electric charge distribution of samarium isotopes 144, 148, 150, 152, 154 by the muonic atom method

    International Nuclear Information System (INIS)

    Barreau, Pierre.

    1977-01-01

    The theory of the nucleus-negative muon system in the case of electrical interactions is discussed. The interactions of muons with the samarium isotopes 152, 154, 144, 148, 150 are investigated. After a description of the experimental device, from muon beam production to data acquisition (detection of the gamma spectra), the results are analyzed and the nuclear charge distribution parameters determined: for each isotope the absolute value of c (half-density radius) and t (skin thickness); for 152 Sm and 154 Sm the parameter β 2 (quadrupolar defomation). Nuclear polarization was accounted for throughout the analysis [fr

  2. MicroRNA-148b promotes proliferation of hair follicle cells by targeting NFAT5

    Directory of Open Access Journals (Sweden)

    Wanbao YANG,Qinqun LI,Bo SU,Mei YU

    2016-03-01

    Full Text Available MicroRNAs (miRNAs, small non-coding RNAs, are involved in many aspects of biological processes. Previous studies have indicated that miRNAs are important for hair follicle development and growth. In our study, we found by qRT-PCR that miR-148b was significantly upregulated in sheep wool follicle bulbs in anagen phase compared with the telogen phase of the hair follicle cycle. Overexpression of miR-148b promoted proliferation of both HHDPC and HHGMC. By using the TOPFlash system we demonstrated that miR-148b could activate Wnt/β-catenin pathway and b-catenin, cycD, c-jun and PPARD were consistently upregulated accordingly. Furthermore, transcript factor nuclear factor of activated T cells type 5 (NFAT5 and Wnt10b were predicted to be the target of miR-148b and this was substantiated using a Dual-Luciferase reporter system. Subsequently NFAT5 was further identified as the target of miR-148b using western blotting. These results were considered to indicate that miR-148b could activate the Wnt/β-catenin signal pathway by targeting NFAT5 to promote the proliferation of human hair follicle cells.

  3. Study on irradiation conditions of producing 153Sm with natural abundance samarium target

    International Nuclear Information System (INIS)

    Du Jin; Jin Xiaohai; Bai Hongsheng; Liu Yuemin; Chen Daming; Wang Fan

    1998-01-01

    Irradiation conditions of natural abundance 152 Sm targets in different forms are studied in the heavy water reactor and the light water swimming pool reactor at the China Institute of Atomic Energy. The result shows that the specific activity of 153 Sm in liquid form target irradiated in the light water swimming pool reactor is two times greater than that in solid form target. The radionuclide purity of 153 Sm is more than 99%, which can meet the needs of clinical application

  4. DNA methyltransferase 1-targeting miRNA-148aof dairymilk: apotential bioactive modifier of thehumanepigenome

    Directory of Open Access Journals (Sweden)

    Bodo C. Melnik

    2017-09-01

    Full Text Available Background: The perception of milk has changed from a “simple food” to a more sophisticated bioactive functional signaling system that promotes mTORC1-driven postnatal anabolism, growth, and development of the newborn infant. Accumulating evidence supports the view that milk´s miRNAs significantly contribute to these processes. The most abundant miRNA of milk found in milk fat and milk exosomes is miRNA-148a, which targets DNA methyltransferase 1 (DNMT1, a pivotal epigenetic regulator that suppresses transcription. Furthermore, milk-derived miRNA-125b, miRNA-30d, and miRNA-25 target TP53, the guardian of the genome that interacts with DNMT1 and regulates metabolism, cell kinetics, and apoptosis. Thus, the question arose whether cow´s milk-derived miRNAs may modify epigenetic regulation of the human milk consumer. Methods: To understand the potential impact of dairy milk consumption on human epigenetics, we have analyzed all relevant research-based bioinformatics data related to milk, milk miRNAs, epigenetic regulation, and lactation performance with special attention to bovine miRNAs that modify gene expression of DNA methyltransferase 1 (DNMT1 and p53 (TP53, the two guardians of the mammalian genome. By means of translational research and comparative functional genomics, we investigated the potential impact of cow´s milk miRNAs on epigenetic regulation of human DNMT1, TP53, FOXP3, and FTO, which are critically involved in immunologic and metabolic programming respectively. miRNA sequences have been obtained from mirbase.org. miRNA-target site prediction has been performed using TargetScan release 7.0. Results: The most abundant miRNA of cow´s milk is miRNA-148a, which represents more than 10% of all miRNAs of cow´s milk, survives pasteurization and refrigerated storage. The seed sequence of human and bovine miRNA-148a-3p is identical. Furthermore, human and bovine DNMT1 mRNA share 88% identity. The miRNA-148a 7mer seed is conserved in

  5. miR-148a suppresses cell invasion and migration in gastric cancer by targeting DNA methyltransferase 1.

    Science.gov (United States)

    Shi, Huaijie; Chen, Xiaojing; Jiang, Hao; Wang, Xujie; Yu, Hao; Sun, Pijiang; Sui, Xin

    2018-04-01

    Gastric cancer (GC) is the fourth most common malignant tumor globally. The highest incidence of GC is found in Eastern Asia, particularly in China. It is therefore imperative to further elucidate the molecular pathogenesis of GC in order to identify new biomarkers and targets for effective therapy. In the present study, we determined whether miR-148a was aberrantly downregulated in gastric cancer tissues and significantly correlated with aggressive clinicopathological characteristics in the MGC-803, HGC-27 and GES-1 cell lines using reverse transcription-quantitative PCR and western blot analysis. The cell lines were obtained from 60 patients who presented at our hospital between September 2010 and July 2015. The results showed that, miR-148a was aberrantly downregulated in GC tissues and its expression was relatively lower in the MGC-803 and HGC-27 GC cell lines than in the normal gastric epithelial cell line, GES-1. The clinicopathological analysis revealed that a decrease of miR-148a was significantly correlated with lymph-node metastasis (Pblot analysis. Furthermore, we found that the re-expression of DNMT1 reversed the inhibition of cell migration and invasion induced by miR-148a. Taken together, we demonstrated that miR-148a suppresses cell invasion and migration in gastric cancer by regulating DNMT1 expression. The miR-148a/DNMT1 axis may therefore be a new potential target for GC therapy.

  6. The production and use of a 148Gd charged particle target in a spectroscopic study of 147Gd

    International Nuclear Information System (INIS)

    Massey, T.N.

    1988-01-01

    This thesis discusses the nuclear structure of 147 Gd elucidated by the neutron pickup reactions (p,d), (d,t) and ( 3 He,α) on the unstable 148 Gd target. The neutron pickup reaction on 148 Gd probes the two-particle-one-hole states by the pickup of neutrons in the shell model orbitals below the N = 82 gap and one-particle states by pickup of neutrons in shell model orbitals above the N = 82 gap. Our experiments will provide information on the location of neutron single-particle energies which can be used for shell-model calculations in the 146 Gd region. The 2-particle-1-hole (2p-1h) states which are probed directly by the neutron transfer reaction in the experiments with the 148 Gd target, will bear indirectly on the energies of one-hole states in 145 Gd. They will also provide information on the strongest single-particle states in 147 Gd because all the single-particle states in the 148 Gd target are partially occupied because of the mixing by the pairing interaction. 107 refs., 23 figs., 20 tabs

  7. ACVR1, a Therapeutic Target of Fibrodysplasia Ossificans Progressiva, Is Negatively Regulated by miR-148a

    Directory of Open Access Journals (Sweden)

    Jun Cheng

    2012-02-01

    Full Text Available Fibrodysplasia ossificans progressiva (FOP is a rare congenital disorder of skeletal malformations and progressive extraskeletal ossification. There is still no effective treatment for FOP. All FOP individuals harbor conserved point mutations in ACVR1 gene that are thought to cause ACVR1 constitutive activation and activate BMP signal pathway. The constitutively active ACVR1 is also found to be able to cause endothelial-to-mesenchymal transition (EndMT in endothelial cells, which may cause the formation of FOP lesions. MicroRNAs (miRNAs play an essential role in regulating cell differentiation. Here, we verified that miR-148a directly targeted the 3' UTR of ACVR1 mRNA by reporter gene assays and mutational analysis at the miRNA binding sites, and inhibited ACVR1 both at the protein level and mRNA level. Further, we verified that miR-148a could inhibit the mRNA expression of the Inhibitor of DNA binding (Id gene family thereby suppressing the BMP signaling pathway. This study suggests miR-148a is an important mediator of ACVR1, thus offering a new potential target for the development of therapeutic agents against FOP.

  8. MHI-148 Cyanine Dye Conjugated Chitosan Nanomicelle with NIR Light-Trigger Release Property as Cancer Targeting Theranostic Agent.

    Science.gov (United States)

    Thomas, Reju George; Moon, Myeong Ju; Surendran, Suchithra Poilil; Park, Hyeong Ju; Park, In-Kyu; Lee, Byeong-Il; Jeong, Yong Yeon

    2018-02-15

    Paclitaxel (PTX) loaded hydrophobically modified glycol chitosan (HGC) micelle is biocompatible in nature, but it requires cancer targeting ability and stimuli release property for better efficiency. To improve tumor retention and drug release characteristic of HGC-PTX nanomicelles, we conjugated cancer targeting heptamethine dye, MHI-148, which acts as an optical imaging agent, targeting moiety and also trigger on-demand drug release on application of NIR 808 nm laser. The amine group of glycol chitosan modified with hydrophobic 5β-cholanic acid and the carboxyl group of MHI-148 were bonded by 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide/N-hydroxysuccinimide chemistry. Paclitaxel was loaded to MHI-HGC nanomicelle by an oil-in-water emulsion method, thereby forming MHI-HGC-PTX. Comparison of near infrared (NIR) dyes, MHI-148, and Flamma-774 conjugated to HGC showed higher accumulation for MHI-HGC in 4T1 tumor and 4T1 tumor spheroid. In vitro studies showed high accumulation of MHI-HGC-PTX in 4T1 and SCC7 cancer cell lines compared to NIH3T3 cell line. In vivo fluorescence imaging of the 4T1 and SCC7 tumor showed peak accumulation of MHI-HGC-PTX at day 1 and elimination from the body at day 6. MHI-HGC-PTX showed good photothermal heating ability (50.3 °C), even at a low concentration of 33 μg/ml in 1 W/cm 2 808 nm laser at 1 min time point. Tumor reduction studies in BALB/c nude mice with SCC7 tumor showed marked reduction in MHI-HGC-PTX in the PTT group combined with photothermal therapy compared to MHI-HGC-PTX in the group without PTT. MHI-HGC-PTX is a cancer theranostic agent with cancer targeting and optical imaging capability. Our studies also showed that it has cancer targeting property independent of tumor type and tumor reduction property by combined photothermal and chemotherapeutic effects.

  9. Biodistribution study of 153Sm-EDTMP produced by irradiation of natural and enriched Samarium, in rats

    International Nuclear Information System (INIS)

    Meftahi, M.; Bahrami Samani, A.; Babaei, M. H.; Shamsaei Zafarghandi, M.; Ghannadi Maragheh, M.

    2010-01-01

    ''1 53 Sm-EDTMP is one of the well known radiopharmaceuticals for pain palliation of bone metastases. Despite that, it is used just in a few countries. It is due to some reasons like being costly enriched samarium that usually used as target for irradiation and short half-life of 153 Sm. In this investigation, certain amounts of radiopharmaceuticals prepared by irradiation of enriched and natural samarium were injected to some normal rats. Then, the rodents were sacrificed and some of their organs were removed. All of the mentioned stages were performed in order to consider the possibility of exploiting natural samarium instead of enriched samarium by study of biodistribution of both radiopharmaceuticals in various organs especially in bone as the target tissue. At the end, the acceptable results were obtained using natural samarium in comparison with the enriched samarium from the point of view of the biodistribution studies.

  10. Collective effects in even-mass samarium isotopes by polarized-proton scattering

    NARCIS (Netherlands)

    Petit, R.M.A.L.; Hall, van P.J.; Klein, S.S.; Moonen, W.H.L.; Nijgh, G.J.; Overveld, van C.W.A.M.; Poppema, O.J.

    1993-01-01

    The even-mass samarium isotopes 148,...,152Sm have been investigated by polarized proton scattering at 20.4 MeV beam energy. The data have been analysed with an 'extended' optical model, where the intensities of the first maxima of the main inelastic channels are fitted in a coupled-channels

  11. Basis for developing samarium AMS for fuel cycle analysis

    International Nuclear Information System (INIS)

    Buchholz, Bruce A.; Biegalski, Steven R.; Whitney, Scott M.; Tumey, Scott J.; Jordan Weaver, C.

    2010-01-01

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of 146 Sm, 149 Sm, and 151 Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  12. Conductometric investigations on samarium soaps

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Chauhan, Mithlesh; Shukla, R.K.

    1989-01-01

    The critical micelle concentration (CMC), degree of dissociation and dissociation constant of samarium soaps (valerate, caproate, caprylate and caprate) in a mixture of 60 per cent benzene and 40 per cent methanol were determined by using conductometric measurements. The soaps behaved as simple electrolyte in dilute solutions and the CMC was found to decrease with increasing chainlength of the fatty acid constituent of the soap. (author). 7 refs., 2 tabs

  13. Labeling fish with an activable element through their diet. [samarium

    Energy Technology Data Exchange (ETDEWEB)

    Michibata, Hitoshi (Toyama Univ. (Japan). Faculty of Science)

    1981-10-01

    Stable samarium, one of the rare earth elements, was fed to medaka (Oryzias latipes) and goldfish (Carassius auratus). The concentration of samarium in the labeled fish was determined by neutron activation analysis. In O. latipes, samarium was detectable even 1 yr after the labeled diet was eaten. In C. auratus, samarium was retained in the fifth brachial arch, scales, and gills.

  14. Implementation of an analytical technique for Samarium

    International Nuclear Information System (INIS)

    Garcia G, N.

    2004-01-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10 - 2 M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  15. Laser spectroscopy of atomic samarium

    International Nuclear Information System (INIS)

    Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

    1988-01-01

    Samarium spectrum was studied with a purpose to find transitions to be used in experiments on parity nonconservation. Macaluso-Corbino effect - Faraday rotation near resonance was used for the search and study of spectral lines. We have identified previously unknown energy levels belonging to the 4f 5 6s 2 5 D term: 15914.55(3) cm -4 (J=1), 17864.29(3) cm -4 (J=2), 20195.76(3) cm -4 (J=3). M1-transitions to these levels from the levels of the ground 4f 5 6s 2 7 F term were observed. There are several peculiarities of these transitions which are due to the fact that they occut within an inner 4f 5 -shell, particularly, a very small presuure broadening by inert gases. 44 refs.; 17 figs.; 7 tabs

  16. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  17. Study of 148-152Sm nuclei employing γ - derived from B(E2) values and level energies

    International Nuclear Information System (INIS)

    Sharma, Aparna; Varshney, A.K.; Singh, M.; Gupta, D.K.; Singh, Yuvraj; Gupta, K.K.; Bihari, Chhail; Varshney, Mani

    2011-01-01

    The study of samarium nuclei has been a challenging theoretical problem, since they lie in the range from near spherical to well deformed shapes. 148 Sm was believed to be basically spherical while 154 Sm is thought to be well deformed nucleus and 150-15 '2Sm are transitional nuclei

  18. Selective targeting of pro-inflammatory Th1 cells by microRNA-148a-specific antagomirs in vivo.

    Science.gov (United States)

    Maschmeyer, Patrick; Petkau, Georg; Siracusa, Francesco; Zimmermann, Jakob; Zügel, Franziska; Kühl, Anja Andrea; Lehmann, Katrin; Schimmelpfennig, Sarah; Weber, Melanie; Haftmann, Claudia; Riedel, René; Bardua, Markus; Heinz, Gitta Anne; Tran, Cam Loan; Hoyer, Bimba Franziska; Hiepe, Falk; Herzog, Sebastian; Wittmann, Jürgen; Rajewsky, Nikolaus; Melchers, Fritz Georg; Chang, Hyun-Dong; Radbruch, Andreas; Mashreghi, Mir-Farzin

    2018-05-01

    In T lymphocytes, expression of miR-148a is induced by T-bet and Twist1, and is specific for pro-inflammatory Th1 cells. In these cells, miR-148a inhibits the expression of the pro-apoptotic protein Bim and promotes their survival. Here we use sequence-specific cholesterol-modified oligonucleotides against miR-148a (antagomir-148a) for the selective elimination of pro-inflammatory Th1 cells in vivo. In the murine model of transfer colitis, antagomir-148a treatment reduced the number of pro-inflammatory Th1 cells in the colon of colitic mice by 50% and inhibited miR-148a expression by 71% in the remaining Th1 cells. Expression of Bim protein in colonic Th1 cells was increased. Antagomir-148a-mediated reduction of Th1 cells resulted in a significant amelioration of colitis. The effect of antagomir-148a was selective for chronic inflammation. Antigen-specific memory Th cells that were generated by an acute immune reaction to nitrophenylacetyl-coupled chicken gamma globulin (NP-CGG) were not affected by treatment with antagomir-148a, both during the effector and the memory phase. In addition, antibody titers to NP-CGG were not altered. Thus, antagomir-148a might qualify as an effective drug to selectively deplete pro-inflammatory Th1 cells of chronic inflammation without affecting the protective immunological memory. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  19. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    delocalized π-electrons of the pyridyl rings obtains increasing attention in ... BaSO4 plate was used as a reference (100% reflectance), on which the finely ground .... several are samarium-containing complex with bipy [41-45]. Figure 2.

  20. Optical isotope shifts for unstable samarium isotopes

    International Nuclear Information System (INIS)

    Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; Grant, I.S.; England, J.G.; Fawcett, M.J.

    1984-01-01

    Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144 Sm and 154 Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

  1. Nonlinear Faraday rotation in samarium vapor

    International Nuclear Information System (INIS)

    Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

    1988-01-01

    Experiments on nonlinear magnetic optical (Faraday) rotation on resonance transitions of atomic samarium are described. Measurements were carried out on transitions with different angular momenta of upper and lower states: 1→0, 0→1 and 1→1. Qualitative explanations of observed phenomena are given

  2. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  3. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    International Nuclear Information System (INIS)

    Mendes, B.M.; Mendes, T.M.; Campos, T.P.R.

    2011-01-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  4. Thermal diffusivity of samarium-gadolinium zirconate solid solutions

    International Nuclear Information System (INIS)

    Pan, W.; Wan, C.L.; Xu, Q.; Wang, J.D.; Qu, Z.X.

    2007-01-01

    We synthesized samarium-gadolinium zirconate solid solutions and determined their thermal diffusivities, Young's moduli and thermal expansion coefficients, which are very important for their application in thermal barrier coatings. Samarium-gadolinium zirconate solid solutions have extremely low thermal diffusivity between 20 and 600 deg. C. The solid solutions have lower Young's moduli and higher thermal expansion coefficients than those of pure samarium and gadolinium zirconates. This combination of characteristics is promising for the application of samarium and gadolinium zirconates in gas turbines. The mechanism of phonon scattering by point defects is discussed

  5. Investigation of samarium solubility in the magnesium based solid solution

    International Nuclear Information System (INIS)

    Rokhlin, L.L.; Padezhnova, E.M.; Guzej, L.S.

    1976-01-01

    Electric resistance measurements and microscopic analysis were used to investigate the solubility of samarium in a magnesium-based solid solution. The constitutional diagram Mg-Sm on the magnesium side is of an eutectic type with the temperature of the eutectic transformation of 542 deg C. Samarium is partly soluble in solid magnesium, the less so, the lower is the temperature. The maximum solubility of samarium in magnesium (at the eutectic transformation point) is 5.8 % by mass (0.99 at. %). At 200 deg C, the solubility of samarium in magnesium is 0.4 % by mass (0.063 at. %)

  6. Anodic dissolution of samarium in acetonitrile solution of acetylacetone

    International Nuclear Information System (INIS)

    Kostyuk, N.N.; Dik, T.A.; Trebnikov, A.G.; Shirokij, V.L.

    2003-01-01

    Electrochemical dissolution of metal samarium in acetonitrile medium in the presence of 0.1 M tetraethylammoniumbromide and 0.9 M acetylacetone (HAA) in argon atmosphere under a voltage of 3 V was considered for studying feasibility of electrochemical synthesis of samarium β-diketonates. Using IR and mass spectrometry, thermal and elementary analyses it was ascertained that, depending on cathode and anode areas ratio, anodic dissolution of samarium can give rise to formation of complexes of bi- and trivalent samarium featuring the composition Sm 4 (AA) 8 · 3HAA, Sm(AA) 3 · HAA and Sm(AA) 3 · 4HAA [ru

  7. Crystallization of Yttrium and Samarium Aluminosilicate Glasses

    OpenAIRE

    Lago, Diana Carolina; Prado, Miguel Oscar

    2016-01-01

    Aluminosilicate glasses containing samarium and yttrium (SmAS and YAS glasses) exhibit high glass transition temperatures, corrosion resistance, and glass stability on heating which make them useful for technological applications. Yttrium aluminosilicate glass microspheres are currently being used for internal selective radiotherapy of liver cancer. During the preparation process, crystallization needs to be totally or partially avoided depending on the final application. Thus knowing the cry...

  8. Plasma sprayed samarium--cobalt permanent magnets

    International Nuclear Information System (INIS)

    Willson, M.C.; Janowiecki, R.J.

    1975-01-01

    Samarium--cobalt permanent magnets were fabricated by arc plasma spraying. This process involves the injection of relatively coarse powder particles into a high-temperature gas for melting and spraying onto a substrate. The technique is being investigated as an economical method for fabricating cobalt--rare earth magnets for advanced traveling wave tubes and cross-field amplifiers. Plasma spraying permits deposition of material at high rates over large areas with optional direct bonding to the substrate, and offers the ability to fabricate magnets in a variety of shapes and sizes. Isotropic magnets were produced with high coercivity and good reproducibility in magnetic properties. Post-spray thermal treatments were used to enhance the magnetic properties of sprayed deposits. Samarium--cobalt magnets, sprayed from samarium-rich powder and subjected to post-spray heat treatment, displayed energy products in excess of 9 million gauss-oersteds and coercive forces of approximately 6000 oersteds. Bar magnet arrays were constructed by depositing magnets on ceramic substrates. (auth)

  9. Synthesis of samarium, europium and ytterbium acetylenides

    International Nuclear Information System (INIS)

    Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

    1995-01-01

    Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

  10. High purity samarium oxide from mixed rare earth carbonates

    International Nuclear Information System (INIS)

    Queiroz, Carlos A. da S.; Seneda, Jose A.; Vasconcellos, Mari E. de; Pedreira Filho, Walter dos R.

    2013-01-01

    A simple and economical chemical process for the production of highly pure samarium oxides is discussed. The raw material, which was used in the form of rare earth carbonates was produced industrially from the chemical treatment of Brazilian monazite. Ion exchange chromatography was performed using a strong cationic resin that is typically employed in water treatment processes to fractionate rare earth elements (REE) without the use of retention ions. Under these conditions, 99.9% pure Sm 2 O 3 was eluted using the ammonium salt of ethylenediaminetetraacetic acid (EDTA) at a controlled pH. The EDTA-samarium complex was separated from EDTA and then precipitated as oxalate and fired to samarium oxide. Molecular absorption spectrophotometry was used to monitor the samarium content during the proposed process, and sector field inductively coupled plasma mass spectrometry was used to certify the purity of the samarium oxide. Typical samarium oxide obtained from the proposed procedure contained the following contaminants in micrograms per gram: Sc (20.90); Y (11.80); La (8.4); Ce (4.3); Pr (2.5); Nd (5.1); Eu (94); Gd (114); Tb (3.6); Dy (2.5), Ho (2.3); Er (3.0); Tm (2.3); Yb (38,2); Lu (25.6). The high-purity samarium oxides produced in the present study can be used as an alternative to imported products in research and development applications. (author)

  11. Plasma sprayed samarium--cobalt permanent magnets

    International Nuclear Information System (INIS)

    Willson, M.C.; Janowiecki, R.J.

    1975-01-01

    Samarium--Co permanent magnets were fabricated by arc plasma spraying. This process involves the injection of relatively coarse powder particles into a high temperature gas for melting and spraying onto a substrate. The technique is being investigated as an economical method for fabricating Co--rare earth magnets for advanced traveling wave tubes and cross-field amplifiers. Plasma spraying permits deposition of material at high rates over large areas with optional direct bonding to the substrate, and offers the ability to fabricate magnets in a variety of shapes and sizes. Isotropic magnets were produced with high coercivity and good reproducibility in magnetic properties. Post-spray thermal treatments were used to enhance the magnetic properties of sprayed deposits. Samarium--Co magnets, sprayed from Sm-rich powder and subjected to post-spray heat treatment, displayed energy products in excess of 9 million G-Oe and coercive forces of approximately 6000 Oe. Bar magnet arrays were constructed by depositing magnets on ceramic substrates

  12. Physico-chemical studies on samarium soaps in solid state

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Chauhan, M.; Shukla, R.K.

    1989-01-01

    The physico-chemical characteristics of samarium soaps (caproate and caprate) in solid state were investigated by IR, X-ray diffraction and TGA measurements. The IR results revealed that the fatty acids exist in dimeric state through hydrogen bonding and samarium soaps possess partial ionic character. The X-ray diffraction measurements were used to calculate the long spacings and the results confirmed the double layer structure of samarium soaps. The decomposition reaction was found kinetically of zero order and the values of energy of activation for the decomposition process for caproate and caprate were found to be 8,0 and 7,8 kcal mol -1 , respectively. (Authors)

  13. The ion-exchange obtaining of high purity samarium oxide

    International Nuclear Information System (INIS)

    Brzyska, W.; Soltysiak, I.; Cygan, J.

    1987-01-01

    The use of lactic acid - EDTA mixture as an eluent for the obtaining of high purity samarium oxide was studied. The studies were carried out at room temperature on cation exchange resin Wofatit KPS X 8. The best results were obtained for lactic acid (0,26 mol/dm 3 ) - EDTA (0,013 mol/dm 3 ) mixture at pH 3,3. As the result of 57% samarium concentrate elution with column load 1:3 and flow rate 0,4 cm/min, over 99% pure samarium oxide with 73% yield has been obtained. The yield of spectrally pure Sm 2 O 3 exceeded 45%. (author)

  14. 20__148

    African Journals Online (AJOL)

    pc

    2017-06-01

    Jun 1, 2017 ... Bayero Journal of Pure and Applied Sciences, 10(1): 148 – 152. Received: November, 2016 ... Soil pollution by organic compounds such as pesticides, industrial and ... and environmentally friendly approaches currently in use. This paper .... characterised and this has enable engineering of novel microbes ...

  15. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  16. Role of samarium additions on the shape memory behavior of iron based alloys

    International Nuclear Information System (INIS)

    Shakoor, R.A.; Khalid, F. Ahmad; Kang, Kisuk

    2011-01-01

    Research highlights: → The effect of samarium contents on shape memory behavior has been studied. → Addition of samarium increases the strength, c/a ratio and ε (hcp martensite). → Addition of samarium retards the nucleation of α (bcc martensite). → Improvement in shape memory effect with the increase in samarium contents. - Abstract: The effect of samarium contents on shape memory behavior of iron based shape memory alloys has been studied. It is found that the strength of the alloys increases with the increase in samarium contents. This effect can be attributed to the solid solution strengthening of austenite by samarium addition. It is also noticed that the shape memory effect increases with the increase in samarium contents. This improvement in shape memory effect presumably can be regarded as the effect of improvement in strength, increase in c/a ratio and obstruction of nucleation of α in the microstructure.

  17. Cross sections for d-{sup 3}H neutron interactions with samarium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Junhua; He, Long [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; Wu, Chunlei; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry

    2016-11-01

    The cross sections for (n,x) reactions on samarium isotopes were measured at (d-T) neutron energies of 13.5 and 14.8 MeV with the activation technique. Samples were activated along with Nb and Al monitor foils to determine the incident neutron flux. Theoretical calculations of excitation functions were performed using the nuclear model codes TALYS-1.6 and EMPIRE-3.2 Malta with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were discussed and compared with experimental data found in the literature. At neutron energies 13.5 and 14.8 MeV, the cross sections of the {sup 149}Sm(n,p){sup 149}Pm reaction are reported for the first time. The cross sections of the {sup 150}Sm(n,p){sup 150}Pm, {sup 144}Sm(n,p){sup 144}Pm, {sup 152}Sm(n,α){sup 149}Nd and {sup 144}Sm(n,α){sup 141}Nd reactions at different neutron energies reported in the present work can be added as new data in the nuclear databases.

  18. Samarium ion exchanged montmorillonite for high temperature cumene cracking reaction

    International Nuclear Information System (INIS)

    Binitha, N.N.

    2009-01-01

    Full text: Nano material Montmorillonite clay is cation exchanged with samarium and its catalytic influence in cumene cracking reaction is investigated. Effect of exchange with sodium ions on further exchange with samarium ions is also noted. Acidity measurements are done using TPD of ammonia. The retention of basic structure is proved from FTIR spectra and XRD patterns. Elemental analysis result shows that samarium exchange has occurred, which is responsible for the higher catalytic activity. Surface area and pore volume remains more or less unaffected upon exchange. Thermogravimetric analysis indicates the enhanced thermal stability on exchanging. Cumene cracking reaction is carried out at atmospheric pressure in a fixed bed glass reactor at 673 K. The predominance of Bronsted acidity is confirmed from high selectivity to benzene. (author)

  19. 4f and 5d magnetism in samarium

    International Nuclear Information System (INIS)

    Stunault, A.; Bernhoeft, N.; Vettier, C.; Dumesnil, K.; Dufour, C.

    2001-01-01

    We report on resonant magnetic X-ray scattering studies of a samarium epitaxial film at the samarium L 3 edge. We observe one quadrupolar resonance below the edge, reflecting the polarization of the 4f electrons, and two dipolar resonances above the edge, related to the polarization of the 5d band. We demonstrate, by following the thermal evolution of resonant magnetic intensities of both types, that the polarization of the 4f and 5d electrons present exactly the same temperature dependence, even very close to the ordering temperature, in agreement with the RKKY model for long-range magnetic order in rare earths

  20. Behavior of Samarium III during the sorption process

    International Nuclear Information System (INIS)

    Ordonez R, E.; Garcia G, N.; Garcia R, G.

    2004-01-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  1. Studies on ultrasonic velocity and electrical conductivity of samarium soaps in non-aqueous medium

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Chauhan, M.; Shukla, R.K.

    1990-01-01

    The ultrasonic velocity of solutions of samarium soaps in non-aqueous medium has been measured at a constant temperature and the results have been used to evaluate the various acoustic parameters. The pre-micellar association and the formation of micelles in samarium soap solutions have been determined by conductometric measurements. The molar conductance at infinite dilution, degree of ionisation and ionisation constant have been evaluated. The results show that samarium soaps behave as weak electrolyte in dilute solutions. (Authors)

  2. Solubility isotherms in ternary systems of samarium nitrate, water and nitrates of amidopyrine, benzotriazole

    International Nuclear Information System (INIS)

    Starikova, L.I.

    1991-01-01

    Solubility in the system of samarium nitrate-amidopyrine nitrate-water at 25 and 50 deg C was studied. Solubility isotherms consist of three branches, corresponding to crystallization of samarium nitrate tetrahydrate, amidopyrine nitrate and congruently soluble compounds of Sm(NO 3 ) 3 · 2C 13 H 17 ON 3 ·HNO 3 composition. Its thermal behaviour was studied. The system of samarium nitrate-benzotriazole nitrate-water is referred to eutonic type

  3. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  5. Europium and samarium doped calcium sulfide thin films grown by PLD

    International Nuclear Information System (INIS)

    Christoulakis, S.; Suchea, M; Katsarakis, N.; Koudoumas, E

    2007-01-01

    Europium and samarium doped calcium sulfide thin films (CaS:Eu,Sm) with different thickness were prepared by the pulsed laser deposition technique using sintered targets. A typical homemade deposition chamber and XeCl excimer laser (308 nm) were employed and the films were deposited in helium atmosphere onto silicon and corning glass substrates. Structural investigations carried out by X-ray diffraction and atomic force microscopy showed a strong influence of the deposition parameters on the film properties. The films grown had an amorphous or polycrystalline structure depending on growth temperature and the number of pulses used, the same parameters affecting the film roughness, the grain shape and dimensions, the film thickness and the optical transmittance. This work indicates that pulsed laser deposition can be a suitable technique for the preparation of CaS:Eu,Sm thin films, the film characteristics being controlled by the growth conditions

  6. Chrome-free Samarium-based Protective Coatings for Magnesium Alloys

    Science.gov (United States)

    Hou, Legan; Cui, Xiufang; Yang, Yuyun; Lin, Lili; Xiao, Qiang; Jin, Guo

    The microstructure of chrome-free samarium-based conversion coating on magnesium alloy was investigated and the corrosion resistance was evaluated as well. The micro-morphology, transverse section, crystal structure and composition of the coating were observed by scanning electron microscopy (SEM), X-ray diffraction (XRD), energy dispersive spectroscopy (EDS) and X- ray photoelectron spectroscopy (XPS), respectively. The corrosion resistance was evaluated by potentiodynamic polarization curve and electrochemical impedance spectroscopy (EIS). The results reveal that the morphology of samarium conversion coating is of crack-mud structure. Tiny cracks distribute in the compact coating deposited by samarium oxides. XRD, EDS and XPS results characterize that the coating is made of amorphous and trivalent-samarium oxides. The potentiodynamic polarization curve, EIS and OCP indicate that the samarium conversion coating can improve the corrosion resistance of magnesium alloys.

  7. Separation of lanthanum (3) and samarium (3) extraction with tributylphosphate in the solvent presence of solid phase

    International Nuclear Information System (INIS)

    Korotkevich, I.B.; Kolesnikov, A.A.; Bomshtejn, V.E.

    1990-01-01

    Lanthanum (3) and samarium (3) extraction from nitric acid solutions by tributylphosphate in the presence of solid phase has been investigated. An increase in samarium α-nitrate distribution factor in the presence of solid phase with a decrease in its concentration in the initial solution and with lanthanum nitrate concentration increase is detected. The greatest effect of separation is observed in samarium nitrate microregion. The method of quantitative extraction of samarium from lanthanum nitrate solutions with samarium-lanthanum separation factor exceeding 50 has been suggested

  8. Lanthanum (samarium) nitrate-4-aminoantipyrine nitrate-water systems

    International Nuclear Information System (INIS)

    Starikova, L.I.; Zhuravlev, E.F.

    1985-01-01

    Using the isothermal method of cross-sections at 50 deg C systems lanthanum nitrate-4-aminoantipyrine nitrate-water (1), samarium nitrate-4-aminoantipyrine nitrate-water (2), are studied. Isotherms of system 1 consist of two crystallization branches of initial salt components. In system 2 formation of congruently soluble compounds of the composition Sm(No) 3 ) 3 xC 11 H 13 ON 3 xHNO 3 is established. Analytical, X-ray phase and thermogravimetric analysis of the isolated binary salt are carried out

  9. Level densities and γ-strength functions in 148,149Sm

    International Nuclear Information System (INIS)

    Siem, S.; Guttormsen, M.; Ingeberg, K.; Melby, E.; Rekstad, J.; Schiller, A.; Voinov, A.

    2002-01-01

    The level densities and γ-strength functions of the weakly deformed 148 Sm and 149 Sm nuclei have been extracted. The temperature versus excitation energy curve, derived within the framework of the microcanonical ensemble, shows structures, which we associate with the breakup of Cooper pairs. The nuclear heat capacity is deduced within the framework of both the microcanonical and canonical ensembles. We observe negative heat capacity in the microcanonical ensemble whereas the canonical heat capacity exhibits an S shape as a function of temperature, both signals of a phase transition. The structures in the γ-strength functions are discussed in terms of the pygmy resonance and the scissors mode built on excited states. The samarium results are compared with data for the well-deformed 161,162 Dy, 166,167 Er, and 171,172 Yb isotopes and with data from (n,γ) experiments and giant dipole resonance studies

  10. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  11. Preparation and examination of properties of samarium-153-EDTMP complex

    International Nuclear Information System (INIS)

    Nowak, M.; Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W.; Licinska, I.

    1995-01-01

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of 153 Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, β - -decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of 153 Sm-EDTMP chelate were examined in a broad range of samarium concentration and 153 Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of 153 Sm-EDTMP chelate as compared with molecules of ''free''EDTMP. The results of biodistribution of 153 Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of 153 Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs

  12. Influence of tellurite on lifetime for samarium doped lanthanum lead borate glass

    Science.gov (United States)

    Madhu, A.; Eraiah, B.

    2018-04-01

    Samarium substituted tellurium lanthanum lead borate glass is prepared using melt quenching technique. Luminescence spectra have been recorded upon excitation with 402 nm various transitions from 4G5/2 level, for samarium doped tellurite glasses are studied and also lifetime for all the samples exhibit single exponential behaviour of decay curve. Luminescence spectra of present glasses show quenching effect due to cross-relation channels of samarium ions. The lifetime of glass samples decrease as the tellurite concentration is decreased. So, it evidences that to attain longer lifetime for lasing material one can tune the host by selecting concentration of tellurite.

  13. 19 CFR 148.44 - Gifts.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Gifts. 148.44 Section 148.44 Customs Duties U.S...) PERSONAL DECLARATIONS AND EXEMPTIONS Exemptions for Nonresidents § 148.44 Gifts. (a) Exemption. An arriving... and are to be disposed of by him as bona fide gifts. See § 148.43(b) for limitations on cigars under...

  14. Octupole deformation in {sup 148}Nd

    Energy Technology Data Exchange (ETDEWEB)

    Ibbotson, R; Kotlinski, B; Cline, DD; Devlin, M; Helmer, K G; Kavka, A E; Vogt, E G; Wu, C Y [Rochester Univ., NY (United States); White, C A; Butler, P A; Clarkson, N; Hoare, T H; Jones, G D [Liverpool Univ. (United Kingdom); Czosnyka, T [Warsaw Univ. (Poland); Cunningham, R A [Daresbury Lab. (United Kingdom); Hughes, J R; Poyntern, R J; Regan, P; Wadsworth, R; Watson, D L [York Univ. (United Kingdom)

    1992-08-01

    E1, E2 and E3 matrix elements have been determined for transitions between states up to spin 13 in {sup 148}Nd. These values were obtained from Coulomb excitation data using {sup 58}Ni and {sup 92}Mo ions, projectile excitation using a {sup 208}Pb target, and from recoil distance lifetime measurements. The results are consistent with a description of {sup 148}Nb having fairly constant intrinsic-frame moments of Q{sub 20} = +400 efm{sup 2} ({beta}{sub 2}{sup rms} {approx}+0.22), Q{sub 30}{sup sum} {approx}1600 efm{sup 3} ({beta}{sub 3}{sup rms} {approx}0.16) for the positive parity states and Q{sub 20} =+330 efm{sup 2} ({beta}{sub 2}{sup rms} {approx}+0.18), Q{sub 30}{sup sum} {approx}2000 efm{sup 3} ({beta}{sub 3}{sup rms} {approx}0.21) for the negative parity states. (author). 23 refs., 3 figs.

  15. 19 CFR 148.4 - Accompanying articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Accompanying articles. 148.4 Section 148.4 Customs... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS General Provisions § 148.4 Accompanying articles. (a) Generally. Articles shall be considered as accompanying a passenger or brought in by him if the articles...

  16. 40 CFR 148.5 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Waste analysis. 148.5 Section 148.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) HAZARDOUS WASTE INJECTION RESTRICTIONS General § 148.5 Waste analysis. Generators of hazardous wastes that are...

  17. 17 CFR 148.25 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 148.25 Section 148... Considering Applications § 148.25 Settlement. The applicant may propose settlement of the award to the Commission before final action on the application, either in connection with a settlement of the adjudicatory...

  18. 7 CFR 1955.148 - Auction sales.

    Science.gov (United States)

    2010-01-01

    ... complexity of the sale. When the services of a professional auctioneer are advisable, the services will be... 7 Agriculture 14 2010-01-01 2009-01-01 true Auction sales. 1955.148 Section 1955.148 Agriculture... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property General § 1955.148 Auction sales...

  19. 19 CFR 148.42 - Personal effects.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Personal effects. 148.42 Section 148.42 Customs... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Exemptions for Nonresidents § 148.42 Personal effects. (a... adornment, toilet articles, and similar personal effects. “Similar personal effects” include all articles...

  20. 45 CFR 148.220 - Excepted benefits.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Excepted benefits. 148.220 Section 148.220 Public... FOR THE INDIVIDUAL HEALTH INSURANCE MARKET Preemption; Excepted Benefits § 148.220 Excepted benefits... provision of the benefits described in paragraphs (a) and (b) of this section (or any combination of the...

  1. Resonances of coherent population trapping in samarium vapours

    International Nuclear Information System (INIS)

    Kolachevsky, Nikolai N; Akimov, A V; Kiselev, N A; Papchenko, A A; Sorokin, Vadim N; Kanorskii, S I

    2001-01-01

    Resonances of coherent population trapping were detected in atomic vapours of the rare-earth element samarium. The coherent population trapping was produced by two external-cavity diode lasers (672 and 686 nm) in a Λ-system formed by the three levels of 154 Sm: the 4f 6 6s 2 ( 7 F 0 ) ground state, the first fine-structure 4f 6 6s 2 ( 7 F 1 ) sublevel of the ground state and the 4f 6 ( 7 F)6s6p( 3 P o ) 9 F o 1 upper level. The dependence of the spectral shapes and resonance contrasts on the polarisation of the laser beams and the direction of the applied magnetic field was studied. The obtained results were analysed. (nonlinear optical phenomena)

  2. Optical and physical properties of samarium doped lithium diborate glasses

    Science.gov (United States)

    Hanumantharaju, N.; Sardarpasha, K. R.; Gowda, V. C. Veeranna

    2018-05-01

    Sm3+ doped lithium di-borate glasses with composition 30Li2O-60B2O3-(10-x) PbO, (where 0 molar volume with samarium ion content indicates the openness of the glass structure. The gradual increase in average separation of boron-boron atoms with VmB clearly indicates deterioration of borate glass network, which in turn leads to decrease in the oxygen packing density. The replacements of Sm2O3 for PbO depolymerise the chain structure and that would increase the concentration of non-bridging oxygens. The marginal increase of optical band gap energy after 1.0 mol.% of Sm2O3 is explained by considering the structural modification in lead-borate. The influence of Sm3+ ion on physical and optical properties in lithium-lead-borate glasses is investigated and the results were discussed in view of the structure of borate glass network.

  3. Magnetic behavior study of samarium nitride using density functional theory

    Science.gov (United States)

    Som, Narayan N.; Mankad, Venu H.; Dabhi, Shweta D.; Patel, Anjali; Jha, Prafulla K.

    2018-02-01

    In this work, the state-of-art density functional theory is employed to study the structural, electronic and magnetic properties of samarium nitride (SmN). We have performed calculation for both ferromagnetic and antiferromagnetic states in rock-salt phase. The calculated results of optimized lattice parameter and magnetic moment agree well with the available experimental and theoretical values. From energy band diagram and electronic density of states, we observe a half-metallic behaviour in FM phase of rock salt SmN in while metallicity in AFM I and AFM III phases. We present and discuss our current understanding of the possible half-metallicity together with the magnetic ordering in SmN. The calculated phonon dispersion curves shows dynamical stability of the considered structures. The phonon density of states and Eliashberg functional have also been analysed to understand the superconductivity in SmN.

  4. New reduced variant in gadolinium and samarium monoxide thin films

    Energy Technology Data Exchange (ETDEWEB)

    Bist, B M.S.; Kumar, J; Srivastava, O N [Banaras Hindu Univ. (India). Dept. of Physics

    1977-01-01

    A new reduced phase has been observed in the thin films of gadolinium and samarium monoxides. This phase results on imparting an annealing treatment to the monoxides and is formed as a result of the creation and ordering of vacancies in the oxygen sublattice. The new phase has been analysed to possess a rhombohedral unit cell with lattice parameters a/sub R/ = a/sub 0/ square root of (3/2) and c/sub R/ = a/sub 0/ square root of 3 (based on hexagonal axes, a/sub 0/ being the lattice parameter of the fundamental zinc blende type unit cell of the monoxide). Based on the proposed structure, the new phase can be assigned the solid state chemical formula RO/sub x/ where R = Gd, Sm and x = 0.66.

  5. Samarium-153-EDTMP in the metastatic bone pain treatment

    International Nuclear Information System (INIS)

    Lins Filho, M.L.M.; Santos, A.O.; Nappi, A.P.B.; Meirelles, M.B.; Arouca, P.T.; Ramos, C.D.; Etchebehere, E.C.S.C.; Teixeira, L.C.; Netto Junior, N.R.; D'Ancona Cal; Camargo, E.E.

    1997-01-01

    Full text: Bone metastasis is the most reason of pain in prostate and mammary cancer patients. The Samarium-153-EDTMP has been showed as an alternative to the treatment of the metastasis bone pain. With the objective to evaluate the use of the Sm-153-EDTMP as a systemic therapy for the metastasis bone pain, 30 patients (19 male, 11 female, average age of 64,5 years) were studied. 19 patients with prostate cancer and 11 with mammary cancer. All the patients presented previous bone scintiscanning with multiple metastasis; interruption of the chemotherapy or radiotherapy for two or more weeks and leukocyte count higher than 2,000 leukocytes/mm 3 and platelets higher than 80,000/mm 3 . The patients were classified previously to the radioisotope therapy, as far the intensity of the pain in a scale from 0 to 10 is concerned. All the patients received 37 MBq/kg (1m Ci/kg) of weight of Sm-153-EDTMP by venous via. The evaluation 6 weeks after the therapy showed complete or partial pain relief in 22 patients (73,3%). Complete or partial pain relief has been obtained in 91,0% (10 in 11) of the patients with mammary cancer and in 62,2% (12 in 19) of the patients with prostate cancer. Transitory leukopenia (lower than 2,000 leukocytes/mm 3 ) and platelet count (lower than 80,000/mm 3 ) occurred in 33,3% of the patients. 8 patients (26,7%) did not responded to the therapy. The therapy with Samarium-153-EDTMP is a simple, safe and efficient method in the treatment of the bone pain caused by metastasis

  6. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    International Nuclear Information System (INIS)

    Castrillejo, Y.; Fernandez, P.; Medina, J.; Hernandez, P.; Barrado, E.

    2011-01-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) ↔ Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al 3 Sm and Al 2 Sm.

  7. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  8. Australian manufacture of QuadrametTM (Samarium-153 EDTMP)

    International Nuclear Information System (INIS)

    Wood, N.R.; Whitwell, J.

    1997-01-01

    Quadramet T (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200μg/mL whereas the overseas formulation has a level of 20-46μg/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet TM provides a further option in the management of these difficult cases

  9. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    Energy Technology Data Exchange (ETDEWEB)

    Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))

    1992-08-24

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

  10. Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

    International Nuclear Information System (INIS)

    Shaorong Liu; Jian Meng; Wenhua Liu

    1992-01-01

    When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

  11. Sorption-desorption of samarium in Febex bentonite

    International Nuclear Information System (INIS)

    Ramirez-Guinart, O.; Rigol, A.; Vidal, M.; Fernandez-Poyatos, P.; Alba, M. D.

    2012-01-01

    Document available in extended abstract form only. The chemical and physical nature of the clay is a key issue in the design of engineered barriers. The FEBEX bentonite is one of the clays candidates to be used in engineered barriers in deep geology repositories (DGR). Here, its performance was tested with respect to the sorption-desorption of samarium, which is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in high level radioactive waste in the form of the radioactive isotope 151 Sm. FEBEX bentonite was used in this study. This is a di-octahedral smectite, with isomorphic substitutions in tetrahedral and octahedral sheets. Its theoretical cation exchange capacity value is 1500 meq kg -1 . Sorption isotherms were obtained for Sm in the range of initial concentrations of 0.01 and 9 meq l -1 . Tests were carried out in deionized water and in a medium simulating the composition of interstitial water. Sorption tests were performed equilibrating 30 ml of the Sm solution with 0.2 g of clay. After a contact time of 24 hours, supernatants were decanted off after centrifugation. The quantification of the concentration of Sm in the initial and final solutions allowed us to quantify the Sm equilibrium concentration (C eq ), the fraction sorbed in the FEBEX bentonite (C sorb ) and to derive the sorption K d data. Desorption tests were applied to determine the desorption K d and the percentage of Sm reversibly sorbed. Desorption tests were performed with the bentonite residue from the sorption step, under the same experimental conditions, but without Sm. Powder X-ray diffractograms were obtained from 3 to 70 deg. 2θ with a step of 0.05 deg. and a counting time of 3 s. The crystalline phases were identified using the computer program X'Pert HighScore. The morphology of the samples was analyzed by SEM at 20 kV. An EDX system was fitted to the SEM equipment to perform chemical analyses of the samples using a Si/Li detector

  12. Development and evaluation of copper-67 and samarium-153 labeled conjugates for tumor radioimmunotherapy

    International Nuclear Information System (INIS)

    Srivastava, S.C.; Mausner, L.F.; Mease, R.C.; Meinken, G.E.; Joshi, V.; Kolsky, K.; Sweet, M.; Steplewski, Z.

    1995-01-01

    The potential of utilizing receptor-specific agents such as monoclonal antibodies (MAb), and MAb-derived smaller molecules, as carriers of radionuclides for the selective destruction of tumors has stimulated much research activity. The success of such applications depends on many factors, especially the tumor binding properties of the antibody reagent, the efficiency of labeling and in-vivo stability of the radioconjugate and, on the careful choice of the radionuclide best suited to treat the tumor under consideration. The radiolabeled antibody technique for radioimmunotherapy (RIT), however, has experienced many limitations, and its success has not matched the expectations that were raised more than a decade ago. The problems that have been identified include: (i) degradation of antibody immunoreactivity resulting from chemical manipulations required for labeling; (ii) lack of suitable radioisotopes and methods for stable attachment of the radiolabel; (iii) in-vivo instability of the radioimmunoconjugates; (iv) excessive accumulation of activity in non-target locations; and (v) lack of radioimmunoconjugate accessibility to cells internal to a tumor mass. A careful choice of the radionuclide(s) best suited to treat the tumor under consideration is one of the most important requirements for successful radioimmunotherapy. This study evaluates copper 67 and samarium 153 for tumor radioimmunotherapy

  13. Determination of 0.01–0.1% of samarium in 40–100 mg of lead chloride

    NARCIS (Netherlands)

    Agterdenbos, J.; Jütte, B.A.H.G.; Schuring, J.

    1971-01-01

    A method is described for the determination of 5–25 μg of samarium in about 40 mg of lead chloride, based on the removal of the lead by electrolysis and determination of the samarium by extraction with PAN and measurement of the extinction of the complex at 552 nm.

  14. Samarium (III Selective Membrane Sensor Based on Tin (IV Boratophosphate

    Directory of Open Access Journals (Sweden)

    Ashok S. K. Kumar

    2004-08-01

    Full Text Available Abstract: A number of Sm (III selective membranes of varying compositions using tin (IV boratophosphate as electroactive material were prepared. Polyvinyl chloride, polystyrene and epoxy resin were used as binding materials. Membrane having composition of 40% exchanger and 60% epoxy resin exhibited best performance. This membrane worked well over a wide concentration range of 1x10-5M to 1x10-1 M of samarium ions with a Super-Nernstian slope of 40 mV/decade. It has a fast response time of less than 10 seconds and can be used for at least six months without any considerable divergence in potentials. The proposed sensor revealed good selectivities with respect to alkali, alkaline earth, some transition and rare earth metal ions and can be used in the pH range of 4.0-10.0. It was used as an indicator electrode in the potentiometric titration of Sm (III ions against EDTA. Effect of internal solution was studied and the electrode was successfully used in non-aqueous media, too.

  15. Structural phase transition and electronic properties in samarium chalcogenides

    Energy Technology Data Exchange (ETDEWEB)

    Panwar, Y. S., E-mail: yspanwar2011@gmail.com [Department of Physics, Govt. New Science College Dewas-455001 (India); Aynyas, Mahendra [Department of Physics, C.S.A. Govt. P.G. College, Sehore, 466001 (India); Pataiya, J.; Sanyal, Sankar P. [Department of Physics, Barkatullah University, Bhopal, 462026 (India)

    2016-05-06

    The electronic structure and high pressure properties of samarium monochalcogenides SmS, SmSe and SmTe have been reported by using tight binding linear muffin-tin-orbital (TB-LMTO) method within the local density approximation (LDA). The total energy as a function of volume is evaluated. It is found that these monochalcogenides are stable in NaCl-type structure under ambient pressure. We predict a structural phase transition from NaCl-type (B{sub 1}-phase) structure to CsCl-type (B{sub 2}-type) structure for these compounds. Phase transition pressures were found to be 1.7, 4.4 and 6.6 GPa, for SmS, SmSe and SmTe respectively. Apart from this, the lattice parameter (a{sub 0}), bulk modulus (B{sub 0}), band structure (BS) and density of states (DOS) are calculated. From energy band diagram we observed that these compounds exhibit metallic character. The calculated values of equilibrium lattice parameter and phase transition pressure are in general good agreement with available data.

  16. Magnetoresistance of samarium in the 4.2-300 K range

    International Nuclear Information System (INIS)

    Trubitsyn, V.A.; Shalashov, V.F.

    1980-01-01

    Electric conductivity, transverse and longitudinal magnetoresistance of polycrystalline samarium with the purity of 99.9% in the 4.2-300 K temperature range and in magnetic fields up to 50 ke, are measured. The constituent of specific electric conductivity caused by spin disorder is 30.7 μOhmxcm, m*/m=2.6, the exchange parameter is G=3.1 eVxA 3 . Both transverse and longitudinal magnetoresistance are positive at 4.2 K; and the increase of temperature reveals a number of anomalies, evidently conditioned by the alteration of samarium magnetic structure

  17. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  18. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    CSIR Research Space (South Africa)

    Mandiwana, V

    2015-09-01

    Full Text Available the biodistribution of poly(D,L-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([(sup153)Sm]Sm(sub2)O(sub3)) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear...

  19. Expedient Method for Samarium(II) Iodide Preparation Utilizing a Flow Approach

    Czech Academy of Sciences Publication Activity Database

    Voltrová, Svatava; Šrogl, Jiří

    2013-01-01

    Roč. 24, č. 3 (2013), s. 394-396 ISSN 0936-5214 R&D Projects: GA MŠk LH12013 Institutional support: RVO:61388963 Keywords : flow * samarium * iodide * reduction Subject RIV: CC - Organic Chemistry Impact factor: 2.463, year: 2013

  20. Identification of the lines in the L emission spectrum of cerium and samarium

    International Nuclear Information System (INIS)

    Shrivastava, B.D.; Singh, D.

    1992-01-01

    The occurrence of a line at 2.1556 A in the L emission spectrum of cerium and two lines at 1.6679 and 1.8379 A in the L emission spectrum of samarium, reported many years ago, has remained a puzzle. These have now been identified as EXAFS minima occurring at the L absorption edges of the respective elements. (author)

  1. ppt level detection of samarium(III) with a coated graphite sensor based on an antibiotic.

    Science.gov (United States)

    Ganjali, Mohammad Reza; Rezapour, Morteza; Pourjavid, Mohammad Reza; Haghgoo, Soheila

    2004-07-01

    N-[2-[4-[[[(Cyclohexylamino)carbonyl]amino]sulfonyl]phenyl]ethyl]-5-methyl pyrazine carboxamide (glipizid) was explored as an electro-active material for preparing a polymeric membrane-based sensor selective to samarium ions. The membrane incorporated 30% poly(vinyl chloride) (PVC), 53% benzyl acetate (BA), 11% glipizid and 6% sodium tetraphenyl borate. When coated on the surface of a graphite electrode, it exhibits Nernstian responses in the concentration range of 1.0 x 10(-5) to 1.0 x 10(-10) M, with a detection limit of 8.0 x 10(-11)M samarium. The electrode shows high selectivity towards samarium over several cations (alkali, alkaline earth, transition and heavy metal ions), and specially lanthanide ions. The proposed sensor has a very short response time (pH range for at least ten weeks. It was used as an indicator electrode in potentiometric titration of Sm(III) ions with an EDTA solution, and for determination of samarium in binary and ternary mixtures.

  2. Diffusion of samarium into cobalt in the reduction-diffusion process

    International Nuclear Information System (INIS)

    Freitas Nogueira, P. de; Neto, F.B.; Landgraf, F.J.G.

    1998-01-01

    The presence of metallic cobalt in samarium-cobalt powders is a major cause for low magnetic properties in magnets. This paper intends to investigate the effect of time and temperature in the microstructure of powders produced by reduction-diffusion. This process, developed for the production of rare earth-transition metal alloys, consists on the reduction of the rare earth oxide with metallic calcium (or calcium hydride) and its subsequent diffusion into the cobalt particle. In the present work, a mixture of samarium oxide, cobalt powder and metallic calcium was heated to 1100 or 1200 C for 2 or 4 hours in a tubular furnace under one atmosphere of purified argon. The material thereof obtained, a sintered mass is disintegrated by aqueous crepitation. The powder was evaluated in terms of its chemical composition, its samarium yield and the intermetallic compounds present. The samarium, oxygen and calcium content of the powders produced were adequate for magnet production. However, despite the massive formation of the SmCo 5 compound after 2 hours at 1100 C, final homogeneity is attained only after 4 hours at 1200 C, with the presence of SmCo 5 and Sm 2 Co 7 and the absence of the Sm 5 Co 19 compound. Also, metallic cobalt and Sm 2 Co 17 were observed in the materials produced after 2 hours at 1100 or 1200 C. (orig.)

  3. Pressure and irradiation effects on transport properties of samarium compounds with instable valence

    International Nuclear Information System (INIS)

    Morillo, J.

    1981-01-01

    Electron transport properties in samarium compounds with instable valence are studied in this thesis: from SmS in its integer valence phases at common pressure to SmB 6 compound IV at common pressure through SmSsub(1-x)Psub(x) (x 6 is presented [fr

  4. Adsorption and the initial stages of samarium condensation on iridium coated by graphite monolayer

    International Nuclear Information System (INIS)

    Abdullaev, R.M.; Tontegode, A.Ya.; Yusifov, F.K.

    1978-01-01

    Adsorption and the initial stages of vacuum samarium condensation on iridium coated by graphite monolayer (valent-saturated neutral substrate) were studied by the thermodesorption mass-spectrometry and thermoemission methods, and were compared with samarium adsorption and condensation on iridium. Desorption heat of samarium atoms with thin coating of Ir-C, equal to E approximately 1.9 eV has been determined. For desorption with Ir E is approximately 6 eV. Such a great difference in desorption heats is connected with the reduction of covalent constituent of adsorption bond in a neutral substrate. Samarium on Ir-C is found to be condensated in two states: loosely bound and tightly bound which sharply differ in properties. The tightly bound state is characterized by abnormally low vapour pressure. Possible nature of this state is discussed. Double effect on the condensation of the substrate valent saturation is noted. On the one hand, the reduction of the particle bond with the substrate decreases their concentration on the surface, preventing condensation. On the other hand, the release of the valent eloctrons of adatous brings about strong lateral interaction between them, which in its turn, promotes condensation during eased migration on the neutral substrate

  5. Samarium-153 Oksabifor in the treatment of metastatic bone disease

    International Nuclear Information System (INIS)

    Solodyannikova, O.; Voit, N.; Sukach, G.; Sagan, D.

    2015-01-01

    patients - reducing the number of foci and the level of radiopharmaceutical uptake in them. Conclusions: radionuclide therapy in patients with BM can effectively suppress pain and significantly reduce the number of analgesics. Post-treatment patients, life quality statistically significantly improved. Samarium-153 has the ability to reduce BM number and intensity of radiopharmaceutical accumulation in spots in the control study. (authors)

  6. Plasma-Lyte 148: A clinical review

    Science.gov (United States)

    Weinberg, Laurence; Collins, Neil; Van Mourik, Kiara; Tan, Chong; Bellomo, Rinaldo

    2016-01-01

    AIM To outline the physiochemical properties and specific clinical uses of Plasma-Lyte 148 as choice of solution for fluid intervention in critical illness, surgery and perioperative medicine. METHODS We performed an electronic literature search from Medline and PubMed (via Ovid), anesthesia and pharmacology textbooks, and online sources including studies that compared Plasma-Lyte 148 to other crystalloid solutions. The following keywords were used: “surgery”, “anaesthesia”, “anesthesia”, “anesthesiology”, “anaesthesiology”, “fluids”, “fluid therapy”, “crystalloid”, “saline”, “plasma-Lyte”, “plasmalyte”, “hartmann’s”, “ringers” “acetate”, “gluconate”, “malate”, “lactate”. All relevant articles were accessed in full. We summarized the data and reported the data in tables and text. RESULTS We retrieved 104 articles relevant to the choice of Plasma-Lyte 148 for fluid intervention in critical illness, surgery and perioperative medicine. We analyzed the data and reported the results in tables and text. CONCLUSION Plasma-Lyte 148 is an isotonic, buffered intravenous crystalloid solution with a physiochemical composition that closely reflects human plasma. Emerging data supports the use of buffered crystalloid solutions in preference to saline in improving physicochemical outcomes. Further large randomized controlled trials assessing the comparative effectiveness of Plasma-Lyte 148 and other crystalloid solutions in measuring clinically important outcomes such as morbidity and mortality are needed. PMID:27896148

  7. The samarium Grignard reaction. In situ formation and reactions of primary and secondary alkylsamarium(III) reagents

    Energy Technology Data Exchange (ETDEWEB)

    Curran, D.P.; Totleben, M.J. [Univ. of Pittsburgh, PA (United States)

    1992-07-15

    This work shows that primary and secondary radicals are rapidly reduced in THF/HMPA to form primary- and secondary-alkylsamarium reagents. The primary- and secondary-radicals can be formed either by direct SmI{sup 2} reductions of primary- and secondary-halides or by a previous rapid radical cyclization. The samarium reagents have moderate stability in solution, and they react with a variety of typical electrophiles, including aldehydes and ketones. The work further shows that organosamarium intermediates can be involved in the traditional samarium Barbier reaction of aldehydes and ketones conducted in THF/HMPA. A new procedure called the {open_quotes}samarium Grignard{close_quotes} method is introduced, and it is suggested that this new procedure will have considerably more scope and generality than the samarium Barbier reaction. 37 refs., 4 tabs.

  8. Dicty_cDB: VFM148 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR

  9. Influence of pretreatment temperature cycling on the radiating defect formation in silicon doped by samarium

    International Nuclear Information System (INIS)

    Abdurakhmanov, K.P.; Nazyrov, D.E.

    2006-01-01

    Full text: The raise of thermal and radiation stability as it is known, is one of actual problems of physics semiconductors. Recently it is established, that the rare-earth elements (REE) raise a stability of silicon to exterior action. In this connection the investigation of silicon doped REE by samarium and influence on its properties of heat treatments and radiation exposure is important. In sectional operation the outcomes of investigations of influence of samarium on thermal (600 degree C are reduced; 600 deg. + 900 deg. C; 900 deg. C; 900 deg. C + 600 deg. C; 1100 deg. C; 600 deg. C + 900 deg. C + 1100 deg. C; 900 deg. C + 600 deg. C + 1100 deg. C) thermal defect formation and radiation defect formation (exposure of γ-quanta 60 Co) both in beforehand wrought, and in thermally unfinished samples. After each cycle of heat treatments samples cool fast (throwing off in oil) or slowly (together with the furnace). Doping n-silicon REE by gadolinium and samarium was carried out during cultivation. The concentration of gadolinium and samarium in silicon, on sectional of a neutron-activation analysis was equaled 10 14 - 10 18 cm -3 . As control is model monocrystal silicon such as KEP-15/50. Para-meters of deep levels originating in control and doped REE samples, both past heat treatment or temperature cycling, and irradiated by the γ-quanta are defined by methods of a capacity spectroscopy: DLTS and IRC. The obtained outcomes have shown, that in irradiated with the γ-quanta 60 Co deep levels samples are formed with energies: E C -0,17 eV, E C -0,32 eV, EC-0,41 eV. Thus the parameters of deep levels vary depending on requirements of prestress heat treatment. For example heat treatment at 600 deg. C essentially increments a velocity of introduction of and centre (deep level of E C -0,17 eV), in comparison with a velocity of introduction of this level in samples with prestress heat treatment at 900 deg. C. In samples n-Si doped by samarium effectiveness of formation

  10. 30 CFR 14.8 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... MINING PRODUCTS REQUIREMENTS FOR THE APPROVAL OF FLAME-RESISTANT CONVEYOR BELTS General Provisions § 14.8... order to assure that the finished conveyor belt will meet the flame-resistance test— (1) Flame test a sample of each batch, lot, or slab of conveyor belts; or (2) Flame test or inspect a sample of each batch...

  11. 19 CFR 148.101 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Noncommercial Importations of Limited Value § 148.101... figured as follows: Fair retail value Duty (a) The $400 personal exemption $400 (b) Articles which carry a...: Fair retail value Duty (a) The $1,200 personal exemptions for residents returning from the U.S. Virgin...

  12. 19 CFR 148.13 - Written declarations.

    Science.gov (United States)

    2010-04-01

    ...) When required. Unless an oral declaration is accepted under § 148.12, the declaration required of a..., HTSUS, for articles to be disposed of as bona fide gifts; or subheading 9804.00.40, HTSUS, for articles... passenger shall state either: (1) The price actually paid for the article in the currency of purchase, or...

  13. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  14. Ultrasonic and viscosimetric studies of samarium laurate in benzene-dimethylsulfoxide mixtures

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Anis, M.

    1995-01-01

    Ultrasonic and viscosity measurements of samarium laurate in benzene-DMSO mixtures of different compositions (7:3 and 1:1 V/V) have been used to determine the critical micelle concentration (CMC), soap-solvent interaction, and various acoustic parameters of the system. The values of critical micelle concentration increase with increasing amount of DMSO in the solvent mixtures. The viscosity results have been explained on the basis of equations proposed by Einstein, Vand. Moulik, and Jones-Dole. The values of CMC for samarium laurate obtained from the viscosity measurements are in agreement with the results obtained from ultrasonic measurements. The results show that the soap molecules do not aggregate appreciably below CMC there is a marked change in the aggregation behaviour at CMC. (author)

  15. Removal of trivalent samarium from aqueous solutions by activated biochar derived from cactus fibres

    Institute of Scientific and Technical Information of China (English)

    Loukia Hadjittofi; Styliana Charalambous; Ioannis Pashalidis

    2016-01-01

    The efficiency of activated biochar fibres obtained fromOpuntia Ficus Indica regarding the sorption of trivalent samarium (Sm(III)) from aqueous solutions was investigated by batch experiments. The effect of various physicochemical parameters (e.g. pH, initial metal concentration, ionic strength, temperature and contact time) on the Sm(III) adsorption was studied and the surface species were characterized by FTIR spectroscopy prior to and after the lanthanide sorption. The experimental results showed that the acti-vated biochar fibres possessed extraordinary sorption capacity for Sm(III) in acidic solutions (qmax=90 g/kg, pH 3.0) and near neutral solutions (qmax=350 g/kg, pH 6.5). This was attributed to the formation of samarium complexes with the surface carboxylic moieties, available in high density on the lamellar structures of the bio-sorbent.

  16. Enhanced electron-lattice coupling under uniaxial stress in layered double hydroxides intercalated with samarium complexes

    International Nuclear Information System (INIS)

    Park, Ta-Ryeong

    2004-01-01

    We have applied uniaxial stress to samarium complexes by intercalating them into the gallery of a layered material and by using a diamond-anvil cell at 28 K. Although uniaxial stress reduces symmetry and removes degeneracy, the overall number of photoluminescence (PL) peaks evidently decreased with the application of uniaxial stress. This contradictory observation is explained by an increased electron-lattice coupling strength under uniaxial stress. This behavior is also confirmed by time-resolved PL data.

  17. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study

    International Nuclear Information System (INIS)

    Lucas H, J.

    2016-01-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  18. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems

    International Nuclear Information System (INIS)

    Diaz F, J.C.

    2006-01-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  19. Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

    International Nuclear Information System (INIS)

    Essman, Stephanie C.; Lewis, Michael R.; Fox, Derek B.

    2008-01-01

    Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ( 153 Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic 153 Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of 153 Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of 153 Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of 153 Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P 153 Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted

  20. Impact of educational strategies in positioning Samarium-153 EDTMP as a treatment for metastatic bone pain

    International Nuclear Information System (INIS)

    Seminario, C.; Morales, R.; Castro, M.; Cano, R.A.; Mendoza, G.

    2005-01-01

    To educate is a difficult task but its results make efforts worthwhile. Many patients in Peru suffer from intractable bone pain due to metastases. Since 1993 radionuclides were used to palliate bone pain due to metastases in Peru. First, with the help of the IAEA, Peru participated in a clinical trial using Phosphorus 32 and Strontium 89. Then, efforts were performed to produce Samarium 153 EDMTP locally, which was achieved in 1995. Nevertheless, years passed and Samarium use did not increase proportionally to the needs of people with cancer and bone pain, mainly the poor. Educational strategies have been proven useful for delivering solutions to many health problems in other diseases and also in cancer. Health education makes patients and their relatives assume responsible care of their problems. The purpose of this work was to increase Samarium EDTMP use as palliative treatment in patients with bone pain due to metastases, using educational strategies as means to change attitudes towards this health problem. In September 2003, a task group conducted studies in order to apply several methods to achieve the goal of increasing Samarium EDTMP use. Educational strategies employed were performed to provide verbal and written information to patients, physicians, medical students, residents, pain specialists, oncologists and neurologists, as well as general public. Verbal information included radio interviews, television spots and a phone number (in charge of two secretaries, prepared for answering and if not possible, a physician was in charge of attending patient consultation), e-mail and a web page for consultation. Written material was delivered to several newspapers, including clinical use of Samarium, possibilities of being elected for treatment, benefits and risks and a photography of the product. Politics of the institution producing Samarium changed, in order to achieve minimum cost of the product and it was delivered to all publics at the lowest cost for a year

  1. 19 CFR 148.114 - Shipment of unaccompanied articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Shipment of unaccompanied articles. 148.114 Section 148.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... States § 148.114 Shipment of unaccompanied articles. One copy of the validated Customs Form 255 shall be...

  2. 36 CFR 406.141-406.148 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.141-406.148 [Reserved] ...

  3. 46 CFR 148.04-23 - Unslaked lime in bulk.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Unslaked lime in bulk. 148.04-23 Section 148.04-23... HAZARDOUS MATERIALS IN BULK Special Additional Requirements for Certain Material § 148.04-23 Unslaked lime in bulk. (a) Unslaked lime in bulk must be transported in unmanned, all steel, double-hulled barges...

  4. 28 CFR 39.141-39.148 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.141-39.148 Section 39.141-39.148 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.141-39.148 [Reserved] ...

  5. 46 CFR 148.02-1 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 148.02-1 Section 148.02-1 Shipping... MATERIALS IN BULK Vessel Requirements § 148.02-1 Shipping papers. (a) Carriers may not accept for..., unless the hazardous materials offered for such shipment is accompanied by a shipping paper on which the...

  6. 26 CFR 148.1-5 - Constructive sale price.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 17 2010-04-01 2010-04-01 false Constructive sale price. 148.1-5 Section 148.1... § 148.1-5 Constructive sale price. (a) Purpose of this section. The purpose of this section is to set forth temporary rules to be used in determining a constructive sale price under section 4216(b) of the...

  7. 19 CFR 148.103 - Family grouping of allowances.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Family grouping of allowances. 148.103 Section 148... Value § 148.103 Family grouping of allowances. (a) Generally. When members of a family residing in one... household. “Members of a family residing in one household” shall include all persons, regardless of age, who...

  8. 46 CFR 148.03-7 - During transport.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false During transport. 148.03-7 Section 148.03-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DANGEROUS CARGOES CARRIAGE OF SOLID HAZARDOUS MATERIALS IN BULK Minimum Transportation Requirements § 148.03-7 During transport. During the transport of a...

  9. 45 CFR 2490.141-2490.148 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.141-2490.148 Section 2490.141-2490.148 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.141-2490.148 [Reserved] ...

  10. 45 CFR 148.306 - Basis and scope.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Basis and scope. 148.306 Section 148.306 Public... FOR THE INDIVIDUAL HEALTH INSURANCE MARKET Grants to States for Operation of Qualified High Risk Pools § 148.306 Basis and scope. This subpart implements section 2745 of the Public Health Service Act (PHS...

  11. 19 CFR 148.24 - Determination of dutiable value.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Determination of dutiable value. 148.24 Section... Collection of Duties and Taxes § 148.24 Determination of dutiable value. (a) Principles applied. In determining the dutiable value of articles examined under § 148.23, the Customs inspector shall apply the...

  12. 49 CFR 28.141-28.148 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.141-28.148 Section 28.141-28.148 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.141-28.148 [Reserved] ...

  13. 18 CFR 284.143-284.148 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.143-284.148 Section 284.143-284.148 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... RELATED AUTHORITIES Certain Sales by Intrastate Pipelines §§ 284.143-284.148 [Reserved] ...

  14. Inductively coupled plasma optical emission spectrometry analysis of lanthanum, samarium and gadolinium oxides for rare earths impurities

    International Nuclear Information System (INIS)

    Reino, L.C.P.; Lordello, A.R.

    1990-09-01

    An inductively coupled plasma optical emission spectrometry method is described for the determination of Sm, Eu, La, Gd, Dy, Pr, Ho, Nd, Tb and Y in purified oxides of lanthanum, samarium and gadolinium. The method enables a simple, precise and readily available determination. Dissolution of the samples is achieved with diluted hydrochloric acid (1:1). The solutions are diluted to volume for a concentration of 1mg/ml. The lowest determination limit is 0,01% for most elements and 0,05 or 0,1% for a few rare earths in samarium and gadolinium matrices. Lanthanum, Samarium and Gadolinium concentrates with purity grade of 99,9%, 99,6% and 99,8%, respectively, can be analysed by this procedure. (author)

  15. Synthesis and structure of unprecedented samarium complex with bulky bis-iminopyrrolyl ligand via intramolecular C=N bond activation

    Energy Technology Data Exchange (ETDEWEB)

    Das, Suman; Anga, Srinivas; Harinath, Adimulam; Panda, Tarun K. [Department of Chemistry, Indian Institute of Technology, Hyderabad (India); Pada Nayek, Hari [Department of Applied Chemistry, Indian Institute of Technology, (ISM) Dhanbad, Jharkhand (India)

    2017-12-29

    An unprecedentate samarium complex of the molecular composition [{κ"3-{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N}{κ"3-{(Ph_2CHN=CH)(Ph_2CHNCH)C_4H_2N}Sm}{sub 2}] (2), which was isolated by the reaction of a potassium salt of 2,5-bis{N-(diphenylmethyl)-iminomethyl}pyrrolyl ligand [K(THF){sub 2}{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N] (1) with anhydrous samarium diiodide in THF at 60 C through the in situ reduction of imine bond is presented. The homoleptic samarium complex [[κ{sup 3}-{(Ph_2CH)-N=CH}{sub 2}C{sub 4}H{sub 2}N]{sub 3}Sm] (3) can also be obtained from the reaction of compound 1 with anhydrous samarium triiodide (SmI{sub 3}) in THF at 60 C. The molecular structures of complexes 2 and 3 were established by single-crystal X-ray diffraction analysis. The molecular structure of complex 2 reveals the formation of a C-C bond in the 2,5-bis{N-(diphenylmethyl)iminomethyl}pyrrole ligand moiety (Ph{sub 2}Py{sup -}). However, complex 3 is a homoleptic samarium complex of three bis-iminopyrrolyl ligands. In complex 2, the samarium ion adopts an octahedral arrangement, whereas in complex 3, a distorted three face-centered trigonal prismatic mode of nine coordination is observed around the metal ion. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. X-ray spectrum in the range (6-12) A emitted by laser-produced plasma of samarium

    International Nuclear Information System (INIS)

    Louzon, Einat; Henis, Zohar; Levi, Izhak; Hurvitz, Gilad; Ehrlich, Yosi; Fraenkel, Moshe; Maman, Shlomo; Mandelbaum, Pinchas

    2009-01-01

    A detailed analysis of the x-ray spectrum emitted by laser-produced plasma of samarium (6-12 A) is presented, using ab initio calculations with the HULLAC relativistic code and isoelectronic considerations. Resonance 3d-nf (n=4 to 7), 3p-4d, 3d-4p, and 3p-4s transitions in Ni samarium ions and in neighboring ionization states (from Mn to Zn ions) were identified. The experiment results show changes in the fine details of the plasma spectrum for different laser intensities.

  17. Peculiarities of electronic, phonon and magnon subsystems of lanthanum and samarium tetraborides

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru; Mitroshenkov, N.V.; Matovnikov, A.V.

    2015-10-15

    Experimental research was carried out to study the temperature dependences of heat capacity C{sub p}(T = 2–300 K), lattice parameters a(T), and ≿(T), (5–300 K) of lanthanum and samarium tetraborides. A comparison with data obtained previously for LuB{sub 4} reveals the peculiar influence of lanthanide contraction and the rare-earths mass on the thermodynamic properties of rare earth tetraborides at low and high temperatures. Sharp anomalies were found in the heat capacity and thermal expansion for SmB{sub 4} at T{sub N} = 25.1 K, conditioned by the phase transition into antiferromagnetic state. The more poorly defined heat capacity anomaly around 7 K is referred to the quadrupole orbital fluctuation of the atomic magnetic moments for Sm{sup 3+} ions. The electronic, lattice, and magnetic contributions to the heat capacity and thermal expansion of samarium tetraboride were defined. Our approach makes it possible to adequately approximate the lattice components of heat capacity and thermal expansion by combining the Debye and Einstein contributions, which are based on the joint analysis of calorimetric and X-ray data. The influence of the frustration of the atomic magnetic moment system for Sm{sup 3+} ions on the thermodynamic characteristics of the samarium tetraboride magnetic phase transition was revealed. - Highlights: • The heat capacity and lattice parameters for LaB{sub 4} and SmB{sub 4} were determined at 2–300 K. • The anomalies of C{sub p}(T), a(T), c(T) for SmB{sub 4} due to the phase transition are revealed. • The lattice contributions to the thermal properties of LaB{sub 4} and SmB{sub 4} are analyzed.

  18. Separation of lanthanum from samarium on solid aluminum electrode in LiCl-KCl eutectic melts

    International Nuclear Information System (INIS)

    De-Bin Ji; Mi-Lin Zhang; Xing Li; Xiao-Yan Jing; Wei Han; Yong-De Yan; Yun Xue; Zhi-Jian Zhang; Harbin Engineering University, Harbin

    2015-01-01

    This paper presents an electrochemical study on the separation of lanthanum from samarium on aluminum electrode at 773 K. The results from different electrochemical methods showed that Sm(III) and La(III) formed Al-Sm and Al-La intermetallic compounds on an aluminum electrode at electrode potential around -1.67 and -1.46 V, respectively. The electrochemical separation of lanthanum was carried out in LiCl-KCl-LaCl 3 -SmCl 3 melts on solid aluminum electrodes at 773 K by potentiostatic electrolysis at -1.45 V for 40 h and the separation efficiency was 99.1 %. (author)

  19. Determination of micro amounts of samarium and europium by analogue derivative spectrophotometry

    International Nuclear Information System (INIS)

    Ishii, H.; Satoh, K.

    1982-01-01

    Derivative spectrophotometry using the analogue differentiation circuit was applied to the determination of samarium and europium at ppm levels. By measuring the second or the fourth derivative spectra of the characteristic absorption bands of both the rare earth ions around 400 nm, they can be determined directly and selectively in the presence of large amounts of most other rare earths without any prior separation. Further, aptly selecting conditions for the measurement of the derivative spectra, the simultaneous determination of both the rare earth elements was feasible. The principle and the characteristics of analogue derivative spectrophotometry are also described. (orig.) [de

  20. Evaluation of samarium-153 and holmium-166-EDTMP in the normal baboon model

    Energy Technology Data Exchange (ETDEWEB)

    Louw, W.K.A.; Dormehl, I.C.; Rensburg, A.J. van; Hugo, N.; Alberts, A.S.; Forsyth, O.E.; Beverley, G.; Sweetlove, M.A.; Marais, J.; Loetter, M.G.; Aswegen, A. van

    1996-11-01

    Bone-seeking radiopharmaceuticals such as ethylenediaminetetramethylene phosphonate (EDTMP) complexes of samarium-153 and holmium-166 are receiving considerable attention for therapeutic treatment of bone metastases. In this study, using the baboon experimental model, multicompartmental analysis revealed that with regard to pharmacokinetics, biodistribution, and skeletal localisation, {sup 166}Ho-EDTMP was significantly inferior to {sup 153}Sm-EDTMP and {sup 99m}Tc-MDP. A more suitable {sup 166}Ho-bone-seeking agent should thus be sought for closer similarity to {sup 153}Sm-EDTMP to exploit fully the therapeutic potential of its shorter half-life and more energetic beta radiation.

  1. Body composition analysis by DEXA by using dynamically changing samarium filtration

    DEFF Research Database (Denmark)

    Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

    1997-01-01

    Dual-energy X-ray absorptiometry (DEXA) has a high accuracy for body composition analysis but is influenced by beam hardening and other error sources in the extremes of measurement. To compensate for beam hardening, the Norland XR-36 introduces a dynamically changing samarium filtration system......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

  2. Performance analysis of samarium cobalt P.M. synchronous motor fed from PWM inverters

    International Nuclear Information System (INIS)

    Rahman, M.A.; Choudhury, M.A.

    1985-01-01

    This paper presents an analysis and performance of samarium cobalt permanent magnet (P.M.) synchronous motors fed from two types of voltage source pulse width modulated (PWM) inverters. The analysis and test results on the steady state performance of a P.M. motor fed from PWM inverters are presented. PWM inverters are used in variable voltage variable frequency applications to avoid a double conversion process of ordinary inverters. In drives, they are used for voltage and speed regulation of motors. Use of modulation technique in inverters also allow to eliminate or minimize selected harmonics from the inverter output voltage

  3. GPER mediated estradiol reduces miR-148a to promote HLA-G expression in breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Sifeng, E-mail: taosifeng@aliyun.com; He, Haifei; Chen, Qiang; Yue, Wenjie

    2014-08-15

    Highlights: • E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells. • GPER mediates the E2-induced increase of miR-148a in MCF-7 and MDA-MB-231 cells. • E2-GPER regulates the expression of HLA-G by miR-148a. - Abstract: Breast cancer is the most common malignant diseases in women. miR-148a plays an important role in regulation of cancer cell proliferation and cancer invasion and down-regulation of miR-148a has been reported in both estrogen receptor (ER) positive and triple-negative (TN) breast cancer. However, the regulation mechanism of miR-148a is unclear. The role of estrogen signaling, a signaling pathway is important in development and progression of breast cancer. Therefore, we speculated that E2 may regulate miR-148a through G-protein-coupled estrogen receptor-1 (GPER). To test our hypothesis, we checked the effects of E2 on miR-148a expression in ER positive breast cancer cell MCF-7 and TN cancer cell MDA-MB-231. Then we used GPER inhibitor G15 to investigate whether GPER is involved in regulation of E2 on miR-148a. Furthermore, we analyzed whether E2 affects the expression of HLA-G, which is a miR-148a target gene through GPER. The results showed that E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells, GPER mediates the E2-induced increase in miR-148a expression in MCF-7 and MDA-MB-231 cells and E2-GPER regulates the expression of HLA-G by miR-148a. In conclusion, our findings offer important new insights into the ability of estrogenic GPER signaling to trigger HLA-G expression through inhibiting miR-148a that supports immune evasion in breast cancer.

  4. Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

    Energy Technology Data Exchange (ETDEWEB)

    Essman, Stephanie C. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)], E-mail: essmans@missouri.edu; Lewis, Michael R. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States); Department of Radiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri-Columbia, Columbia, MO 65211 (United States); Research Service, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Fox, Derek B. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)

    2008-02-15

    Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ({sup 153}Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic {sup 153}Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of {sup 153}Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of {sup 153}Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of {sup 153}Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P<.05. Results: Significant differences in lengths of multiple bones were detected between the high-dose group and other treatment groups and controls at each time interval. A significant difference in lengths of the tibias was also noted in the medium-treatment group, compared to controls. Mean reduction of bone length was first detected at 4 months and did not increase significantly over time. Conclusions: These data suggest that clinically significant bone shortening may occur as a result of high-dosage administration of {sup 153}Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted.

  5. Production of SmCo5 alloy by calciothermic reduction of samarium oxide

    International Nuclear Information System (INIS)

    Krishnan, T.S.; Gupta, C.K.

    1988-01-01

    Among the established permanent magnets, SmCo 5 magnet occupies the foremost position as it offers a unique combination of high energy product, coercivity and curie temperature. The SmCo 5 magnets are thus extensively used for high field applications. These are also best suited for use in environments where high demagnetizing field and high temperature are operative. Also, for applications where high performance and miniaturization are the over-riding considerations, the choice again falls on SmCo 5 magnets. The main deterrent to the widespread use of SmCo 5 magnet is its high cost. Both samarium and cobalt metals are high priced, and the magnets prepared from their directly melted alloy are thus naturally very expensive. An alternate process involving calcium reduction of their oxide intermediates has, therefore, been studied and the alloy prepared by this process has been evaluated and found satisfactory for magnet production. The process essentially involves compaction of the charge mix containing samarium oxide, cobalt oxide (or metal) and calcium metal and reduction of the charge compact at 1000-1300 degrees C in hydrogen atmosphere, followed by water and acid leaching, drying and classification

  6. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  7. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  8. Thermomechanical behavior of Fe-Mn-Si-Cr-Ni shape memory alloys modified with samarium

    International Nuclear Information System (INIS)

    Shakoor, R.A.; Khalid, F. Ahmad

    2009-01-01

    The deformation and training behavior of Fe-14Mn-3Si-10Cr-5Ni (wt.%) shape memory alloys containing samarium addition has been studied in the iron-based shape memory alloys. It is noticed that thermomechanical treatment (training) has significant influence on proof stress, critical stress and shape memory behavior of the alloys. The improvement in shape memory behavior can be attributed to the decrease in the proof stress and critical stress which facilitates the formation of ε (hcp martensite). It is also observed that alloy 2 containing samarium undergoes less softening as compared to alloy 1 with training which inhibits the formation of α (bcc martensite) and thus enhances the shape memory behavior. The excessive thermomechanical treatment with increase in the training cycle has led to the formation of α (bcc martensite) along with ε (hcp martensite) in the alloy 1 which appeared to have decline in the shape memory effect. This has been demonstrated by the examination of microstructure and identification of α (bcc martensite) martensite in the alloy 1 as compared to alloy 2

  9. Phase Composition of Samarium Niobate and Tantalate Thin Films Prepared by Sol-Gel Method

    Science.gov (United States)

    Bruncková, H.; Medvecký, Ľ.; Múdra, E.; Kovalčiková, A.; Ďurišin, J.; Šebek, M.; Girman, V.

    2017-12-01

    Samarium niobate SmNbO4 (SNO) and tantalate SmTaO4 (STO) thin films ( 100 nm) were prepared by sol-gel/spin-coating process on alumina substrates with PZT interlayer and annealing at 1000°C. The precursors of films were synthesized using Nb or Ta tartrate complexes. The improvement of the crystallinity of monoclinic M'-SmTaO4 phase via heating was observed through the coexistence of small amounts of tetragonal T-SmTa7O19 phase in STO precursor at 1000°C. The XRD results of SNO and STO films confirmed monoclinic M-SmNbO4 and M'-SmTaO4 phases, respectively, with traces of orthorhombic O-SmNbO4 (in SNO). In STO film, the single monoclinic M'-SmTaO4 phase was revealed. The surface morphology and topography of thin films were investigated by SEM and AFM analysis. STO film was smoother with roughness 3.2 nm in comparison with SNO (6.3 nm). In the microstructure of SNO film, small spherical ( 50 nm) and larger cuboidal particles ( 100 nm) of the SmNbO4 phase were observed. In STO, compact clusters composed of fine spherical SmTaO4 particles ( 20-50 nm) were found. Effect of samarium can contribute to the formation different polymorphs of these films for the application to environmental electrolytic thin film devices.

  10. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  11. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  12. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  13. Neutron Capture and Transmission Measurements and Resonance Parameter Analysis of Samarium

    International Nuclear Information System (INIS)

    Leinweber, G.; Burke, J.A.; Knox, H.D.; Drindak, N.J.; Mesh, D.W.; Haines, W.T.; Ballad, R.V.; Block, R.C.; Slovacek, R.E.; Werner, C.J.; Trbovich, M.J.; Barry, D.P.; Sato, T.

    2001-01-01

    The purpose of the present work is to accurately measure the neutron cross sections of samarium. The most significant isotope is 149 Sm, which has a large neutron absorption cross section at thermal energies and is a 235 U fission product with a 1% yield. Its cross sections are thus of concern to reactor neutronics. Neutron capture and transmission measurements were performed by the time-of-flight technique at the Rensselaer Polytechnic institute (RPI) LINAC facility using metallic and liquid Sm samples. The capture measurements were made at the 25 meter flight station with a multiplicity-type capture detector, and the transmission total cross-section measurements were performed at 15- and 25-meter flight stations with 6 Li glass scintillation detectors. Resonance parameters were determined by a combined analysis of six experiments (three capture and three transmission) using the multi-level R-matrix Bayesian code SAMMY version M2. The significant features of this work are as follows. Dilute samples of samarium nitrate in deuterated water (D 2 O) were prepared to measure the strong resonances at 0.1 and 8 eV without saturation. Disk-shaped spectroscopic quartz cells were obtained with parallel inner surfaces to provide a uniform thickness of solution. The diluent feature of the SAMMY program was used to analyze these data. The SAMMY program also includes multiple scattering corrections to capture yield data and resolution functions specific to the RPI facility. Resonance parameters for all stable isotopes of samarium were deduced for all resonances up to 30 eV. Thermal capture cross-section and capture resonance integral calculations were made using the resultant resonance parameters and were compared to results obtained using resonance parameters from ENDF/B-VI updated through release 3. Extending the definition of the capture resonance integral to include the strong 0.1 eV resonance in 149 Sm, present measurements agree within estimated uncertainties with En

  14. 19 CFR 148.46 - Sale of exempted articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Sale of exempted articles. 148.46 Section 148.46... exempted articles. (a) Sale resulting in forfeiture. The following articles or their value (to be recovered... paragraph (b) of this section is followed: (1) Any jewelry or similar articles of personal adornment having...

  15. 19 CFR 148.53 - Exemption for tools of trade.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Exemption for tools of trade. 148.53 Section 148.53 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... tools of trade. (a) Exemption. Professional books, implements, instruments, or tools of trade...

  16. 19 CFR 148.33 - Articles acquired abroad.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Articles acquired abroad. 148.33 Section 148.33... Articles acquired abroad. (a) Exemption. Each returning resident is entitled to bring in free of duty and..., Harmonized Tariff Schedule of the United States (19 U.S.C. 1202), articles for his personal or household use...

  17. 19 CFR 148.83 - Diplomatic and consular bags.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Diplomatic and consular bags. 148.83 Section 148... bags. (a) Diplomatic bags. The contents of diplomatic bags are restricted to diplomatic documents and articles intended exclusively for official use and packages constituting the diplomatic bag must bear...

  18. 12 CFR 410.141-410.148 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.141-410.148 Section 410.141-410.148 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  19. 27 CFR 24.148 - Penal sums of bonds.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Penal sums of bonds. 24.148 Section 24.148 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Vinegar Plant Bond, TTB F 5510.2 Not less than the tax on all wine on hand, in transit, or unaccounted for...

  20. 34 CFR 303.148 - Transition to preschool programs.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Transition to preschool programs. 303.148 Section 303.148 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND TODDLERS WITH DISABILITIES State...

  1. The systems cerium(3) (samarium) nitrate-quinoline nitrate-water

    International Nuclear Information System (INIS)

    Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

    1982-01-01

    Using the method of cross sections at 25 and 50 deg C the solubility in the systems cerium (3) nitrate-quinoline nitrate-water and samarium nitrate-quinoline nitrate-water has been studied. It is established that in the systems during chemical interaction of components congruently melting compounds of the composition: Ce(NO 3 ) 2 x2[C 9 H 7 NxHNO 3 ]x6H 2 O and Sm(NO 3 ) 3 x2[C 9 H 7 NxHNO 3 ]x2H 2 O are formed. New solid phases are separated preparatively and are subjected to chemical, differential thermal and IR spectroscopic analyses. The investigation results are compared with similar ones for nitrates of other representatives of lanthanide group

  2. The systems lanthanum (cerium, samarium) nitrate-tetramethyl-ammonium nitrate-water

    International Nuclear Information System (INIS)

    Zhuravlev, E.F.; Khisaeva, D.A.; Semenova, Eh.B.

    1984-01-01

    The method of cross sections at 25 and 50 deg C has been applied to study solubility in the systems lanthanum nitrate-tetramethyl ammonium nitrate-water (1), cesium (3) nitrate-tetramethyl ammonium nitrate-water (2) and samarium nitrate-tetramethyl ammonium nitrate-water (3). Crystallization fields of congruently dissolving compounds with 1:3 ratio of salt components (in system 1) and 1:2 ratio (in systems 2 and 3) are found in the systems. New solid phases are separated preparatively and subjected to chemical, differential thermal and IR spectroscopic analyses. Compositions of formed compounds are compared with the compositions known for nitrates of other representatives of light lanthanides

  3. Preparation and biological behaviour of samarium-153-hydroxyapatite particles for radiation synovectomy

    International Nuclear Information System (INIS)

    Agrueelles, M.G.; Luppi Berlanga, I.S.; Torres, E.A.; Rutty Sola, G.A.; Rimoldi, G.

    1998-01-01

    The preparation and labelling procedures of 153 Sm-hydroxyapatite ( 153 Sm-HA) are described in this paper. Hydroxyapatite (HA) was prepared and studied as a radiosynovectomy agent. HA particles were prepared from the reaction of calcium nitrate and ammonia phosphate at high pH Samarium-153 labelling was done in two steps with citric acid. A serie of experimental conditions, such as specific activity, citric acid mass, radioactive solution volume, in-vitro stability, have been carried out. Radiolabelling efficiency was greater than 95%. In vitro studies showed high stability (≥99%). Animal studies showed a good retention in the synovium, with a very low extra-articular leakage over 6 days after administration. (author)

  4. Efficacy and toxicity of Samarium-153-EDTMP locally produced in the treatment of painful skeletal metastases

    International Nuclear Information System (INIS)

    Olea, E.; Quintana, J.C.; Nagel, J.; Arenas, L.; Tomicic, M.; Gil, M.C.; Araya, G.

    2001-01-01

    Samarium-153 emits medium-energy beta particles an a gamma photon with a physical half-life of 46,3 hours. When chelated to ethylenediaminetetramethylenephosphonic acid (EDTMP), it is remarkably stable in vitro and in vivo. In this study we administered randomly 0,5 and 1,0 mCi/Kg body weight (two groups), to 30 patients with painful metastatic bone cancer. Slight and spontaneously reversible myelotoxicity was observed. A bigger leukocyte and platelet suppression was obtained with 1,0 mCi/kg than 0,5 mCi/Kg dose. Pain palliation was obtained in 66% of the treated patients. Our preliminary results indicate that 153 Sm-EDTMP is a promising radiotherapeutic agent for palliative treatment of metastatic bone cancer pain where a reactor is available and at a very affordable cost. (author)

  5. Studies on the structural, optical and dielectric properties of samarium coordinated with salicylic acid single crystal

    Science.gov (United States)

    Singh, Harjinder; Slathia, Goldy; Gupta, Rashmi; Bamzai, K. K.

    2018-04-01

    Samarium coordinated with salicylic acid was successfully grown as a single crystal by low temperature solution technique using mixed solvent of methanol and water in equal ratio. Structural characterization was carried out by single crystal X-ray diffraction analysis and it crystallizes in centrosymmetric space group P121/c1. FTIR and UV-Vis-NIR spectroscopy confirmed the compound formation and help to determine the mode of binding of the ligand to the rare earth-metal ion. Dielectric constant and dielectric loss have been measured over the frequency range 100 Hz - 30MHz. The decrease in dielectric constant with increases in frequency is due to the transition from interfacial polarization to dipolar polarization. The small value of dielectric constant at higher frequency ensures that the crystal is good candidate for NLO devices. Dielectric loss represents the resistive nature of the material.

  6. Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

    International Nuclear Information System (INIS)

    Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

    2008-01-01

    A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

  7. Effect of samarium in corrosion and microstructure of Al-5Zn-0.5Cu as low driving voltage sacrificial anode

    Science.gov (United States)

    Pratesa, Yudha; Ferdian, Deni; Ramadhan, Fajar Yusya; Maulana, Bramuda

    2018-05-01

    Sacrificial Anode Low voltage is the latest generation of the sacrificial anode that can prevent the occurrence of Hydrogen Cracking (HIC) due to overprotection. The Al-5n-0.5Cu alloy showed the potential to be developed as the new sacrificial anode. However, the main problem is copper made Al2Cu intermetallic in grain boundary. Samarium is added to modify the shape of the intermetallic to make it finer and make the corrosion uniform. Several characterizations were conducted to analyze the effect of Samarium. Scanning electron microscope (SEM) and Energy dispersive spectroscopy was used to analyzed the microstructure of the alloy. Metallography preparation was prepared for SEM analysis. Corrosion behavior was characterized by cyclic polarization in 3.5% NaCl solution. The results show samarium can change the shape of intermetallic and refine the grains. In addition, samarium makes better pitting resistance and exhibits a tendency for uniform corrosion. It is indicated by the loop reduction (ΔEpit-prot). Current density increased as an effect of samarium addition from 6x10-5 Ampere (Al-5Zn-0.5Cu) to 2.5x10-4 Ampere (Al-5Zn-0.5Cu-0.5Sm). Steel potential protection increased after addition of samarium which is an indication the possibility of Al-Zn-Cu-Sm to be used as low voltage sacrificial anode.

  8. Myelotoxicity of Samarium Sm153 lexidronam in patients with painful bony metastases

    International Nuclear Information System (INIS)

    Ben Ghachem, T.; Mhiri, A.; Slim, I.; Bahloul, A.; Yeddes, I.; Elbez, I.; Meddeb, I.; Ben Slimene, M.F.

    2015-01-01

    Full text of publication follows. Introduction: the management of bone pain includes analgesia, radiation, hormones, radiofrequency (RF) ablation, chemotherapy, and surgery. Bone pain palliation therapy with radiopharmaceuticals is a cost-effective systemic therapy to relieve pain from skeletal metastases with a consequent decrease in morbidity and an improvement in quality of life. The aim of our study is to evaluate the effect of myelotoxicity of samarium lexidronam (Sm 153 ) in patients with painful bony metastasis. Methods: we reviewed 116 patients aged from 14 to 87 years old, 91 males (78%) and 25 females (22%), having received 1 to 4 treatments of Sm 153 (37 MBq/kg) for painful bony metastases from different primitive tumors: 67 cases of prostate cancer (57.7%), 22 cases of breast cancer (18.9%), 10 cases of pulmonary cancer (8.6%) and others in 14.6% of cases. Clinical follow-up was available for 159 treatments, consisting on blood count each week over at least two months, in order to evaluate myelotoxicity according to WHO classification. Results: no patients had grade 4 toxicity after its cures. A grade 2-3 myelotoxicity was observed after 52 treatments (34%) during the second week and after 50 treatments (32.6%) during the fourth week with a satisfactory reversibility. At 10 weeks of treatment, myelotoxicity was reclassified from 0 to 2 for 139 cures (90,8%). Moreover, we found that prior treatment with radiotherapy or chemotherapy did not affect the rates of myelotoxicity. Conclusion: multiple treatments with samarium Sm 153 lexidronam had no significant effect on myelotoxicity. Patients with bone predominant metastatic disease may survive for extended periods of time and may safely be treated with multiple modalities of therapy. (authors)

  9. Transport calculations for a 14.8 MeV neutron beam in a water phantom

    International Nuclear Information System (INIS)

    Goetsch, S.J.

    1981-01-01

    A coupled neutron/photon Monte Carlo radiation transport code (MORSE-CG) has been used to calculate neutron and photon doses in a water phantom irradiated by 14.8 MeV neutrons from the Gas Target Neutron Source. The source-collimator-phantom geometry was carefully simulated. Results of calculations utilizing two different statistical estimators (next-collision and track-length) are presented

  10. miR-148a-3p Mediates Notch Signaling to Promote the Differentiation and M1 Activation of Macrophages

    Directory of Open Access Journals (Sweden)

    Fei Huang

    2017-10-01

    Full Text Available The Notch pathway plays critical roles in the differentiation and polarized activation of macrophages; however, the downstream molecular mechanisms underlying Notch activity in macrophages remain elusive. Our previous study has identified a group of microRNAs that mediate Notch signaling to regulate macrophage activation and tumor-associated macrophages (TAMs. In this study, we demonstrated that miR-148a-3p functions as a novel downstream molecule of Notch signaling to promote the differentiation of monocytes into macrophages in the presence of granulocyte macrophage colony-stimulating factor (GM-CSF. Meanwhile, miR-148a-3p promoted M1 and inhibited M2 polarization of macrophages upon Notch activation. Macrophages overexpressing miR-148a-3p exhibited enhanced ability to engulf and kill bacteria, which was mediated by excessive production of reactive oxygen species (ROS. Further studies using reporter assay and Western blotting identified Pten as a direct target gene of miR-148a-3p in macrophages. Macrophages overexpressing miR-148a-3p increased their ROS production through the PTEN/AKT pathway, likely to defend against bacterial invasion. Moreover, miR-148a-3p also enhanced M1 macrophage polarization and pro-inflammatory responses through PTEN/AKT-mediated upregulation of NF-κB signaling. In summary, our data establish a novel molecular mechanism by which Notch signaling promotes monocyte differentiation and M1 macrophage activation through miR-148a-3p, and suggest that miR-148a-3p-modified monocytes or macrophages are potential new tools for the treatment of inflammation-related diseases.

  11. MicroRNA-148b is frequently down-regulated in gastric cancer and acts as a tumor suppressor by inhibiting cell proliferation

    Directory of Open Access Journals (Sweden)

    Jiang Li

    2011-01-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are involved in cancer development and progression, acting as tumor suppressors or oncogenes. Our previous studies have revealed that miR-148a and miR-152 are significantly down-regulated in gastrointestinal cancers. Interestingly, miR-148b has the same "seed sequences" as miR-148a and miR-152. Although aberrant expression of miR-148b has been observed in several types of cancer, its pathophysiologic role and relevance to tumorigenesis are still largely unknown. The purpose of this study was to elucidate the molecular mechanisms by which miR-148b acts as a tumor suppressor in gastric cancer. Results We showed significant down-regulation of miR-148b in 106 gastric cancer tissues and four gastric cancer cell lines, compared with their non-tumor counterparts by real-time RT-PCR. In situ hybridization of ten cases confirmed an overt decrease in the level of miR-148b in gastric cancer tissues. Moreover, the expression of miR-148b was demonstrated to be associated with tumor size (P = 0.027 by a Mann-Whitney U test. We also found that miR-148b could inhibit cell proliferation in vitro by MTT assay, growth curves and an anchorage-independent growth assay in MGC-803, SGC-7901, BGC-823 and AGS cells. An experiment in nude mice revealed that miR-148b could suppress tumorigenicity in vivo. Using a luciferase activity assay and western blot, CCKBR was identified as a target of miR-148b in cells. Moreover, an obvious inverse correlation was observed between the expression of CCKBR protein and miR-148b in 49 pairs of tissues (P = 0.002, Spearman's correlation. Conclusions These findings provide important evidence that miR-148b targets CCKBR and is significant in suppressing gastric cancer cell growth. Maybe miR-148b would become a potential biomarker and therapeutic target against gastric cancer.

  12. Potentiometric study of samarium oxides formation from its chloride in a molten eutectic mixture of sodium and cesium chlorides

    International Nuclear Information System (INIS)

    Smolenskij, V.V.; Bove, A.L.; Del'mukhamedov, R.D.; Borodina, N.P.; Gavrilov, A.G.

    1997-01-01

    Interaction of trivalent samarium cations with oxide-ions in NaCl-2CsCl melt at 973 K has been studied by potentiometric method using electrochemical cell with two platinum-oxygen electrodes with a solid electrolyte membrane. The mechanism of the interaction and composition of the reaction products, depending on the medium oxyacidity, have been considered. Certain thermodynamic characteristics of the process have been calculated

  13. 7 CFR 1260.148 - Compensation and reimbursement.

    Science.gov (United States)

    2010-01-01

    ....148 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Cattlemen's Beef Promotion and Research Board...

  14. Smurf1 Inhibits Osteoblast Differentiation, Bone Formation, and Glucose Homeostasis through Serine 148

    Directory of Open Access Journals (Sweden)

    Junko Shimazu

    2016-04-01

    Full Text Available The E3 ubiquitin ligase Smurf1 targets the master regulator of osteoblast differentiation, Runx2, for degradation, yet the function of Smurf1, if any, during osteoblast differentiation in vivo is ill defined. Here, we show that Smurf1 prevents osteoblast differentiation by decreasing Runx2 accumulation in osteoblasts. Remarkably, mice harboring a substitution mutation at serine 148 (S148 in Smurf1 that prevents its phosphorylation by AMPK (Smurf1ki/ki display a premature osteoblast differentiation phenotype that is equally severe as that of Smurf1−/− mice, as well as a high bone mass, and are also hyperinsulinemic and hypoglycemic. Consistent with the fact that Smurf1 targets the insulin receptor for degradation, there is, in Smurf1ki/ki mice, an increase in insulin signaling in osteoblasts that triggers a rise in the circulating levels of osteocalcin, a hormone that favors insulin secretion. These results identify Smurf1 as a determinant of osteoblast differentiation during the development of bone formation and glucose homeostasis post-natally and demonstrate the necessity of S148 for these functions.

  15. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  16. Fluorometric determination of samarium and europium in rare earth minerals with. beta. -diketoneternary complex

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-07-01

    This communication reported the optimum conditions for the fluorometric determination of these ions, and the method was adopted in the simultaneous determination of samarium and europium in xenotime and monazite minerals. From the experimental results on the effect of diverse ions and the extraction pH of the aqueous phase, it became clear that TTA-TOPO hexane method was the best system for the determination of samarium and europium because of the highest fluorescence sensitivity of the ternary complex, and also because the lower extraction pH eliminated the effect of diverse ions. Moreover, the very high detection limit (2 ppb) of Sm was achieved by the use of a red sensitive photomultiplier. Which was used at 644 nm, and that of Eu (0.02 ppb) at 614 nm. The procedure was established as follows: The rare earth minerals (xenotime, monazite) sample was treated with hot conc. H/sub 2/SO/sub 4/ and twice precipitated with 0.5 mol dm/sup -3/ oxalic acid (pH was adjusted to 2.0 -- 2.2). Then the precipitate was filtered and ignited to give the rare earth oxide. Fifty milligrams of the oxide was dissolved in HCl and diluted with water in order to obtain the solution containing 5 ..mu..g cm/sup -3/ rare earth oxide. An aliquot of the solution ((1.0 -- 3.0) cm/sup 3/) was adjusted to pH 5.5 with sodium acetate and shaken with 1 x 10/sup -4/ mol dm/sup -3/ TTA- 2 x 10/sup -2/ mol dm/sup -3/ TOPO hexane solution. Then the fluorescence intensity of the organic layer was measured at 644 nm for Sm and 614 nm for Eu. In this procedure, the recovery of Sm and Eu was found to be about 96%. Xenotime contained 0.70% of Sm and 0.004% of Eu, and monazite contained 1.84% of Sm and 0.003% of Eu.

  17. Solar Hydrogen Production via a Samarium Oxide-Based Thermochemical Water Splitting Cycle

    Directory of Open Access Journals (Sweden)

    Rahul Bhosale

    2016-04-01

    Full Text Available The computational thermodynamic analysis of a samarium oxide-based two-step solar thermochemical water splitting cycle is reported. The analysis is performed using HSC chemistry software and databases. The first (solar-based step drives the thermal reduction of Sm2O3 into Sm and O2. The second (non-solar step corresponds to the production of H2 via a water splitting reaction and the oxidation of Sm to Sm2O3. The equilibrium thermodynamic compositions related to the thermal reduction and water splitting steps are determined. The effect of oxygen partial pressure in the inert flushing gas on the thermal reduction temperature (TH is examined. An analysis based on the second law of thermodynamics is performed to determine the cycle efficiency (ηcycle and solar-to-fuel energy conversion efficiency (ηsolar−to−fuel attainable with and without heat recuperation. The results indicate that ηcycle and ηsolar−to−fuel both increase with decreasing TH, due to the reduction in oxygen partial pressure in the inert flushing gas. Furthermore, the recuperation of heat for the operation of the cycle significantly improves the solar reactor efficiency. For instance, in the case where TH = 2280 K, ηcycle = 24.4% and ηsolar−to−fuel = 29.5% (without heat recuperation, while ηcycle = 31.3% and ηsolar−to−fuel = 37.8% (with 40% heat recuperation.

  18. Charge and transition densities of samarium isotopes in the interacting Boson model

    International Nuclear Information System (INIS)

    Moinester, M.A.; Alster, J.; Dieperink, A.E.L.

    1982-01-01

    The interacting boson approximation (IBA) model has been used to interpret the ground-state charge distributions and lowest 2 + transition charge densities of the even samarium isotopes for A = 144-154. Phenomenological boson transition densities associated with the nucleons comprising the s-and d-bosons of the IBA were determined via a least squares fit analysis of charge and transition densities in the Sm isotopes. The application of these boson trasition densities to higher excited 0 + and 2 + states of Sm, and to 0 + and 2 + transitions in neighboring nuclei, such as Nd and Gd, is described. IBA predictions for the transition densities of the three lowest 2 + levels of 154 Gd are given and compared to theoretical transition densities based on Hartree-Fock calculations. The deduced quadrupole boson transition densities are in fair agreement with densities derived previously from 150 Nd data. It is also shown how certain moments of the best fit boson transition densities can simply and sucessfully describe rms radii, isomer shifts, B(E2) strengths, and transition radii for the Sm isotopes. (orig.)

  19. Enhancement of the fluorescence of the samarium (III) complex by gadolinium (III)

    International Nuclear Information System (INIS)

    Yun-Xiang, C.; Zhang-Hua, L.

    1988-01-01

    The increase in sensitivity and selectivity of reactions in which colored species are formed by the addition of different metal ions is an area of research that has recently been developed. This phenomenon, which is sometimes called cocolaration effect, has been explained by the formation of mixed metal complex. The authors found an analogous phenomenon of reactions forming fluorescent complexes. The complexes of Sm(III)-thenoyltrifluoroacetone (TTA)-phenanthroline (Phen)-Triton-X-100 (TX-100) and Gd(III) (or La(III), Lu(III) and Y(III))-TTA-Phen-TX-100 had practically no fluorescence separately. Instead, a fluorescence-enhancement phenomenon caused by adding Gd or La, Lu and Y ions to the system was observed for the first time. The intensity of the enhanced fluorescence of Sm(III) complex was increased in the following order: La< Y< Lu< Gd. By analogy with cocoloration effect, the authors call this new fluorescence-enhancement phenomenon the co-fluorescence effect. The object of this work was to study the enhancement effect of Gd(III) on the fluorescence of the Sm(III)-TTA-Phen-TX-100 system. The recommended fluorimetric method has been applied to the determination of trace amounts of samarium in ytterbium oxide with satisfactory results. A general reaction mechanism for the system studied was proposed

  20. Pharmacokinetics of labelled compounds with technetium-99m and samarium-153

    International Nuclear Information System (INIS)

    Borda O, L.B.; Torres L, M.N.

    1997-01-01

    The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa

  1. Memory effect of calcined layered samarium hydroxy chlorides in aqueous solution

    International Nuclear Information System (INIS)

    Lee, Byung Il; Byeon, Song Ho

    2015-01-01

    The decomposition and recovery behavior of layered samarium hydroxychloride (Sm 2 (OH) 5 Cl·nH 2 O, LSmH) has been closely studied in various conditions. Although the heat treatment of LSmH at 700 °C completely collapsed typical layered structure, the calcined LSmH (c-LSmH) recovered its layered characteristics and consequently its ability to intercalate anions into the interlayer space when it was rehydroxylated and rehydrated in aqueous solutions containing organic and inorganic anions. This phenomenon is similar to the memory effect observed in classical layered double hydroxides (LDHs), where LDHs calcined to a mixture of metal oxides can recover their layered structures in aqueous solutions. In contrast, the recovery reaction of c-LSmH in water without any counter anions was unsuccessful and instead resulted in the formation of Sm(OH) 3 . Such a difference was interpreted on the basis of the salt effect on Sm 2 (OH) 5 Cl·nH 2 O–Sm(OH) 3 phase equilibria in water

  2. Characterization of luminescent samarium doped HfO2 coatings synthesized by spray pyrolysis technique

    International Nuclear Information System (INIS)

    Chacon-Roa, C; Guzman-Mendoza, J; Aguilar-Frutis, M; Garcia-Hipolito, M; Alvarez-Fragoso, O; Falcony, C

    2008-01-01

    Trivalent samarium (Sm 3+ ) doped hafnium oxide (HfO 2 ) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO 2 monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO 2 : SmCl 3 films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm 3+ ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed

  3. Effect of Zinc Oxide Doping on Electroluminescence and Electrical Behavior of Metalloporphyrins-Doped Samarium Complex

    Science.gov (United States)

    Janghouri, Mohammad; Amini, Mostafa M.

    2018-02-01

    Samarium complex [(Sm(III)] as a new host material was used for preparation of red organic light-emitting diodes (OLEDs). Devices with configurations of indium-doped tin oxide (ITO)/poly(3,4-ethylenedioxythiophene):(poly(styrenesulfonate) (PEDOT:PSS (50 nm)/polyvinyl carbazole (PVK):[zinc oxide (ZnO)] (50 nm)/[(Sm(III)]:[zinc(II) 2,3-tetrakis(dihydroxyphenyl)-porphyrin and Pt(II) 2,3-dimethoxyporphyrin] (60 nm)/2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) (15 nm)/Al (150 nm) have been fabricated and investigated. An electroplex occurring at the (PVK/Sm: Pt(II) 2,3-dimethoxyporphyrin) interface has been suggested when ZnO nanoparticles were doped in PVK. OLED studies have revealed that the photophysical characteristics and electrical behavior of devices with ZnO nanoparticles are much better than those of devices with pure PVK. The efficiency of devices based on [(Sm(III)] was superior than that of known aluminum tris(8-hydroxyquinoline) (Alq3) and also our earlier reports on red OLEDs under the same conditions.

  4. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  5. Detonation nanodiamond introduced into samarium doped ceria electrolyte improving performance of solid oxide fuel cell

    Science.gov (United States)

    Pei, Kai; Li, Hongdong; Zou, Guangtian; Yu, Richeng; Zhao, Haofei; Shen, Xi; Wang, Liying; Song, Yanpeng; Qiu, Dongchao

    2017-02-01

    A novel electrolyte materials of introducing detonation nanodiamond (DNDs) into samarium doped ceria (SDC) is reported here. 1%wt. DNDs doping SDC (named SDC/ND) can enlarge the electrotyle grain size and change the valence of partial ceria. DNDs provide the widen channel to accelerate the mobility of oxygen ions in electrolyte. Larger grain size means that oxygen ions move easier in electrolyte, it can also reduce the alternating current (AC) impedance spectra of internal grains. The lower valence of partial Ce provides more oxygen vacancies to enhance mobility rate of oxygen ions. Hence all of them enhance the transportation of oxygen ions in SDC/ND electrolyte and the OCV. Ultimately the power density of SOFC can reach 762 mw cm-2 at 800 °C (twice higher than pure SDC, which is 319 mw cm-2 at 800 °C), and it remains high power density in the intermediate temperature (600-800 °C). It is relatively high for the electrolyte supported (300 μm) cells.

  6. miRNA-148a regulates the expression of the estrogen receptor through DNMT1-mediated DNA methylation in breast cancer cells

    Science.gov (United States)

    Xu, Yurui; Chao, Lin; Wang, Jianyu; Sun, Yonghong

    2017-01-01

    Breast cancer remains the most prevalent cancer among women worldwide. The expression of estrogen receptor-α (ER-α) is an important marker for prognosis. ER-α status may be positive or negative in breast cancer cells, although the cause of negative or positive status is not yet fully characterized. In the present study, the expression of ER-α and miRNA-148a was assessed in two breast cancer cell lines, HCC1937 and MCF7. An association between ER-α and miRNA-148a expression was identified. It was then demonstrated that DNA methyltransferase 1 (DNMT1) is a target of miRNA-148a, which may suppress the expression of ER-α via DNA methylation. Finally, an miRNA-148a mimic or inhibitor was transfected into MCF7 cells; the miRNA-148a mimic increased ER-α expression whereas the miRNA-148a inhibitor decreased ER-α expression. In conclusion, it was identified that miRNA-148a regulates ER-α expression through DNMT1-mediated DNA methylation in breast cancer cells. This may represent a potential miRNA-based strategy to modulate the expression of ER-α and provide a novel perspective for investigating the role of miRNAs in treating breast cancer. PMID:29085474

  7. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues

    International Nuclear Information System (INIS)

    Garcia G, N.

    2006-01-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH PCN ) and density of surface sites (D s ). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  8. 19 CFR 148.111 - Written declaration for unaccompanied articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Written declaration for unaccompanied articles... of the United States § 148.111 Written declaration for unaccompanied articles. The baggage... covers articles which do not accompany him and: (a) The articles are entitled to free entry under the $1...

  9. 45 CFR 148.316 - Grant application instructions.

    Science.gov (United States)

    2010-10-01

    ... in § 148.310(d)). (3) Bonus grants for supplemental consumer benefits. Provide detailed information about the following supplemental consumer benefits for which the entity is applying: (i) A narrative description of one or more of the following of the supplemental consumer benefits to be provided to enrollees...

  10. 19 CFR 148.31 - Effects taken abroad.

    Science.gov (United States)

    2010-04-01

    ... such personal or household effect taken abroad has been advanced in value or improved in condition... TREASURY (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Exemptions for Returning Residents § 148.31.... 1202), all personal and household effects taken abroad. To ensure allowance of the exemption, articles...

  11. 19 CFR 148.102 - Flat rate of duty.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Noncommercial Importations of Limited Value § 148.102 Flat... fair retail value in the country of acquisition. (b) American Samoa, Guam, the Northern Mariana Islands..., effective January 1, 2001, and 1.5 percent, effective January 1, 2002, of the fair retail value in the...

  12. 33 CFR 157.148 - COW system: Evidence for inspections.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false COW system: Evidence for... CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Inspections § 157.148 COW system... inspector evidence that the COW system has been installed in accordance with the plans accepted under § 157...

  13. 75 FR 2894 - Withdrawal of Regulatory Guide 1.148

    Science.gov (United States)

    2010-01-19

    ... downloading through the NRC's public Web site under ``Regulatory Guides'' in the NRC's Electronic Reading Room at http://www.nrc.gov/reading-rm/doc-collections . Regulatory guides are also available for... NUCLEAR REGULATORY COMMISSION [NRC-2010-0013] Withdrawal of Regulatory Guide 1.148 AGENCY: Nuclear...

  14. 33 CFR 148.300 - What does this subpart concern?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What does this subpart concern... (CONTINUED) DEEPWATER PORTS DEEPWATER PORTS: GENERAL Licenses § 148.300 What does this subpart concern? This subpart concerns the license for a deepwater port and the procedures for transferring, amending...

  15. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  16. Study of samarium modified lead zirconate titanate and nickel zinc ferrite composite system

    Energy Technology Data Exchange (ETDEWEB)

    Rani, Rekha [Department of Physics, SD PG College, Panipat 132103 (India); School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Juneja, J.K., E-mail: jk_juneja@yahoo.com [Department of Physics, Hindu College, Sonepat 131001 (India); Singh, Sangeeta [Department of Physics, GVM Girls College, Sonepat 131001 (India); Raina, K.K. [School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Prakash, Chandra [Solid State Physics Laboratory, Timarpur, Delhi 110054 (India)

    2015-03-15

    In the present work, composites of samarium substituted lead zirconate titanate and nickel zinc ferrite with compositional formula 0.95Pb{sub 1−3x/2} Sm{sub x}Zr{sub 0.65}Ti{sub 0.35}O{sub 3}–0.05Ni{sub 0.8}Zn{sub 0.2}Fe{sub 2}O{sub 4} (x=0, 0.01, 0.02 and 0.03) were prepared by the conventional solid state route. X-ray diffraction analysis was carried out to confirm the coexistence of individual phases. Microstructural study was done by using scanning electron microscope. Dielectric constant and loss were studied as a function of temperature and frequency. To study ferroelectric and magnetic properties of the composite samples, corresponding P–E and M–H hysteresis loops were recorded. Change in magnetic properties of electrically poled composite sample (x=0.02) was studied to confirm the magnetoelectric (ME) coupling. ME coefficient (dE/dH) of the samples (x=0 and 0.02) was measured as a function of DC magnetic field. - Highlights: • We are reporting the effect of Sm substitution on PZT–NiZn ferrite composites. • Observation of both P–E and M–H loops confirms ferroelectric and magnetic ordering. • With Sm substitution, significant improvement in properties was observed. • Increase in magnetization for electrically poled sample is evidence of ME coupling. • Electric polarization is generated by applying magnetic field.

  17. The effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases

    International Nuclear Information System (INIS)

    Ma Yubo; Huang Gang; Liu Jianjun

    2004-01-01

    Objectives: To evaluate the effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases. Methods: 380 patients with bone metastases were studied (221 men, 159 women; average age 65.3 y; ranged 27-91 y; average weight 59.3 kg, ranged 39-95 kg). The tumor types were prostate carcinoma (n=155), pulmonary carcinoma (n=92), breast cancer (n=57), gastric carcinoma (n=12), colorectal carcinoma (n=22), nasopharyngeal carcinoma (n=8), lymphoma (n=8), hepatic carcinoma (n=6), ovary carcinoma (n=4) and others (n=16). All patients were received 135Sm-EDTMP 0.8 or 1.0 mCi/kg during 1 to 7 course of treatment. Patients and physician evaluations were used to assess pain relief. Numbers of metastatic foci and activity of ROIs were used to observe post-therapy change in bone scanning. Results: In 380 patients, pain relief was observed in 257 patients (67.6%). Persistence of pain relief was seen through 2 to 24 weeks. The mean relief time is 5.8±3.4 weeks. KPS score was higher 10% than pre-therapy (71.2%±9.6% Vs 80.9%±10.3%, p<0.001). Numbers of metastatic foci (11.2+8.8 Vs 8.4±5.7, p<0.001) and activity of ROIs (3.28±2.04 Vs 2.15±0.94, p<0.01) were less than pre-therapy. Bone marrow suppression was mild and reversible (5.87±1.56 Vs 4.94±1.16 x 109/L). Conclusions: 153Sm-EDTMP provided relief of pain associated with bone metastases and inhibition of metastatic foci. As a relief drug of painful bone metastases, 153Sm-EDTMP is safe and effective. (authors)

  18. Graphite furnace atomic absorption spectrometry with a tantalum boat for the determination of yttrium, samarium, and dysprosium in a mish metal

    International Nuclear Information System (INIS)

    Daidoji, Hidehiro; Tamura, Shohei

    1982-01-01

    The determination of yttrium, samarium, and dysprodium by means of graphite-furnace atomic absorption spectrometry (AAS) was studied by a tantalum boat inserted into a graphite tube atomizer. These elements could not be determined by the use of a commercial graphite tube, In the atomization from a tantalum boat, better analytical sensitivities and negligible memory effects for these rare earths are obtained. The analytical sensitivities of yttrium, samarium, and dysprodium with the tantalum boat were 0.60 ng, 0.86 ng, and 0.17 ng respectively. This method was applied for the determination of yttrium, samarium, and dysprosium in a mish metal. The measurements were performed with slightly acidified solutions (0.01 mol dm 3 HCI or HNO 3 ). The sensitivities and the precisions for these elements decreased with increasing acid concentration. An enhancement in the sensitivities of yttrium and dysprosium upon the addition of a large excess of lanthanum, neodymium, and praseodymium salts were observed. The yttrium, samarium, and dysprosium in a mish metal were determined with both analytical curves of standard solutions containing an excess of lanthanum, cerium, and neodymium ions and of the standard addition. The precisions for this work were in the 3 - 9.3% range. (author)

  19. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 ke...

  20. ’n Eko-billike beoordeling van Psalm 148

    Directory of Open Access Journals (Sweden)

    H. Viviers

    2004-12-01

    Eco-justness determines whether the earth and her inhabitants are treated in their own right as subjects, and not only as objects to be acted upon. At first glance it seems as if Psalm 148 is eco-just. The poet encompasses all of creation in this hymn of praise to Yahweh. However, it does not pass the test of eco-justness. Many (older commentators go along with the male ideological thrust of the psalm, without questioning the maleness of Yahweh. The construct of Yahweh as the “super” male, symbolising Israel’s success as a nation, is not good news for eco-sensitivity and eco-responsibility. Female earth becomes very vulnerable within this shaping of society always aimed at serving male hegemony, values and interests. To uncritically reinscribe Psalm 148’s androcentric, ideological stance will simultaneously lead to an impoverishment and a one dimensional view of life in general.

  1. Evaluation of n + 144,148,154Sm reaction data

    International Nuclear Information System (INIS)

    Ming Jianchuan; Zhuang Youxiang

    2000-01-01

    The neutron cross section data were evaluated for n + 144,148,154 Sm reaction in the energy range 10 -5 eV to 20 MeV. Spline function was used in the experimental data fit calculation. The corresponding JENDL-3 data are accepted in the energy range of 0.025 to 100 Kev. The comparisons among calculation data and experimental data, JENDL-3 data ENDF/B-6 data are presented

  2. An estimation of influence of humic acid and organic matter originated from bentonite on samarium solubility

    International Nuclear Information System (INIS)

    Kanaji, Mariko; Sato, Haruo; Sasahira, Akira

    1999-10-01

    Organic acids in groundwater are considered to form complexes and increase the solubility of radionuclides released from vitrified waste in a high-level radioactive waste (HLW) repository. To investigate whether the solubility of samarium (Sm) is influenced by organic substances, we measured Sm solubility in the presence of different organic substances and compared those values with results from thermodynamic predictions. Humic acid (Aldrich) is commercially available and soluble organic matter originated from bentonite were used as organic substances in this study. Consequently, the solubility of Sm showed a tendency to apparently increase with increasing the concentration of humic acid, but in the presence of carbonate, thermodynamic predictions suggested that the dominant species are carbonate complexes and that the effect of organic substances are less than that of carbonate. Based on total organic carbon (TOC), the increase of Sm solubility measured with humic acid (Aldrich) was more significant than that in the case with soluble organic matter originated from bentonite. Since bentonite is presumed to include also simple organic matters of which stability constant for forming complexes is low, the effect of soluble organic matter originated from bentonite on the solubility of Sm is considered to be less effective than that of humic acid (Aldrich). Experimental values were compared with model prediction, proposed by Kim, based on data measured in a low pH region. Tentatively we calculated the increase in Sm solubility assuming complexation with humic acid. Trial calculations were carried out on the premise that the complexation reaction of metal ion with humic acid is based on neutralization process by 1-1 complexation. In this process, it was assumed that one metal ion coordinates with one unit of complexation sites which number of proton exchange sites is equal to ionic charge. Consequently, Kim's model indicated that carbonate complexes should be dominant

  3. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  4. Fluorescence properties of europium and samarium. beta. -diketonates and their use in fluorometry

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

    1981-01-01

    Several europium and samarium ..beta..-diketonates (tta, ntfa, bfa) complexed with 1, 10-phenanthroline, or with trioctylphosphine oxide (topo) were synthesized. The fluorescence properties of these compounds in benzene or hexane have been studied. Absorption and fluorescence spectra, fluorescence quantum yield, fluorescence sensitivity index (F.S.I.), and fluorescence lifetime were measured. From the measurement of fluorescence lifetime of the ..beta..-diketonates, the velocity of radiative process (k sub(f)/phi sub(f)) has almost the same value for benzene and hexane solvent. The red fluorescence (Em. max. : 619 nm) of Eu(III) in these chelates is attributed to transitions from /sup 5/D/sub 0/ ..-->.. /sup 7/F/sub 2/ levels of this ion, and the three-band spectrum (Em. max. : 569 nm, 606 nm, 650 nm) indicates the transitions from the /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(5/2), /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(7/2), and /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(9/2) levels of Sm(III), respectively. These spectra are not changed by any solvents and ligands. From the results, the fluorescence of the ..beta..-diketonates in organic solvent has been attributed to m* ..-->.. m luminescence transition. The complexes of Eu(III) and Sm(III) show radiative transition within orbitals, composed exclusively of 4f orbitals of rare earth ions (m* ..-->.. m radiative transition). Fluorinated ligands show better sensitivity than unfluorinated ligands, and the best sensitivity is obtained with TTA-phen system, and/or TTA-topo system for the spectrofluorometric determination of the two metals. In the case of Eu determination, 619 nm emission wavelength is used (the determinable range : 0.2 -- 10 ppb Eu), and in the case of Sm determination, 650 nm emission wavelength is adopted (the determinable range : 0.1 -- 1 ppm Sm), because of much higher sensitivity than the other two peaks (569, 606 nm) without interference from europium complex.

  5. 25 CFR 170.148 - What is a tribal transit program?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is a tribal transit program? 170.148 Section 170.148... PROGRAM Indian Reservation Roads Program Policy and Eligibility Transit Facilities § 170.148 What is a tribal transit program? A tribal transit program is the planning, administration, acquisition, and...

  6. 47 CFR 25.148 - Licensing provisions for the Direct Broadcast Satellite Service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions for the Direct Broadcast Satellite Service. 25.148 Section 25.148 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses Space Stations § 25.148...

  7. 33 CFR 148.730 - What are the land use and coastal zone management criteria?

    Science.gov (United States)

    2010-07-01

    ... Criteria for Deepwater Ports § 148.730 What are the land use and coastal zone management criteria? In... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What are the land use and coastal zone management criteria? 148.730 Section 148.730 Navigation and Navigable Waters COAST GUARD...

  8. 33 CFR 148.217 - How can a State be designated as an adjacent coastal State?

    Science.gov (United States)

    2010-07-01

    ... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD... General § 148.217 How can a State be designated as an adjacent coastal State? (a) Adjacent coastal States... as an adjacent coastal State in the notice may request to be designated as one if the environmental...

  9. 19 CFR 148.15 - Inclusion of articles not for personal or household use.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Inclusion of articles not for personal or household use. 148.15 Section 148.15 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... § 148.15 Inclusion of articles not for personal or household use. Articles not personal in character, or...

  10. 19 CFR 148.3 - Customs treatment after transiting the Panama Canal.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Customs treatment after transiting the Panama Canal. 148.3 Section 148.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... § 148.3 Customs treatment after transiting the Panama Canal. Passengers' baggage and effects and...

  11. 46 CFR 148.04-21 - Coconut meal pellets (also known as copra pellets).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Coconut meal pellets (also known as copra pellets). 148.04-21 Section 148.04-21 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DANGEROUS... § 148.04-21 Coconut meal pellets (also known as copra pellets). (a) Coconut meal pellets; (1) Must...

  12. 46 CFR 148.04-15 - Petroleum coke, uncalcined; petroleum coke, uncalcined and calcined (mixture).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Petroleum coke, uncalcined; petroleum coke, uncalcined and calcined (mixture). 148.04-15 Section 148.04-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND... Requirements for Certain Material § 148.04-15 Petroleum coke, uncalcined; petroleum coke, uncalcined and...

  13. 40 CFR 267.148 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 267.148 Section 267.148 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Financial Requirements § 267.148 Incapacity of owners or operators, guarantors, or financial institutions. (a) An owner or operator must notify the Regional...

  14. 40 CFR 264.148 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 264.148 Section 264.148 Protection of Environment ENVIRONMENTAL... TREATMENT, STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 264.148 Incapacity of owners or operators, guarantors, or financial institutions. (a) An owner or operator must notify the Regional...

  15. 40 CFR 265.148 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 265.148 Section 265.148 Protection of Environment ENVIRONMENTAL... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Financial Requirements § 265.148 Incapacity of owners or operators, guarantors, or financial institutions. (a) An owner or operator must notify the...

  16. 27 CFR 20.148 - Manufacture of articles with completely denatured alcohol.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Manufacture of articles with completely denatured alcohol. 20.148 Section 20.148 Alcohol, Tobacco Products and Firearms ALCOHOL... ALCOHOL AND RUM Sale and Use of Completely Denatured Alcohol § 20.148 Manufacture of articles with...

  17. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS)

    International Nuclear Information System (INIS)

    Kaempfer, Tino

    2009-01-01

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [de

  18. Thermodynamics of coproportionation reactions of homogeneous samarium (3) and yttrium (3) nitrates solvates with neutral organic phosphorus compounds

    International Nuclear Information System (INIS)

    Pyartman, A.K.

    1995-01-01

    Reaction heats of homogeneous samarium (3) and yttrium (3) nitrate solvates coproportionation with neutral organophosphoric compounds (tri-n.-butylphosphate, diisooctylmethylphosphonate, diisoamylmethylphosphonate) at T=298.15 K in hexane have been measured by thermochemical method. It has been ascertained that enthalpies of coproportionation reactions practically do not depend on the nature, concentration of rare earth metal (3) nitrate solvates in hexane, nature of neutral organophosphoric compound and constitute 1.1±-.2 kJ/mol. The Gibbs free energy of coproportionation reactions is -5.43 kJ/mol, while entropy of the reactions in 14.5±0.7 J/mol·K. 8 refs., 1 tab

  19. On the effects of pressure and irradiation on the transport properties of samarium compounds with unstable valence

    International Nuclear Information System (INIS)

    Morillo, J.

    1983-06-01

    We present the first extensive study of electronic transport properties of ''quasi-stoichiometric'' SmS as a function of pressure P, temperature T, magnetic field B and defect concentration C. SmS which is a semiconductor, undergoes with increasing P a first order transition towards an homogeneous intermediate valence state. In the semiconducting phase (s.c.), the energie epsilon(f) necessary to delocalize a 4f electron increases greatly with T and is about 250meV at 300K. The phase diagram for the first order electronic transition Sm 2 + →Smsup(2+epsilon) with P has been determined for T 6 has been investigated by resistivity measurements under irradiation at 21K. The threshold energy Ed for displacement of Sm in SmS has been determined: Ed(Sm) = 20 +- 2 eV, and the observed effects of irradiation have been associated to samarium displacements (vacancies and interstitials) [fr

  20. Bufalin Inhibits the Differentiation and Proliferation of Cancer Stem Cells Derived from Primary Osteosarcoma Cells through Mir-148a.

    Science.gov (United States)

    Chang, Yuewen; Zhao, Yongfang; Gu, Wei; Cao, Yuelong; Wang, Shuqiang; Pang, Jian; Shi, Yinyu

    2015-01-01

    Osteosarcoma (OS) is the second leading cause of cancer-related death in children and young adults. Chemoresistance is the most important cause of treatment failure in OS, largely resulting from presence of cancer stem cells (CSCs). However, CSCs isolated from cancer cell lines do not necessarily represent those from primary human tumors due to accumulation of genetic aberrations that increase with passage number. Therefore, studies on CSCs from primary OS may be more important for understanding the mechanisms driving the chemoresistance of CSCs in OS. We established a primary culture of OS cells, known as C1OS, from freshly resected tumor tissue. We further isolated CSCs from C1OS cells (C1OS-CSCs). We analyzed the effects of bufalin, a traditional Chinese medicine, on the stemness of C1OS-CSCs. We also analyzed the microRNA (miR) targets of bufalin on the stemness of C1OS-CSCs. Moreover, we examined these findings in the OS specimen. Bufalin inhibited the stemness of C1OS-CSCs. Moreover, we found that miR-148a appeared to be a target of bufalin, and miR-148a further regulated DNMT1 and p27 to control the stemness of OS cells. This mechanism was further confirmed in OS specimen. Our data suggest that bufalin may be a promising treatment for OS, and its function may be conducted through regulation of miR-148a. © 2015 S. Karger AG, Basel.

  1. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  2. Ferrites Ni0,5Zn0,5Fe2O4 doped with samarium: structural analysis, morphological and electromagnetic

    International Nuclear Information System (INIS)

    Costa, A.C.F.M.; Diniz, A.P.; Viana, K.M.S.; Cornejo, D.R.; Kiminami, R.H.G.A.

    2010-01-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni 0.5 Zn 0.5 Fe 2-x Sm x O 4 ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  3. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    International Nuclear Information System (INIS)

    Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

    2010-01-01

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  4. AGR-2 Data Qualification Report for ATR Cycles 147A, 148A, 148B, and 149A

    Energy Technology Data Exchange (ETDEWEB)

    Michael L. Abbott; Keith A. Daum

    2011-08-01

    This report presents the data qualification status of fuel irradiation data from the first four reactor cycles (147A, 148A, 148B, and 149A) of the on-going second Advanced Gas Reactor (AGR-2) experiment as recorded in the NGNP Data Management and Analysis System (NDMAS). This includes data received by NDMAS from the period June 22, 2010 through May 21, 2011. AGR-2 is the second in a series of eight planned irradiation experiments for the AGR Fuel Development and Qualification Program, which supports development of the very high temperature gas-cooled reactor (VHTR) under the Next Generation Nuclear Plant (NGNP) Project. Irradiation of the AGR-2 test train is being performed at the Advanced Test Reactor (ATR) at the Idaho National Laboratory (INL) and is planned for 600 effective full power days (approximately 2.75 calendar years) (PLN-3798). The experiment is intended to demonstrate the performance of UCO (uranium oxycarbide) and UO2 (uranium dioxide) fuel produced in a large coater. Data qualification status of the AGR-1 experiment was reported in INL/EXT-10-17943 (Abbott et al. 2010).

  5. AGR-2 Data Qualification Report for ATR Cycles 147A, 148A, 148B, and 149A

    International Nuclear Information System (INIS)

    Abbott, Michael L.; Daum, Keith A.

    2011-01-01

    This report presents the data qualification status of fuel irradiation data from the first four reactor cycles (147A, 148A, 148B, and 149A) of the on-going second Advanced Gas Reactor (AGR-2) experiment as recorded in the NGNP Data Management and Analysis System (NDMAS). This includes data received by NDMAS from the period June 22, 2010 through May 21, 2011. AGR-2 is the second in a series of eight planned irradiation experiments for the AGR Fuel Development and Qualification Program, which supports development of the very high temperature gas-cooled reactor (VHTR) under the Next Generation Nuclear Plant (NGNP) Project. Irradiation of the AGR-2 test train is being performed at the Advanced Test Reactor (ATR) at the Idaho National Laboratory (INL) and is planned for 600 effective full power days (approximately 2.75 calendar years) (PLN-3798). The experiment is intended to demonstrate the performance of UCO (uranium oxycarbide) and UO2 (uranium dioxide) fuel produced in a large coater. Data qualification status of the AGR-1 experiment was reported in INL/EXT-10-17943 (Abbott et al. 2010).

  6. [An analysis of 148 outpatient treated occupational accidents].

    Science.gov (United States)

    Nicaeus, T; Erb, C; Rohrbach, M; Thiel, H J

    1996-10-01

    The most common eye injuries are non-perforating. Eye injuries in the workplace are a major cause of socioeconomical damage, morbidity and disability, despite well publicised standards for industrial eye protection. This study investigates the epidemiological and clinical aspects of 148 occupational cases. At the University Eye Clinic of Tübingen, 709 non-perforating eye injuries were registered as occupational accidents between 1995 and 1996. Of these cases, 148 were analysed retrospectively per random. The 5 most common injuries of 148 patients (m/f = 138/10; mean age 33.4 +/- 12 years) were related to corneal foreign body injuries (35%), chemical burns (15.5%), sub-conjunctival foreign bodies (12%), thermal/ultraviolet injuries (11%) and contusions (7.4%). Of these patients, 22.3% were employed as construction workers and 16.2% as metal workers. At the time of examination the visual acuity of the traumatic eye was 0.9 +/- 0.3. The interval between the beginning of work and accident was 6.2 +/- 6.4 hours in average (0.5-13.5 h). Of all accidents, 8.5% were caused during the first hour of work; in contrast 45.5% of all accidents were caused after 6 hours of work. Another 12.4 +/- 14.5 hours (5min.-72 h; median 7 h) passed by until the patients arrived for eye examination at the Eye Clinic of Tübingen. Only 6% of all patients arrived within the first hour, and 29.7% after 12 hours. Of all cases, 30.4% received first-aid treatment in their company by the factory doctor or by the eye doctor before examination at the Eye Clinic. Only 6.8% of all patients had protective spectacles during work. Incapacity was seen in 30.4%; the average in total was 5.5 +/- 10 days. Despite the late examination at the Eye Clinic the functional loss was mostly little except after chemical burns. Nevertheless, most occupational accidents can be avoided with better protective devices in order to reduce the incidence of injuries and socioeconomical damage. Therefore an intense campaign

  7. Effective visible light-active nitrogen and samarium co-doped BiVO{sub 4} for the degradation of organic pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Min; Niu, Chao [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China); Liu, Jun, E-mail: minwang62@msn.com [Shenyang Military General Hospital, Shenyang 110016 (China); Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China)

    2015-11-05

    Nitrogen and samarium co-doped BiVO{sub 4} (N–xSm–BiVO{sub 4}) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO{sub 4} particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO{sub 4} extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO{sub 4} exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO{sub 4} under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO{sub 4} were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO{sub 4} has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping.

  8. Effective visible light-active nitrogen and samarium co-doped BiVO4 for the degradation of organic pollutants

    International Nuclear Information System (INIS)

    Wang, Min; Niu, Chao; Liu, Jun; Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan

    2015-01-01

    Nitrogen and samarium co-doped BiVO 4 (N–xSm–BiVO 4 ) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO 4 particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO 4 extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO 4 exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO 4 under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO 4 were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO 4 has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping

  9. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  10. Results after therapy of pain from bone metastases with Samarium-153 in our centers in Lima, Peru

    International Nuclear Information System (INIS)

    Alvarado, N.; Eskenazi, S.; Valle, M.P.; Montoya, J.; Castro, M.; Montiel, L.; Velarde, V.; Jauregui, I.; Cueto, C.

    2004-01-01

    Full text: 105 patients with bone metastases from prostate and breast cancer; between 42 and 78 years age (median 61 years) were evaluated. Patients had intense pain that could not be managed with combinations of analgesic and anti tumoral drugs. All patients received 1.2 mCi/kg of Samarium-153 intravenously as treatment for pain due to bony metastases. The isotope obtained from atomic reactor placed in Lima - Peru, was provided by Peruvian Nuclear Energy Institute (IPEN). One week before therapy, all the patients had a bone scan study with Tc99m-MDP that showed the presence of multiple bone metastases with high blastic activity. Haematology and biochemical parameter checked were: Creatinine ( 150,000 mm3), Leukocytes (> 5,000 mm3), Red cells (>3,500,000 mm3). No problems were encountered during intravenous administration of the radioisotope. The side effects after treatment were: Primary effects: 16 cases of nausea, 2 of vomiting, 3 of headache, 28 had increment of pain, 6 had flushing. 50 patients did not have the primary symptoms. Secondary effects: 3 Patients showed drop in leukocyte count between 2nd and 3rd week of therapy. Red cells showed 10-15% decrease between 6th to 8th week. Platelets showed a decrease of about 15% with one peak between 1st and 2nd week post Samarium therapy. Data was analysed using an analogue visual scale of the pain with values from 0 - 10 (0-no pain; 10-maximum pain) and in the same way using the E.C.O.G. scale (Eastern Cooperative Oncology Group) in relationship with the Karnofsky index in order to establish functional recovery for each patient. The decrease of pain was seen between 4th-7th days (average 8 days). A second dose was given after 60 days in 12 patients and a third dose in 3 cases.11 patients died due to different causes between 30 - 60 days post treatment. The analgesic dose came down significantly in 80% of patients. We conclude that palliative therapy of metastatic bone pain in Peru is possible with radionuclides. It

  11. MiR-148a functions to suppress metastasis and serves as a prognostic indicator in triple-negative breast cancer.

    Science.gov (United States)

    Xu, Xin; Zhang, Yun; Jasper, Jeff; Lykken, Erik; Alexander, Peter B; Markowitz, Geoffrey J; McDonnell, Donald P; Li, Qi-Jing; Wang, Xiao-Fan

    2016-04-12

    Triple-negative breast cancer (TNBC) presents a major challenge in the clinic due to its lack of reliable prognostic markers and targeted therapies. Accumulating evidence strongly supports the notion that microRNAs (miRNAs) are involved in tumorigenesis and could serve as biomarkers for diagnostic purposes. To identify miRNAs that functionally suppress metastasis of TNBC, we employed a concerted approach with selecting miRNAs that display differential expression profiles from bioinformatic analyses of breast cancer patient databases and validating top candidates with functional assays using breast cancer cell lines and mouse models. We have found that miR-148a exhibits properties as a tumor suppressor as its expression is inversely correlated with the ability of both human and mouse breast cancer cells to colonize the lung in mouse xenograft tumor models. Mechanistically, miR-148a appears to suppress the extravasation process of cancer cells, likely by targeting two genes WNT1 and NRP1 in a cell non-autonomous manner. Importantly, lower expression of miR-148a is detected in higher-grade tumor samples and correlated with increased likelihood to develop metastases and poor prognosis in subsets of breast cancer patients, particularly those with TNBC. Thus, miR-148a is functionally defined as a suppressor of breast cancer metastasis and may serve as a prognostic biomarker for this disease.

  12. Samarium-modified vanadium phosphate catalyst for the selective oxidation of n-butane to maleic anhydride

    International Nuclear Information System (INIS)

    Wu, Hua-Yi; Wang, Hai-Bo; Liu, Xin-Hua; Li, Jian-Hui; Yang, Mei-Hua; Huang, Chuan-Jing; Weng, Wei-Zheng; Wan, Hui-Lin

    2015-01-01

    Graphical abstract: The addition of a small amount of Sm into VPO catalyst brought about great changes in its physicochemical properties such as surface area, surface morphology, phase composition and redox property, thus leading to a higher catalytic performance in the selective oxidation of n-butane to maleic anhydride, as compared to the undoped VPO catalyst. - Highlights: • The addition of Sm leads to great changes in the structure of VPO catalyst. • Sm improves performance of VPO for oxidation of n-butane to maleic anhydride. • Catalytic performance is closely related to structure of VPO catalyst. - Abstract: A series of samarium-modified vanadium phosphate catalysts were prepared and studied in selective oxidation of n-butane to maleic anhydride. The catalytic evaluation showed that Sm modification significantly increased the overall n-butane conversion and intrinsic activity. N 2 -adsorption, XRD, SEM, Raman, XPS, EPR and H 2 -TPR techniques were used to investigate the intrinsic difference among these catalysts. The results revealed that the addition of Sm to VPO catalyst can increase the surface area of the catalyst, lead to a significant change in catalyst morphology from plate-like structure into rosette-shape clusters, and largely promote the formation of (VO) 2 P 2 O 7 . All of these were related to the different catalytic performance of Sm-doped and undoped VPO catalysts. The roles of the different VOPO 4 phases and the influence of Sm were also described and discussed

  13. Study of unstable valences of cadmium and samarium by pulse radiolysis. Influence of complexation by some synthetical ionophores

    International Nuclear Information System (INIS)

    Lerat-Parizot, O.

    1992-01-01

    Instable valences of cations in solution are evidenced by pulse radiolysis, in spite of a lifetime often lower than a milli-second they participate to electron transfer reactions, owing to their redox potential. In this work are studied Cd + and Sm 2+ obtained respectively by reduction of Cd 2+ and Sm 3+ by a solvated electron. The reactivity of Cd + in a cryptand and in a coronand is studied; it is a powerful reducing agent (redox potential -2V) going back to the stable valence by electron transfer to an acceptor. Transfer kinetics is studied by reduction of organic molecules, effect of solvents and ligands is also examined. For samarium the reduction kinetics by hydrated electrons is increased when the ion is in a cryptand in agreement with electrochemical observations, showing that the valence 2+ is stabilized in respect to the valence 3+ for lanthanides. The difference of behaviour between Cd + and Sm 2+ is probably due to the fact that for Cd the transferred electron comes from the external layer and for Sm it is a f electron protected by the 5s and 5p orbitals

  14. Fabrication of samarium strontium aluminate ceramic and deposition of thermal barrier coatings by air plasma spray process

    Directory of Open Access Journals (Sweden)

    Baskaran T

    2018-01-01

    Full Text Available Thermal barrier coatings (TBC with the metallic NiCrAlY bond coat are often used in many aircraft engines to protect superalloy components from high-temperature corrosion thereby to improve the life of gas turbine components. The search for new TBC material has been intensified in recent years due to lack of thermo-physical properties of conventionally used Yttria stabilized Zirconia (YSZ TBCs. Recently, the rare earth containing Samarium Strontium Aluminate (SSA based ceramic was proposed as a new TBC material due to its matching thermo-physical properties with the substrate. The present work focused on the synthesis of SSA ceramics for TBCs application and its coatings development on Ni-based superalloy Inconel 718 substrate by air plasma spray process. The X-ray photoelectron spectroscopy (XPS result confirmed the formation of single phase SSA ceramic after synthesis. The surface morphology of SSA TBCs is mainly composed of melted splats, semi and un-melted particles. The cross-sectional SEM micrographs did not show any spallation at the interface which indicated good mechanical interlocking between the bond coat and ceramic top coat. The Young’s modulus and hardness of SSA TBCs were found to be 80 and 6.1 GPa, respectively. The load-depth curve of SSA TBC showed good elastic recovery about 47 %.

  15. Observation of near infrared and enhanced visible emissions from electroluminescent devices with organo samarium(III) complex

    Energy Technology Data Exchange (ETDEWEB)

    Chu, B [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, W L [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Hong, Z R [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Zang, F X [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wei, H Z [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wang, D Y [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, M T [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Lee, C S [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China); Lee, S T [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China)

    2006-11-07

    Samarium (dibenzoylmethanato){sub 3} bathophenanthroline (Sm(DBM){sub 3} bath) was employed as an emitting and electron transport layer in organic light emitting diodes (OLEDs), and narrow electroluminescent (EL) emissions of a Sm{sup 3+} ion were observed in the visible and near infrared (NIR) region, differing from those of the same devices with Eu{sup 3+}- or Tb{sup 3+}-complex EL devices with the same structure. The EL emissions of the Sm{sup 3+}-devices originate from transitions from {sup 4}G{sub 5/2} to the lower respective levels of Sm{sup 3+} ions. A maximum luminance of 490 cd m{sup -2} at 15 V and an EL efficiency of 0.6% at 0.17 mA cm{sup -2} were obtained in the visible region, and the improved efficiency should be attributed to introducing a transitional layer between the N,N'-diphenyl-N,N'-bis(3-methylphenyl)-1,1'-diphenyl-4,4'-diamine (TPD) film and the Sm(DBM){sub 3} bath film and the avoidance of interfacial exciplex emission in devices. Sharp emissions of Sm{sup 3+} ions in the NIR region were also observed under a lower threshold value less than 4.5 V.

  16. Synthesis and characterization of samarium-doped ZnS nanoparticles: A novel visible light responsive photocatalyst

    Energy Technology Data Exchange (ETDEWEB)

    Hanifehpour, Younes, E-mail: y_hanifehpour@yu.ac.kr [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of); Soltani, Behzad; Amani-Ghadim, Ali Reza; Hedayati, Behnam [Department of Chemistry, Faculty of Basic Sciences, Azarbaijan Shahid Madani University, Tabriz (Iran, Islamic Republic of); Khomami, Bamin [Department of Chemical and Biomolecular Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Joo, Sang Woo, E-mail: swjoo1@gmail.com [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of)

    2016-04-15

    Highlights: • Sm-doped ZnS Nanomaterials were synthesized by hydrothermal method. • The as-prepared compounds were characterized by XRD, TEM, XPS, SEM and UV techniques. • The photocatalytic effect of compounds was determined by Reactive Red 43 degradation. • The degradation of RRed 43 followed the Langmuir–Hinshelwood kinetic model. - Abstract: We prepared pure and samarium-doped ZnS (Sm{sub x}Zn{sub 1−x}S{sub 1+0.5x}) nanoparticles via hydrothermal process at 160 °C for 24 h. XRD analysis shows that the particles were well crystallized and corresponds to a cubic sphalerite phase. SEM and TEM images indicate that the sizes of the particles were in the range of 20–60 nm. The photocatalytic activity of Sm-doped ZnS nanoparticles was evaluated by monitoring the decolorization of Reactive Red 43 in aqueous solution under visible light irradiation. The color removal efficiency of Sm{sub 0.04}Zn{sub 0.96}S and pure ZnS was 95.1% and 28.7% after 120 min of treatment, respectively. Among the different amounts of dopant agent used, 4% Sm-doped ZnS nanoparticles indicated the highest decolorization. We found that the presence of inorganic ions such as Cl{sup −}, CO{sub 3}{sup 2−} and other radical scavengers such as buthanol and isopropyl alcohol reduced the decolorization efficiency.

  17. Determination of the speciation and bioavailability of samarium to Chlamydomonas reinhardtii in the presence of natural organic matter.

    Science.gov (United States)

    Rowell, Justine-Anne; Fillion, Marc-Alexandre; Smith, Scott; Wilkinson, Kevin J

    2018-06-01

    As technological interest and environmental emissions of the rare earth elements increase, it is becoming more important to assess their potential environmental impact. Samarium (Sm) is a lanthanide of intermediate molar mass that is used in numerous high-technology applications including wind turbines, solar panels, and electric vehicles. The present study relates the speciation of Sm determined in the presence of natural organic matter (NOM) to its bioavailability to the unicellular green alga Chlamydomonas reinhardtii. The free ion concentration was determined using a cation exchange resin (ion exchange technique) in dynamic mode and compared with thermodynamic modeling. Short-term biouptake experiments were performed in the presence of 4 types of NOM: Suwannee River fulvic acids, Pahokee Peat fulvic acids, Suwannee River humic acids, and a Luther Marsh dissolved organic matter isolate (90-95% humic acids). It was clearly shown that even a small amount of NOM (0.5 mg C L -1 ) resulted in a significant decrease (10 times) in the Sm internalization fluxes. Furthermore, complexation with humic acids (and the corresponding reduction in Sm bioavailability) was stronger than that with fulvic acids. The results showed that the experimentally measured (free) Sm was a better predictor of Sm internalization than either the total concentrations or the free ion concentrations obtained using thermodynamic modeling. Environ Toxicol Chem 2018;37:1623-1631. © 2018 SETAC. © 2018 SETAC.

  18. Bufalin Inhibits the Differentiation and Proliferation of Cancer Stem Cells Derived from Primary Osteosarcoma Cells through Mir-148a

    Directory of Open Access Journals (Sweden)

    Yuewen Chang

    2015-06-01

    Full Text Available Background/Aims: Osteosarcoma (OS is the second leading cause of cancer-related death in children and young adults. Chemoresistance is the most important cause of treatment failure in OS, largely resulting from presence of cancer stem cells (CSCs. However, CSCs isolated from cancer cell lines do not necessarily represent those from primary human tumors due to accumulation of genetic aberrations that increase with passage number. Therefore, studies on CSCs from primary OS may be more important for understanding the mechanisms driving the chemoresistance of CSCs in OS. Methods: We established a primary culture of OS cells, known as C1OS, from freshly resected tumor tissue. We further isolated CSCs from C1OS cells (C1OS-CSCs. We analyzed the effects of bufalin, a traditional Chinese medicine, on the stemness of C1OS-CSCs. We also analyzed the microRNA (miR targets of bufalin on the stemness of C1OS-CSCs. Moreover, we examined these findings in the OS specimen. Results: Bufalin inhibited the stemness of C1OS-CSCs. Moreover, we found that miR-148a appeared to be a target of bufalin, and miR-148a further regulated DNMT1 and p27 to control the stemness of OS cells. This mechanism was further confirmed in OS specimen. Conclusion: Our data suggest that bufalin may be a promising treatment for OS, and its function may be conducted through regulation of miR-148a.

  19. 9 CFR 381.148 - Processing and handling requirements for frozen poultry products.

    Science.gov (United States)

    2010-01-01

    ... for frozen poultry products. 381.148 Section 381.148 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS...

  20. Draft Genome Sequence of Ochrobactrum intermedium Strain SA148, a Plant Growth-Promoting Desert Rhizobacterium

    KAUST Repository

    Lafi, Feras Fawzi

    2017-03-03

    Ochrobactrum intermedium strain SA148 is a plant growth-promoting bacterium isolated from sandy soil in the Jizan area of Saudi Arabia. Here, we report the 4.9-Mb draft genome sequence of this strain, highlighting different pathways characteristic of plant growth promotion activity and environmental adaptation of SA148.

  1. 40 CFR 148.10 - Waste specific prohibitions-solvent wastes.

    Science.gov (United States)

    2010-07-01

    ... injection unless the solvent waste is a solvent-water mixture or solvent-containing sludge containing less... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Waste specific prohibitions-solvent wastes. 148.10 Section 148.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

  2. 45 CFR 148.122 - Guaranteed renewability of individual health insurance coverage.

    Science.gov (United States)

    2010-10-01

    ... insurance coverage. 148.122 Section 148.122 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS REQUIREMENTS FOR THE INDIVIDUAL HEALTH INSURANCE MARKET... health insurance coverage. (a) Applicability. This section applies to all health insurance coverage in...

  3. 40 CFR 261.148 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 261.148 Section 261.148 Protection of Environment ENVIRONMENTAL... owners or operators, guarantors, or financial institutions. (a) An owner or operator must notify the... financial assurance or liability coverage in the event of bankruptcy of the trustee or issuing institution...

  4. Fabrication of a PVC membrane samarium(III) sensor based on N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide as a selectophore

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of); Naghavi-Reyabbi, Fatemeh [Resident of General Surgery, Endoscopic and Minimaly Invasive Surgery Research Center, Ghaem Hospital, Faculty of Medicine, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Faridbod, Farnoush [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Tadjarodi, Azadeh; Rad, Maryam [Department of Chemistry, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

    2013-03-01

    A new ion-selective electrode for Sm{sup 3+} ion is described based on the incorporation of N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 {+-} 0.5 mV decade{sup -1} over a wide concentration range of 1.0 Multiplication-Sign 10{sup -2} and 1 Multiplication-Sign 10{sup -6} mol L{sup -1}, with a lower detection limit of 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} and satisfactor applicable pH range of 3.6-9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm{sup 3+} over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm{sup 3+}. Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: Black-Right-Pointing-Pointer A new Sm{sup 3+}-PVC membrane sensor is introduced for determination of Sm{sup 3+} ions in the solutions. Black-Right-Pointing-Pointer N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. Black-Right-Pointing-Pointer Detection limit of the sensor is 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} with a short response time of less than 10 s.

  5. Fabrication of a PVC membrane samarium(III) sensor based on N,N′,N″-tris(4-pyridyl)trimesic amide as a selectophore

    International Nuclear Information System (INIS)

    Zamani, Hassan Ali; Naghavi-Reyabbi, Fatemeh; Faridbod, Farnoush; Mohammadhosseini, Majid; Ganjali, Mohammad Reza; Tadjarodi, Azadeh; Rad, Maryam

    2013-01-01

    A new ion-selective electrode for Sm 3+ ion is described based on the incorporation of N,N′,N″-tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 ± 0.5 mV decade −1 over a wide concentration range of 1.0 × 10 −2 and 1 × 10 −6 mol L −1 , with a lower detection limit of 4.7 × 10 −7 mol L −1 and satisfactor applicable pH range of 3.6–9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm 3+ over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm 3+ . Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: ► A new Sm 3+ -PVC membrane sensor is introduced for determination of Sm 3+ ions in the solutions. ► N,N′,N″-tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. ► Detection limit of the sensor is 4.7 × 10 −7 mol L −1 with a short response time of less than 10 s.

  6. Identification of the neutron-rich nuclides /sup 147; 148/Ba and half- life determination of the heavy isotopes of Rb, Sr, Y, Cs, Ba and La

    CERN Document Server

    Amiel, S; Nir-El, Y; Shmid, M

    1976-01-01

    The neutron nuclides /sup 147; 148/Ba were produced in the thermal neutron induced fission of /sup 235/U. A new surface ionization integrated target ion source operating at temperatures in the region of 1800 degrees C permits the measurement of half-lives of isotopes down to about 0.1 sec due to the very fast release of atoms from the target. Isotopes of Rb, Sr, Cs, and Ba were separated by positive surface ionization and their half-lives measured using beta activity detected by a silicon surface barrier detector with a depletion depth of 300 mu . The isotopes /sup 147/Ba and /sup 148/Ba were identified for the first time and their half-lives were found to be 0.72+or-0.07 sec and 0.47+or-0.20 sec, respectively. (0 refs).

  7. The theoretical basis and clinical methodology for stereotactic interstitial brain tumor irradiation using iododeoxyuridine as a radiation sensitizer and samarium-145 as a brachytherapy source

    International Nuclear Information System (INIS)

    Goodman, J.H.; Gahbauer, R.A.; Kanellitsas, C.; Clendenon, N.R.; Laster, B.H.; Fairchild, R.G.

    1989-01-01

    High grade astrocytomas have proven resistant to all conventional therapy. A technique to produce radiation enhancement during interstitial brain tumor irradiation by using a radiation sensitizer (IdUrd) and by stimulation of Auger electron cascades through absorption of low energy photons in iodine (Photon activation) is described. Clinical studies using IdUrd, 192 Ir as a brachytherapy source, and external radiation have produced promising results. Substituting samarium-145 for 192 Ir in this protocol is expected to produce enhanced results. 15 refs

  8. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  9. Effect of samarium (Sm) addition on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys

    International Nuclear Information System (INIS)

    Qiu, Hongxu; Yan, Hong; Hu, Zhi

    2013-01-01

    Highlights: •Sm affected the secondary dendrite arm spacing of Al–7Si–0.7Mg alloy. •The coarse plate-like eutectic silicon was fully modified into a fine branched and particle structure when 0.6 wt.% Sm added. •The tensile properties were enhanced by the addition of Sm. •Sm has marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior. •The morphology and chemical composition of Sm-rich intermetallics were studied. -- Abstract: The effects of samarium (Sm) additions (0–0.9 wt.%) on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys have been studied in this article. The microstructures of the as-cast samples were examined by optical microscopy (OM) and scanning electron microscopy (SEM). The experimental results indicated that the rare earth Sm affected the secondary dendrite arm spacing (SDAS) of Al–7Si–0.7Mg alloy. And it was found that Sm had great modification effects on the microstructures of eutectic silicon. When 0.6 wt.% Sm was added to the alloy, the coarse plate-like eutectic silicon was fully modified into a fine fibrous structure; the dendrites of Al–7Si–0.7Mg alloy was best refined. The mechanical properties were investigated by tensile test. The findings indicate that the tensile properties and elongation were improved by the addition of Sm. And a good combination of ultimate tensile strength (215 MPa) and elongation (3.3%) was obtained when the Sm addition was up to 0.6 wt.%. Furthermore the results of thermal analysis reveal that Sm addition had marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior

  10. Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

    International Nuclear Information System (INIS)

    Dantas, E.S.K.

    1990-01-01

    A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

  11. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  12. SPIN1, negatively regulated by miR-148/152, enhances Adriamycin resistance via upregulating drug metabolizing enzymes and transporter in breast cancer.

    Science.gov (United States)

    Chen, Xu; Wang, Ya-Wen; Gao, Peng

    2018-05-09

    Spindlin1 (SPIN1), a protein highly expressed in several human cancers, has been correlated with tumorigenesis and development. Alterations of drug metabolizing enzymes and drug transporters are major determinants of chemoresistance in tumor cells. However, whether the metabolizing enzymes and transporters are under the control of SPIN1 in breast cancer chemoresistance has not yet been defined. SPIN1 expression in breast cancer cells and tissues was detected by quantitative real-time PCR (qRT-PCR) and immunohistochemistry. Chemosensitivity assays in vitro and in vivo were performed to determine the effect of SPIN1 on Adriamycin resistance. Downstream effectors of SPIN1 were screened by microarray and confirmed by qRT-PCR and Western blot. Luciferase assay and Western blot were used to identify miRNAs regulating SPIN1. We showed that SPIN1 was significantly elevated in drug-resistant breast cancer cell lines and tissues, compared with the chemosensitive ones. SPIN1 enhanced Adriamycin resistance of breast cancer cells in vitro, and downregulation of SPIN1 by miRNA could decrease Adriamycin resistance in vivo. Mechanistically, drug metabolizing enzymes and transporter CYP2C8, UGT2B4, UGT2B17 and ABCB4 were proven to be downstream effectors of SPIN1. Notably, SPIN1 was identified as a direct target of the miR-148/152 family (miR-148a-3p, miR-148b-3p and miR-152-3p). As expected, miR-148a-3p, miR-148b-3p or miR-152-3p could increase Adriamycin sensitivity in breast cancer cells in vitro. Moreover, high expression of SPIN1 or low expression of the miR-148/152 family predicted poorer survival in breast cancer patients. Our results establish that SPIN1, negatively regulated by the miR-148/152 family, enhances Adriamycin resistance in breast cancer via upregulating the expression of drug metabolizing enzymes and drug transporter.

  13. 33 CFR 148.115 - How many copies of the application must I send and where must I send them?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How many copies of the application must I send and where must I send them? 148.115 Section 148.115 Navigation and Navigable Waters... Application for a License § 148.115 How many copies of the application must I send and where must I send them...

  14. 33 CFR 148.246 - When is a document considered filed and where should I file it?

    Science.gov (United States)

    2010-07-01

    ... filed and where should I file it? 148.246 Section 148.246 Navigation and Navigable Waters COAST GUARD... Formal Hearings § 148.246 When is a document considered filed and where should I file it? (a) If a document to be filed is submitted by mail, it is considered filed on the date it is postmarked. If a...

  15. 24 CFR 943.148 - What procurement standards apply to PHAs selecting partners for a joint venture?

    Science.gov (United States)

    2010-04-01

    ... PHAs selecting partners for a joint venture? 943.148 Section 943.148 Housing and Urban Development... VENTURES Subsidiaries, Affiliates, Joint Ventures in Public Housing § 943.148 What procurement standards apply to PHAs selecting partners for a joint venture? (a) The requirements of part 85 of this title are...

  16. Koestanti et al., Afr., J. Infect. Dis. (2018) 12(S): 148-151 https://doi ...

    African Journals Online (AJOL)

    emy

    2017-09-09

    Sep 9, 2017 ... (2018) 12(S): 148-151 ... Background: Brucellosis in pigs at East Java Indonesia has not only cause great economic losses due to a decrease in ..... assay for presumptive serodiagnosis of swine brucellosis in Argentina.

  17. 26 CFR 1.148-4 - Yield on an issue of bonds.

    Science.gov (United States)

    2010-04-01

    ... percent per year and matures on January 1, 2004. Bonds Y and Z are callable by the issuer at par plus... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Yield on an issue of bonds. 1.148-4 Section 1... (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.148-4 Yield on...

  18. The effect of samarium doping on structure and enhanced thermionic emission properties of lanthanum hexaboride fabricated by spark plasma sintering

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Shenlin; Hu, Qianglin [College of Mathematics and Physics, Jinggangshan University, Jian (China); Zhang, Jiuxing; Liu, Danmin [Key Laboratory of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing (China); Huang, Qingzhen [NIST Center for Neutron Research, National Institute of Standards and Technology, MD (United States)

    2014-03-15

    Single-phase polycrystalline solid solutions (La{sub 1-x}Sm{sub x})B{sub 6} (x = 0, 0.2, 0.4, 0.8, 1) are fabricated by spark plasma sintering (SPS). This study demonstrates a systematic investigation of structure-property relationships in Sm-doped LaB{sub 6} ternary rare-earth hexaborides. The microstructure, crystallographic orientation, electrical resistivity, and thermionic emission performance of these compounds are investigated. Analysis of the results indicates that samarium (Sm) doping has a noticeable effect on the structure and performance of lanthanum hexaboride (LaB{sub 6}). The analytical investigation of the electron backscatter diffraction confirms that (La{sub 0.6}Sm{sub 0.4})B{sub 6} exhibits a clear (001) texture that results in a low work function. Work functions are determined by pulsed thermionic diode measurements at 1500-1873 K. The (La{sub 0.6}Sm{sub 0.4})B{sub 6} possesses improved thermionic emission properties compared to LaB{sub 6}. The current density of (La{sub 0.6}Sm{sub 0.4})B{sub 6} is 42.4 A cm{sup -2} at 1873 K, which is 17.5% larger than that of LaB{sub 6}. The values of Φ{sub R} for (La{sub 0.6}Sm{sub 0.4})B{sub 6} and LaB{sub 6} are 1.98 ± 0.03 and 1.67 ± 0.03 eV, respectively. Furthermore, the Sm substitution of lanthanum (La) effectively increases the electrical resistivity. These results reveal that Sm doping lead to significantly enhanced thermionic emission properties of LaB{sub 6}. The compound (La{sub 0.6}Sm{sub 0.4})B{sub 6} appears most promising as a future emitter material. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  20. Lack of association between the APEX1 Asp148Glu polymorphism and sporadic amyotrophic lateral sclerosis.

    Science.gov (United States)

    Coppedè, Fabio; Lo Gerfo, Annalisa; Carlesi, Cecilia; Piazza, Selina; Mancuso, Michelangelo; Pasquali, Livia; Murri, Luigi; Migliore, Lucia; Siciliano, Gabriele

    2010-02-01

    Impairments in DNA repair enzymes have been observed in amyotrophic lateral sclerosis (ALS) tissues, particularly in the activity of the apurinic/apyrimidinic endonuclease 1 (APEX1). Moreover, it was suggested that the common APEX1 Asp148Glu polymorphism might be associated with ALS risk. To further address this question we performed the present study aimed at evaluating the contribution of the APEX1 Asp148Glu polymorphism in sporadic ALS (sALS) risk and clinical presentation, including age and site of onset and disease progression. We screened 134 sALS Italian patients and 129 matched controls for the presence of the APEX1 Asp148Glu polymorphism. No difference in APEX1 Asp148Glu allele and genotype frequencies was found between the groups, nor was the polymorphism associated with age and site of onset or disease progression. Present results do not support a role for the APEX1 Asp148Glu polymorphism in sALS pathogenesis in the Italian population.

  1. Measurement and Evaluation of the Activation Resonance Integral of 146Nd, 148Nd and 150Nd

    International Nuclear Information System (INIS)

    Ricabarra, M. D.; Turjanski, R.; Ricabarra, G. H.

    2012-01-01

    Values of the ratio of the reduced activation resonance integral to the thermal cross section, I'/σ 0 of 146 Nd, 148 Nd and 150 Nd were determined relative to gold by measuring cadmium ratios. A lithium-drifted germanium gamma ray spectrometer was used to resolve the activities of the irradiated samples. The results are for 146 Nd I'/σ 0 = 1.42±0.1 0 and with an assumed σ 0 = 1.4 barn, I' = 1 .99±0.20; for 148 Nd I'/ σ 0 = 4.22±0.1 4 and with an assumed σ 0 = 2.5 barn, I' = 10.5±0. 9 barn, and for 150 Nd I'/σ 0 = 13.7±0. 8 and with an assumed σ 0 = 1.2 barn, I' = 16.4±2.8. The resolved and unresolved epithermal integrals of 146 Nd, 148 Nd and 150 Nd were calculated. Values of the spectral correction factor were also calculated, so the resonance integral could be obtained from the epithermal integral data measured in our reactor spectrum in this experiment. Epithermal integral and spectral correction factors are listed in the text. The most important result of this investigation is that the 148 Nd activation reduced resonance integral is about half of the previously recommended value and consequently the radiative width for 148 Nd is also about half of the previously accepted value. (author)

  2. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  3. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  4. Optimal Timing of Bisphosphonate Administration in Combination with Samarium-153 Oxabifore in the Treatment of Painful Metastatic Bone Disease

    International Nuclear Information System (INIS)

    Rasulova, Nigora; Lyubshin, Vladimir; Arybzhanov, Dauranbek; Sagdullaev, Sh.; Krylov, Valery; Khodjibekov, Marat

    2013-01-01

    While bisphosphonates are indicated for prevention of skeletal-related events, radionuclide therapy is widely used for treatment of painful bone metastases. Combined radionuclide therapy with bisphosphonates has demonstrated improved effectiveness in achieving bone pain palliation in comparison to mono therapy with radionuclides or bisphosphonates alone. However, there are conflicting reports as to whether bisphosphonates adversely influence skeletal uptake of the bone-seeking radiotracers used for therapy. Recent studies analyzing influence of Zoledronic acid on total bone uptake of Samarium-153 EDTMP (Sm-153 EDTMP) by measuring cumulative urinary activity of Sm-153 on baseline study, as well as in combination with bisphosphonates (administrated 48 hours prior to Sm-153) did not provide any statistically significant difference in urinary excretion of Sm-153 between the two groups. It may be noted that the exact temporal sequence of bisphosphonate administration vis a vis radionuclide therapy has not yet been studied. One of the side effects of bisphosphonates is transient flare effect on bone pain. Radionuclide therapy may also have similar side effect. Keeping in view the above the current study was designed with the main objective of determining the exact timing of bisphosphonate administration in patients receiving combined therapy so as to achieve optimal efficacy of bone pain palliation. Ninety-three patients suffering from metastatic bone pain who received combination therapy with Sm-153 oxabifore (an analog of Sm-153 EDTMP) and Zoledronic acid were divided into three groups according to the timing of Zoledronic acid administration: Group I: 39 patients who received Zoledronic acid 7 or more days prior to Sm-153 oxabifore treatment; Group II: 32 patients who received Zoledronic acid 48-72 hours prior to Sm-153 oxabifore treatment and Group III: 22 patients who received Zoledronic acid 7 days after Sm-153 oxabifore treatment. Sm-153 oxabifore was administered

  5. The Atacama Cosmology Telescope: Extragalactic Sources at 148 GHz in the 2008 Survey

    Science.gov (United States)

    Marriage, T. A.; Juin, J. B.; Lin, Y. T.; Marsden, D.; Nolta, M. R.; Partridge, B.; Ade, P. A. R.; Aguirre, P.; Amiri, M.; Appel, J. W.; hide

    2011-01-01

    We report on extragalactic sources detected in a 455 square-degree map of the southern sky made with data at a frequency of 148 GHz from the Atacama Cosmology Telescope 2008 observing season. We provide a catalog of 157 sources with flux densities spanning two orders of magnitude: from 15 mJy to 1500 mJy. Comparison to other catalogs shows that 98% of the ACT detections correspond to sources detected at lower radio frequencies. Three of the sources appear to be associated with the brightest cluster galaxies of low redshift X-ray selected galaxy clusters. Estimates of the radio to mm-wave spectral indices and differential counts of the sources further bolster the hypothesis that they are nearly all radio sources, and that their emission is not dominated by re-emission from warm dust. In a bright (> 50 mJy) 148 GHz-selected sample with complete cross-identifications from the Australia Telescope 20 GHz survey, we observe an average steepening of the spectra between .5, 20, and 148 GHz with median spectral indices of alp[ha (sub 5-20) = -0.07 +/- 0.06, alpha (sub 20-148) -0.39 +/- 0.04, and alpha (sub 5-148) = -0.20 +/- 0.03. When the measured spectral indices are taken into account, the 148 GHz differential source counts are consistent with previous measurements at 30 GHz in the context of a source count model dominated by radio sources. Extrapolating with an appropriately rescaled model for the radio source counts, the Poisson contribution to the spatial power spectrum from synchrotron-dominated sources with flux density less than 20 mJy is C(sup Sync) = (2.8 +/- 0.3) x 1O (exp-6) micro K(exp 2).

  6. Effect of pulsed dose in simultaneous and sequential irradiation of V-79 cells by 14.8 MeV neutrons and 60Co photons

    International Nuclear Information System (INIS)

    Higgins, P.D.; DeLuca, P.M. Jr.; Gould, M.N.; Schell, M.C.; Pearson, D.W.

    1983-01-01

    The effect of irradiating V-79 Chinese hamster ovary cells with a mixture of 40% 14.8-MeV neutrons and 60% 60 Co photons with simultaneous or sequential exposures is investigated. Target doses are obtained by irradiating cell samples with 3-minute-long pulses of alternating neutrons and photons (in the sequential case) or with mixed neutrons and photons followed by equal beam-off periods to insure equal total-exposure times for sequenced and simultaneous irradiations. We observe qualitative differences between the survival results under each beam configuration that confirms earlier observations

  7. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  8. 26 CFR 1.148-8 - Small issuer exception to rebate requirement.

    Science.gov (United States)

    2010-04-01

    ... present value. (d) Pooled financings—(1) Treatment of pool issuer. To the extent that an issuer of a... limitations, such as voter approval requirements, but may not be contingent on approval by another governmental unit. See, also, section 148(f)(4)(D)(iv). (c) Size limitation—(1) In general. An issue (other...

  9. 7 CFR 457.148 - Fresh market pepper crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Fresh market pepper crop insurance provisions. 457.148... pepper crop insurance provisions. The fresh market pepper crop insurance provisions for the 1999 and... Fresh Market Pepper Crop Provisions If a conflict exists among the policy provisions, the order of...

  10. 21 CFR 146.148 - Reduced acid frozen concentrated orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Reduced acid frozen concentrated orange juice. 146... Canned Fruit Juices and Beverages § 146.148 Reduced acid frozen concentrated orange juice. (a) Reduced acid frozen concentrated orange juice is the food that complies with the requirements for composition...

  11. 19 CFR 148.32 - Vehicles, aircraft, boats, teams and saddle horses taken abroad.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Vehicles, aircraft, boats, teams and saddle horses... for Returning Residents § 148.32 Vehicles, aircraft, boats, teams and saddle horses taken abroad. (a) Admission free of duty. Automobiles and other vehicles, aircraft, boats, teams and saddle horses, together...

  12. 26 CFR 1.148-0 - Scope and table of contents.

    Science.gov (United States)

    2010-04-01

    ... method. (b) Allocation of gross proceeds to an issue. (1) One-issue rule and general ordering rules. (2... for which the bonds were issued. To accomplish these purposes, section 148 restricts the direct and... substance. (4) Reasonable charge. (5) Guarantee of purpose investments. (6) Allocation of qualified...

  13. 19 CFR 148.55 - Exemption for articles bearing American trademark.

    Science.gov (United States)

    2010-04-01

    ... registered with the U.S. Patent and Trademark Office and recorded with Customs. The exemption may be applied... 19 Customs Duties 2 2010-04-01 2010-04-01 false Exemption for articles bearing American trademark... § 148.55 Exemption for articles bearing American trademark. (a) Application of exemption. An exemption...

  14. 19 CFR 148.54 - Exemption for effects of citizens dying abroad.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Exemption for effects of citizens dying abroad... § 148.54 Exemption for effects of citizens dying abroad. (a) Exemption. Articles claimed to be personal and household effects, not stock in trade, the title to which is in the estate of a citizen of the...

  15. 27 CFR 478.148 - Armor piercing ammunition intended for sporting or industrial purposes.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Armor piercing ammunition... AMMUNITION COMMERCE IN FIREARMS AND AMMUNITION Exemptions, Seizures, and Forfeitures § 478.148 Armor piercing ammunition intended for sporting or industrial purposes. The Director may exempt certain armor piercing...

  16. 40 CFR 148.12 - Waste specific prohibitions-California list wastes.

    Science.gov (United States)

    2010-07-01

    ...) WATER PROGRAMS (CONTINUED) HAZARDOUS WASTE INJECTION RESTRICTIONS Prohibitions on Injection § 148.12...; (2) Liquid hazardous wastes, including free liquids associated with any solid or sludge, containing... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Waste specific prohibitions-California...

  17. Draft Genome Sequence of Ochrobactrum intermedium Strain SA148, a Plant Growth-Promoting Desert Rhizobacterium

    KAUST Repository

    Lafi, Feras Fawzi; Alam, Intikhab; Geurts, Rene; Bisseling, Ton; Bajic, Vladimir B.; Hirt, Heribert; Saad, Maged

    2017-01-01

    Ochrobactrum intermedium strain SA148 is a plant growth-promoting bacterium isolated from sandy soil in the Jizan area of Saudi Arabia. Here, we report the 4.9-Mb draft genome sequence of this strain, highlighting different pathways characteristic

  18. 7 CFR 905.148 - Reports of special purpose shipments under certificates of privilege.

    Science.gov (United States)

    2010-01-01

    ... (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts... Regulations Non-Regulated Fruit § 905.148 Reports of special purpose shipments under certificates of privilege... name and address of the shipper or shippers; name and address of the certified organic Florida citrus...

  19. Clinical significance of promoter region hypermethylation of microRNA-148a in gastrointestinal cancers

    Directory of Open Access Journals (Sweden)

    Sun JX

    2014-05-01

    Full Text Available Jingxu Sun,1,* Yongxi Song,1,* Zhenning Wang,1 Guoli Wang,2 Peng Gao,1 Xiaowan Chen,1 Zhaohua Gao,1 Huimian Xu1 1Department of Surgical Oncology and General Surgery, First Hospital of China Medical University, Shenyang, People’s Republic of China; 2Department of Biochemistry and Molecular Biology, China Medical University, Shenyang, People’s Republic of China *These authors contributed equally to this work Background: MicroRNAs are associated with tumor genesis and progression in various carcinomas. MicroRNA-148a (miR-148a was reported to have low expression in gastrointestinal cancers, and might be regulated by promoter region DNA methylation. Methods: Bisulfite-modified sequencing was used to determine the promoter region DNA methylation status of human gastrointestinal cancer cell lines. Expression levels of miR-148a in cell lines treated with 5-aza-2′-deoxycytidine were determined by quantitative real-time polymerase chain reaction. Total DNA was extracted from the tissues of 64 patients with gastric cancer and 51 patients with colorectal cancer. Methylation status was determined by methylation-specific polymerase chain reaction. All statistical analyses were performed with SPSS 17.0 software. Results: The promoter regions of genes in human gastrointestinal cancer cell lines were all hypermethylated, except for HT-29, and the expression of miR-148a tended to be higher than in controls after treatment with 5-aza-2′-deoxycytidine. The methylation-specific polymerase chain reaction results showed that 56.25% of gastric cancer tissues and 19.61% of colorectal cancer tissues were hypermethylated. A strong correlation was found between the expression of miR-148a and the methylation status of promoter regions (P<0.001, chi-square test and Pearson’s correlation. Furthermore, promoter region CpG site hypermethylation of miR-148a was correlated with increased tumor size (P=0.01 in gastric cancer after analyzing the correlation between

  20. Photoluminescence and spectroscopic dependence of fluorophosphate glasses on samarium ions concentration and the induced defects by gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Marzouk, M.A., E-mail: marzouk_nrc@yahoo.com [Glass Research Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); Hamdy, Y.M. [Spectroscopy Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); ElBatal, H.A. [Glass Research Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); Ezz ElDin, F.M. [National Institute for Radiation Research & Technology, Nasr City, Cairo (Egypt)

    2015-10-15

    /2} and {sup 6}H{sub 11/2}, respectively. The intensity of the emission spectra is observed to increase with the increase of Sm{sub 2}O{sub 3} content. The optical spectra within the visible–near IR region and photoluminescence spectra of Sm{sub 2}O{sub 3}-doped glasses are found to be stable and show almost no variations after gamma irradiation especially when rare-earth ions are present in noticeable contents (1–3%). FTIR spectra of all the studied glasses reveal repetitive and characteristic vibrational bands mainly due to phosphate groups with abundant of Q{sup 2} and Q{sup 3} groups due to the high content of P{sub 2}O{sub 5} (70 mol%). The introduction of 10% NaF and 20% AlF{sub 3} is observed to cause formation of mixed fluorophosphate groups (PO{sub 3}F){sup 2−}. The formation of (AlPO){sub 4} and/or (AlPO{sub 6}) groups needs further justification by combined techniques. The increase of Sm{sub 2}O{sub 3} content to 3% causes obvious increase of the IR absorption bands within the wavenumbers range of about 850–1400 cm{sup −1} due to suggested depolymerization effect. Gamma irradiation causes no distinct variations in the FTIR spectra due to suggested compactness through the formation of additional structural groups from AlF{sub 4} or AlF{sub 6}. - Highlights: • Samarium ions doped in host fluorophosphate glasses were prepared. • Optical and FT infrared absorption techniques were applied to study the spectral properties of the glasses. • Photoluminescence properties were measured. • Collective spectroscopic variations generated by gamma irradiation were investigated.

  1. 43 CFR 30.148 - Will interest or penalties charged after the date of death be paid?

    Science.gov (United States)

    2010-10-01

    ... date of death be paid? Interest or penalties charged against claims after the date of death will not be... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Will interest or penalties charged after the date of death be paid? 30.148 Section 30.148 Public Lands: Interior Office of the Secretary of the...

  2. 33 CFR 148.510 - What happens when a petition for exemption involves the interests of an adjacent coastal State?

    Science.gov (United States)

    2010-07-01

    ... exemption involves the interests of an adjacent coastal State? 148.510 Section 148.510 Navigation and... petition for exemption involves the interests of an adjacent coastal State? If the petition for exemption concerns an adjacent coastal State, the Commandant (CG-5) forwards the petition to the Governor of the...

  3. Overexpression of hsa-miR-148a promotes cartilage production and inhibits cartilage degradation by osteoarthritic chondrocytes

    NARCIS (Netherlands)

    Vonk, L A; Kragten, A H M; Dhert, W J A; Saris, D B F; Creemers, L B

    OBJECTIVE: Hsa-miR-148a expression is decreased in Osteoarthritis (OA) cartilage, but its functional role in cartilage has never been studied. Therefore, our aim was to investigate the effects of overexpressing hsa-miR-148a on cartilage metabolism of OA chondrocytes. DESIGN: OA chondrocytes were

  4. Overexpression of hsa-miR-148a promotes cartilage production and inhibits cartilage degradation by osteoarthritic chondrocytes

    NARCIS (Netherlands)

    Vonk, Lucienne A.; Kragten, Angela H.M.; Dhert, Wouter J.; Saris, Daniël B.F.; Creemers, Laura B.

    2014-01-01

    Objective Hsa-miR-148a expression is decreased in OA cartilage, but its functional role in cartilage has never been studied. Therefore, our aim was to investigate the effects of overexpressing hsa-miR-148a on cartilage metabolism of OA chondrocytes. Design OA chondrocytes were transfected with a

  5. Energy dependence of fission product yields from 235U, 238U, and 239Pu with monoenergetic neutrons between thermal and 14.8 MeV

    Science.gov (United States)

    Gooden, Matthew; Arnold, Charles; Bhike, Megha; Bredeweg, Todd; Fowler, Malcolm; Krishichayan; Tonchev, Anton; Tornow, Werner; Stoyer, Mark; Vieira, David; Wilhelmy, Jerry

    2017-09-01

    Under a joint collaboration between TUNL-LANL-LLNL, a set of absolute fission product yield measurements has been performed. The energy dependence of a number of cumulative fission product yields (FPY) have been measured using quasi-monoenergetic neutron beams for three actinide targets, 235U, 238U and 239Pu, between 0.5 and 14.8 MeV. The FPYs were measured by a combination of fission counting using specially designed dual-fission chambers and γ-ray counting. Each dual-fission chamber is a back-to-back ionization chamber encasing an activation target in the center with thin deposits of the same target isotope in each chamber. This method allows for the direct measurement of the total number of fissions in the activation target with no reference to the fission cross-section, thus reducing uncertainties. γ-ray counting of the activation target was performed on well-shielded HPGe detectors over a period of two months post irradiation to properly identify fission products. Reported are absolute cumulative fission product yields for incident neutron energies of 0.5, 1.37, 2.4, 3.6, 4.6, 5.5, 7.5, 8.9 and 14.8 MeV. Preliminary results from thermal irradiations at the MIT research reactor will also be presented and compared to present data and evaluations. This work was performed under the auspices of the U.S. Department of Energy by Los Alamos National Security, LLC under contract DE-AC52-06NA25396, Lawrence Livermore National Laboratory under contract DE-AC52-07NA27344 and by Duke University and Triangle Universities Nuclear Laboratory through NNSA Stewardship Science Academic Alliance grant No. DE-FG52-09NA29465, DE-FG52-09NA29448 and Office of Nuclear Physics Grant No. DE-FG02-97ER41033.

  6. Cumulative fission yield of Ce-148 produced by thermal-neutron fission of U-235

    International Nuclear Information System (INIS)

    Hasan, A.A.

    1984-12-01

    Cumulative fission yield of 148 cesium isotopes and some other fission products produced by thermal-neutron fission of 235 uranium is determined by Germanium/Lithium spectroscopic methods. The measuremets were done at Tsing-Hua open pool reactor using 3 to 4 mg of 93.15% enriched 235 uranium samples. Gamma rays are assigned to the responsible fission products by matching gamma rays energies and half lives. Fission rate is calculated by fission track method. Cumulative fission yields of 148 cesium, 90 krypton, 130 iodine, 144 lanthanum, 89 krypton, 136 xenon, 137 xenon and 140 cesium are calculated. This values are compared with previously predicted values and showed good agreement. 21 Ref

  7. Entrance-channel effects in the population of superdeformed bands in sup 147,148 Gd

    Energy Technology Data Exchange (ETDEWEB)

    Flibotte, S.; Andrews, H.R.; Drake, T.E.; Galindro-Uribarri, A.; Haas, B.; Janzen, V.P.; Prevost, D.; Radford, D.C.; Rodriguez, J.; Romain, P.; Vivien, J.P.; Waddington, J.C.; Ward, D.; Zwartz, G. (Centre de Recherches Nucleaires, F-67037 Strasbourg CEDEX (France) AECL Research, Chalk River Laboratories, Chalk River, Ontario, K0J 1J0 (Canada) Department of Physics, University of Toronto, Toronto, Ontario, M5S 1A7 (Canada) Department of Physics and Astronomy, McMaster University, Hamilton, Ontario, L8S 4K1 (Canada))

    1992-03-01

    Discrete superdeformed bands in {sup 147,148}Gd have been populated with asymmetric and symmetric fusion-evaporation reactions. The yields of the superdeformed bands compared with the total yield of the channel exhibit a large increase for symmetric reactions. We suggest an explanation for this effect in terms of the competition between neutron emission and fission at the early stage of the deexcitation process of the composite system.

  8. Entrance-channel effects in the population of superdeformed bands in 147,148Gd

    International Nuclear Information System (INIS)

    Flibotte, S.; Andrews, H.R.; Drake, T.E.; Galindro-Uribarri, A.; Haas, B.; Janzen, V.P.; Prevost, D.; Radford, D.C.; Rodriguez, J.; Romain, P.; Vivien, J.P.; Waddington, J.C.; Ward, D.; Zwartz, G.

    1992-01-01

    Discrete superdeformed bands in 147,148 Gd have been populated with asymmetric and symmetric fusion-evaporation reactions. The yields of the superdeformed bands compared with the total yield of the channel exhibit a large increase for symmetric reactions. We suggest an explanation for this effect in terms of the competition between neutron emission and fission at the early stage of the deexcitation process of the composite system

  9. Pairing phase transition and thermodynamical quantities in 148,149Sm

    International Nuclear Information System (INIS)

    Razavi, R.; Behkami, A.N.; Dehghani, V.

    2014-01-01

    The nuclear level densities and entropies in 148,149 Sm have been calculated in the framework of the superconducting theory that includes modified nuclear pairing gap. For modified pairing gap parameter the smooth transition from the BCS to the Fermi type distributions is used. By applying modified pairing gap, the extracted S-shaped heat capacity as a function of nuclear temperature exhibits a physical and smoother behavior instead of the singular behavior predicted by the BCS equations at critical temperature

  10. 46 CFR 148.04-17 - Petroleum coke, calcined, at 130 °F or above.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Petroleum coke, calcined, at 130 °F or above. 148.04-17...-17 Petroleum coke, calcined, at 130 °F or above. (a) The requirements of this part do not apply to bulk shipments of petroleum coke, calcined, on any vessel when the material is less than 130 °F. (b...

  11. Sequences of digestible lysine for gilts from 60 to 148 days of age

    Directory of Open Access Journals (Sweden)

    Veredino Louzada da Silva Júnior

    2015-01-01

    Full Text Available The experiment was conducted to evaluate five nutritional plans based on sequences of standardized ileal digestible lysine: 0.90-0.80-0.70, 1.00-0.90-0.80, 1.10-1.00-0.90, 1.20-1.10-1.00, and 1.30-1.20-1.10% fed to gilts from 60 to 99, 129 to 100, and 130 to 148 days of age, respectively. Eighty commercial hybrid gilts, selected for lean gain, with initial weight of 23.46±0.27kg were allotted in a randomized block design, with five treatments, eight replicates, and two pigs per experimental unit. No effect (P>0.05 of the nutritional plans was verified on daily feed intake, daily weight gain and feed conversion. The nutritional plans had no influence (P>0.05 on any of the carcass traits evaluated (carcass yield, meat amount, and meat yield. The nutritional plan of 0.90-0.80-0.70% standardized ileal digestible lysine fed to gilts from 60 to 99, 100 to 129, and 130 to 148 days of age, respectively, meets the standardized ileal digestible lysine requirements of gilts from 60 to 148 days of age.

  12. Structural and superconducting properties of (Y,Gd)Ba2Cu3O7-δ grown by MOCVD on samarium zirconate buffered IBAD-MgO

    International Nuclear Information System (INIS)

    Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X; Chen, Y; Selvamanickam, V

    2008-01-01

    Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 μm thick (Y,Gd)Ba 2 Cu 3 O 7-δ ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9 0 and 3.4 0 for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J c ) of over 2 MA cm -2 at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J c and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd) 2 O 3 particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes

  13. Pharmacokinetics of labelled compounds with technetium-99m and samarium-153; Farmacocinetica de compuestos marcados con tecnecio-99m y samario-153

    Energy Technology Data Exchange (ETDEWEB)

    Borda O, L B; Torres L, M N

    1997-07-01

    The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa.

  14. Hyperfine structure and isotope shift of the neutron-rich barium isotopes 139-146Ba and 148Ba

    International Nuclear Information System (INIS)

    Wendt, K.; Ahmad, S.A.; Klempt, W.; Neugart, R.; Otten, E.W.

    1988-01-01

    The hyperfine structure and isotope shift in the 6s 2 S 1/2 -6p 2 P 3/2 line of Ba II (455.4 nm) have been measured by collinear fast-beam laser spectroscopy for the neutron-rich isotopes 139-146 Ba and 148 Ba. Nuclear moments and mean square charge radii of these isotopes have been recalculated. The isotope shift of the isotope 148 Ba (T 1/2 = 0.64 s) could be studied for the first time, yielding δ 2 > 138,148 = 1.245(3) fm 2 . (orig.)

  15. Separation of the rare earths by high pressure liquid chromatography and the fission yield on sup(148m)Pm and sup(148g)Pm using thermal neutron induced fission of 233U and 239Pu

    International Nuclear Information System (INIS)

    Zwicky, H.U.

    1979-03-01

    This report is in two parts: in the first part, the method of high pressure liquid chromatography is described with particular reference to rare earth nuclei produced in nuclear reactions; in the second part, the results of a study of the fission yield of sup(148m)Pm and sup(148g)Pm from the thermal fission of 233 U and 239 Pu are presented. (G.T.H.)

  16. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  17. WR 148: identifying the companion of an extreme runaway massive binary*

    Science.gov (United States)

    Munoz, Melissa; Moffat, Anthony F. J.; Hill, Grant M.; Shenar, Tomer; Richardson, Noel D.; Pablo, Herbert; St-Louis, Nicole; Ramiaramanantsoa, Tahina

    2017-05-01

    WR 148 (HD 197406) is an extreme runaway system considered to be a potential candidate for a short-period (4.3173 d) rare WR + compact object binary. Provided with new high-resolution, high signal-to-noise spectra from the Keck observatory, we determine the orbital parameters for both the primary WR and the secondary, yielding respective projected orbital velocity amplitudes of 88.1 ± 3.8 km s-1 and 79.2 ± 3.1 km s-1 and implying a mass ratio of 1.1 ± 0.1. We then apply the shift-and-add technique to disentangle the spectra and obtain spectra compatible with a WN7ha and an O4-6 star. Considering an orbital inclination of ˜67°, derived from previous polarimetry observations, the system's total mass would be a mere 2-3M_{⊙}, an unprecedented result for a putative massive binary system. However, a system comprising a 37 M_{⊙} secondary (typical mass of an O5V star) and a 33 M_{⊙} primary (given the mass ratio) would infer an inclination of ˜18°. We therefore reconsider the previous methods of deriving the orbital inclination based on time-dependent polarimetry and photometry. While the polarimetric results are inconclusive requiring better data, the photometric results favour low inclinations. Finally, we compute WR 148's space velocity and retrace the runaway's trajectory back to the Galactic plane (GP). With an ejection velocity of 198 ± 27 km s-1 and a travel time of 4.7 ± 0.8 Myr to reach its current location, WR 148 was most likely ejected via dynamical interactions in a young cluster.

  18. Let-7 and MicroRNA-148 Regulate Parathyroid Hormone Levels in Secondary Hyperparathyroidism.

    Science.gov (United States)

    Shilo, Vitali; Mor-Yosef Levi, Irit; Abel, Roy; Mihailović, Aleksandra; Wasserman, Gilad; Naveh-Many, Tally; Ben-Dov, Iddo Z

    2017-08-01

    Secondary hyperparathyroidism commonly complicates CKD and associates with morbidity and mortality. We profiled microRNA (miRNA) in parathyroid glands from experimental hyperparathyroidism models and patients receiving dialysis and studied the function of specific miRNAs. miRNA deep-sequencing showed that human and rodent parathyroids share similar profiles. Parathyroids from uremic and normal rats segregated on the basis of their miRNA expression profiles, and a similar finding was observed in humans. We identified parathyroid miRNAs that were dysregulated in experimental hyperparathyroidism, including miR-29, miR-21, miR-148, miR-30, and miR-141 (upregulated); and miR-10, miR-125, and miR-25 (downregulated). Inhibition of the abundant let-7 family increased parathyroid hormone (PTH) secretion in normal and uremic rats, as well as in mouse parathyroid organ cultures. Conversely, inhibition of the upregulated miR-148 family prevented the increase in serum PTH level in uremic rats and decreased levels of secreted PTH in parathyroid cultures. The evolutionary conservation of abundant miRNAs in normal parathyroid glands and the regulation of these miRNAs in secondary hyperparathyroidism indicates their importance for parathyroid function and the development of hyperparathyroidism. Specifically, let-7 and miR-148 antagonism modified PTH secretion in vivo and in vitro , implying roles for these specific miRNAs. These findings may be utilized for therapeutic interventions aimed at altering PTH expression in diseases such as osteoporosis and secondary hyperparathyroidism. Copyright © 2017 by the American Society of Nephrology.

  19. The measurement of abundance and content of 148Nd monitor for the determination of burnup with mass spectrometry

    International Nuclear Information System (INIS)

    Gao Shuqin; Li Silin

    1992-09-01

    The abundance and content of nuclide 148 Nd, which is used as monitor to determine reactor element burnup, were measured by mass spectrometry, and the burnup can be calculated from measured results. The distribution of 148 Nd abundance and content in the axial direction are consistent with the theoretical calculation. The burnup values agree with the data obtained from heavy isotope ratio and radiochemistry methods within the errors of 4.0% and 2.8% respectively

  20. VizieR Online Data Catalog: ACT high significance 148 and 218GHz sources (Marsden+, 2014)

    Science.gov (United States)

    Marsden, D.; Gralla, M.; Marriage, T. A.; Switzer, E. R.; Partridge, B.; Massardi, M.; Morales, G.; Addison, G.; Bond, J. R.; Crichton, D.; Das, S.; Devlin, M.; Dunner, R.; Hajian, A.; Hilton, M.; Hincks, A.; Hughes, J. P.; Irwin, K.; Kosowsky, A.; Menanteau, F.; Moodley, K.; Niemack, M.; Page, L.; Reese, E. D.; Schmitt, B.; Sehgal, N.; Sievers, J.; Staggs, S.; Swetz, D.; Thornton, R.; Wollack, E.

    2014-11-01

    The ACT experiment (Swetz et al., 2011ApJS..194...41S) is situated on the slopes of Cerro Toco in the Atacama Desert of Chile at an elevation of 5190m. ACT's latitude gives access to both the northern and southern celestial hemispheres. Observations occurred simultaneously in three frequency bands, at 148GHz (2.0mm), 218GHz (1.4mm) and 277GHz (1.1mm) with angular resolutions of roughly 1.4 , 1.0 and 0.9-arcmin, respectively. (1 data file).

  1. Determination of burnup in irradiated nuclear fuels by the method of stable 148Nd fission products

    International Nuclear Information System (INIS)

    Souza Sarkis, J.E. de.

    1982-01-01

    A method is described for the isotopic analysis and determination of burnup in irradiated nuclear fuel by mass spectrometric technique. The burnup is calculed from the determination of the concentration of uranium, plutonium and the fission product 148 Nd in the samples of UO 2 irradiated fuel from a P.W.R. type reactor. The method involves the separation of fractions of uranium, plutonium and neodimium from the dissolved irradiated fuel by ion exchange technique. The determination of uranium, plutonium and the fission product 148 Nd is carried out by isotope diluition mass spectrometry technique using as isotope tracers the nuclides 233 U, 242 Pu and 150 Nd. For the chemical processing and handling of the irradiated sample a Hot Chemistry Laboratory was mounted. It consists of glove boxes and equipments for radiation monitoring and protection. The results obtained indicate an atom percent burnup of 2.181 + - 0.035% wich corresponds an 20.937 + - 0.739 Gwd/ton of thermal energy produced. (Author) [pt

  2. Two- to one-phonon E3 transition strength in {sup 148}Gd

    Energy Technology Data Exchange (ETDEWEB)

    Piiparinen, M [Niels Bohr Institute, Tandem Accelerator Laboratory, Roskilde (Denmark); [Jyvaeskylae Univ. (Finland). Dept. of Physics; Atac, A; Nyberg, J; Ramsoy, T; Sletten, G [Niels Bohr Institute, Tandem Acceleratory Laboratory, Roskile, (Denmark); Virtanen, A; Muller, D [Jyvaeskylae Univ. (Finland). Dept. of Physics; Kleinheinz, P [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Kernphysik; Blomqvist, J [Manne Siegbahn Inst. of Physics, Stockholm (Sweden)

    1992-08-01

    In a plunger experiment the mean life of the ({nu} f{sub 6}{sup 2}x3{sup -}x3{sup -})12{sup +} state at 3.981 MeV in {sub 64}{sup 148}Gd{sub 84} was measured as {tau}=83(10)ps, giving 77(11)B{sub w} for the 1286 keV 12{sup +} {yields} 9{sup -} E3 transition rate, which confirms the double-octupole character of the 12{sup +} state. The observed deviations in energy and transition rate from harmonic vibration are shown to be caused by the exclusion principle acting between nucleons in the two phonons and are related to the dominant contributions to the {sup 148}Gd octupole phonon of the low-lying {Delta}l={Delta}j=3 proton- and neutron in-shell 3{sup -} excitations which are of vital significance for the octupole mode in open-shell nuclei. (author). 17 refs., 2 figs.

  3. The i148m Pnpla3 polymorphism influences serum adiponectin in patients with fatty liver and healthy controls

    Directory of Open Access Journals (Sweden)

    Valenti Luca

    2012-08-01

    Full Text Available Abstract Background Reduced adiponectin is implicated in the pathogenesis of nonalcoholic fatty liver disease (NAFLD and steatohepatitis (NASH, and the I148M Patatin-like phospholipase domain-containing 3 (PNPLA3 polymorphism predisposes to NAFLD and liver damage progression in NASH and chronic hepatitis C (CHC by still undefined mechanisms, possibly involving regulation of adipose tissue function. Aim of this study was to evaluate whether the I148M PNPLA3 polymorphism influences serum adiponectin in liver diseases and healthy controls. Methods To this end, we considered 144 consecutive Italian patients with NAFLD, 261 with CHC, 35 severely obese subjects, and 257 healthy controls with very low probability of steatosis, all with complete clinical and genetic characterization, including adiponectin (ADIPOQ genotype. PNPLA3 rs738409 (I148M and ADIPOQ genotypes were evaluated by Taqman assays, serum adiponectin by ELISA. Adiponectin mRNA levels were evaluated by quantitative real-time PCR in the visceral adipose tissue (VAT of 35 obese subjects undergoing bariatric surgery. Results Adiponectin levels were independently associated with the risk of NAFLD and with the histological severity of the disease. Adiponectin levels decreased with the number of 148 M PNPLA3 alleles at risk of NASH both in patients with NAFLD (p = 0.03, and in healthy subjects (p = 0.04. At multivariate analysis, PNPLA3 148 M alleles were associated with low adiponectin levels (ADIPOQ genotype (OR 1.67, 95% c.i. 1.07-2.1 for each 148 M allele. The p.148 M PNPLA3 variant was associated with decreased adiponectin mRNA levels in the VAT of obese patients (p PNPLA3 and ADIPOQ genotypes and viral features. Conclusions The I148M PNPLA3 variant is associated with adiponectin levels in patients with NAFLD and in healthy subjects, but in the presence of adiponectin resistance not in CHC patients. The I148M PNPLA3 genotype may represent a genetic determinant of serum

  4. Energy Dependence of Fission Product Yields from 235U, 238U and 239Pu for Incident Neutron Energies Between 0.5 and 14.8 MeV

    Science.gov (United States)

    Gooden, Matthew; Bredeweg, Todd; Fowler, Malcolm; Vieira, David; Wilhelmy, Jerry; Tonchev, Anton; Stoyer, Mark; Bhike, Megha; Finch, Sean; Krishichayan, Fnu; Tornow, Werner

    2017-09-01

    The energy dependence of a number of cumulative fission product yields (FPY) have been measured using quasi- monoenergetic neutron beams for three actinide targets, 235U, 238U and 239Pu, between 0.5 and 14.8 MeV. The FPYs were measured by a combi- nation of fission counting using specially designed dual-fission chambers and -ray counting. Each dual-fission chamber is a back-to-back ioniza- tion chamber encasing an activation target in the center with thin de- posits of the same target isotope in each chamber. This method allows for the direct measurement of the total number of fissions in the activa- tion target with no reference to the fission cross-section, thus reducing uncertainties. γ-ray counting of the activation target was performed on well-shielded HPGe detectors over a period of 2 months post irradiation to properly identify fission products. Reported are absolute cumulative fission product yields for incident neutron energies of 0.5, 1.37, 2.4, 3.6, 4.6 and 14.8 MeV. New data in the second chance fission region of 5.5 - 9 MeV are included. Work performed for the U.S. Department of Energy by Los Alamos National Security, LLC under Contract DE-AC52-06NA25396.

  5. Interaction between PNPLA3 I148M variant and age at infection in determining fibrosis progression in chronic hepatitis C.

    Directory of Open Access Journals (Sweden)

    Stella De Nicola

    Full Text Available BACKGROUND AND AIMS: The PNPLA3 I148M sequence variant favors hepatic lipid accumulation and confers susceptibility to hepatic fibrosis and hepatocellular carcinoma. The aim of this study was to estimate the effect size of homozygosity for the PNPLA3 I148M variant (148M/M on the fibrosis progression rate (FPR and the interaction with age at infection in chronic hepatitis C (CHC. METHODS: FPR was estimated in a prospective cohort of 247 CHC patients without alcohol intake and diabetes, with careful estimation of age at infection and determination of fibrosis stage by Ishak score. RESULTS: Older age at infection was the strongest determinant of FPR (p<0.0001. PNPLA3 148M/M was associated with faster FPR in individuals infected at older age (above the median, 21 years; -0.64±0.2, n = 8 vs. -0.95±0.3, n = 166 log10 FPR respectively; p = 0.001; confirmed for lower age thresholds, p<0.05, but not in those infected at younger age (p = ns. The negative impact of PNPLA3 148M/M on fibrosis progression was more marked in subjects at risk of altered hepatic lipid metabolism (those with grade 2-3 steatosis, genotype 3, and overweight; p<0.05. At multivariate analysis, PNPLA3 148M/M was associated with FPR (incremental effect 0.08±0.03 log10 fibrosis unit per year; p = 0.022, independently of several confounders, and there was a significant interaction between 148M/M and older age at infection (p = 0.025. The association between 148M/M and FPR remained significant even after adjustment for steatosis severity (p = 0.032. CONCLUSIONS: We observed an interaction between homozygosity for the PNPLA3 I148M variant and age at infection in determining fibrosis progression in CHC patients.

  6. Energy dependence of fission product yields from 235U, 238U, and 239Pu with monoenergetic neutrons between thermal and 14.8 MeV

    Directory of Open Access Journals (Sweden)

    Gooden Matthew

    2017-01-01

    Full Text Available Under a joint collaboration between TUNL-LANL-LLNL, a set of absolute fission product yield measurements has been performed. The energy dependence of a number of cumulative fission product yields (FPY have been measured using quasi-monoenergetic neutron beams for three actinide targets, 235U, 238U and 239Pu, between 0.5 and 14.8 MeV. The FPYs were measured by a combination of fission counting using specially designed dual-fission chambers and γ-ray counting. Each dual-fission chamber is a back-to-back ionization chamber encasing an activation target in the center with thin deposits of the same target isotope in each chamber. This method allows for the direct measurement of the total number of fissions in the activation target with no reference to the fission cross-section, thus reducing uncertainties. γ-ray counting of the activation target was performed on well-shielded HPGe detectors over a period of two months post irradiation to properly identify fission products. Reported are absolute cumulative fission product yields for incident neutron energies of 0.5, 1.37, 2.4, 3.6, 4.6, 5.5, 7.5, 8.9 and 14.8 MeV. Preliminary results from thermal irradiations at the MIT research reactor will also be presented and compared to present data and evaluations. This work was performed under the auspices of the U.S. Department of Energy by Los Alamos National Security, LLC under contract DE-AC52-06NA25396, Lawrence Livermore National Laboratory under contract DE-AC52-07NA27344 and by Duke University and Triangle Universities Nuclear Laboratory through NNSA Stewardship Science Academic Alliance grant No. DE-FG52-09NA29465, DE-FG52-09NA29448 and Office of Nuclear Physics Grant No. DE-FG02-97ER41033.

  7. Conservative surgery and radiotherapy in the treatment of breast cancer. Preliminary results of 148 patients

    International Nuclear Information System (INIS)

    Faria, S.L.; Chiminazzo Junior, H.; Koseki, N.; Oliveira Filho, J.A. de

    1986-01-01

    The combination of tumoral resection and radiotherapy with preservation of the breast is called conservative treatment of breast cancer. The literature considers this treatment a good option if used by an experient team and with appropriate equipment. This paper shows the results of 148 cases of breast cancer treated by this conservative approach at Centro de Oncologia Campinas. Follow-up varied from 3 to 87 months (mean 28) considered by the histological diagnosis. Overall actuarial survival of 5 years was 77% disease-free survival 55%. Twelve patients (8%) presented local relapse and 13 (9%) had distant metastases as the first therapeutic failure. Cosmetic results were considered good and fair in 89% of patients. These results are similar to others published in the literature (Author) [pt

  8. Normative data for 148 Spanish emotional words in terms of attributions of humanity

    Directory of Open Access Journals (Sweden)

    Armando Rodríguez-Pérez

    2014-10-01

    Full Text Available Research on outgroup infrahumanization is based on the subtle and not deliberate distinction of secondary emotions, an exclusively human emotion, and primary emotions, which are shared by animals and human beings. According to prior studies, people attribute more secondary emotions to the ingroup than to the outgroup which they deny or restrict the ability to experience them. This study presents normative measures for 148 emotional words viewed by Spanish people in seven dimensions related to humanity assessments. Two factors were revealed by the principal components analysis (PCA. The first component was loaded on dimensions that differentiate the emotions depending on the cognitive demands (cognition, moral quality and duration whereas the second one was loaded on their expressive profile (visibility, age at which they are acquired, universality and causal locus. These dimensions were analyzed in relation to desirability, familiarity and explicit humanity.

  9. Infrared studies of H II regions: the Sharpless regions S148, 184, 198, 206 and 269

    International Nuclear Information System (INIS)

    Pismis, Paris

    1991-01-01

    We present the results of a combined near-infrared and IRAS mapping study of five H II regions for which fairly complete information at optical and radio wavelengths previously existed. The near-infrared observations, carried out with the 2.1-m telescope at Observatorio de San Pedro Martir (Mexico), allowed us to study the the stellar content at the core of each nebula, while an analysis of extended near-infrared emission zones showed these to arise mainly from ionized gas (S148 and S206) or through scattering and thermal emission from dust grains surrounding a massive young star (S269-IRS2). The analysis of IRAS data, on the other hand, suggests that two different populations of grains contribute to the observed 12- to 100-μm fluxes. (author)

  10. MC148 encoded by human molluscum contagiosum poxvirus is an antagonist for human but not murine CCR8

    DEFF Research Database (Denmark)

    Lüttichau, H R; Gerstoft, J; Schwartz, T W

    2001-01-01

    The viral CC chemokines MC148, encoded by the poxvirus molluscum contagiosum, and viral macrophage inflammatory protein (vMIP)-I and vMIP-II, encoded by human herpesvirus 8, were probed on the murine CC receptor (CCR) 8 in parallel with human CCR8. In calcium mobilization assays, vMIP-I acted...... as a high-affinity agonist, whereas vMIP-II acted as a low-affinity antagonist on the murine CCR8 as well as the human CCR8. MC148 was found to bind and block responses through the human CCR8 with high affinity, but surprisingly MC148 was unable to bind and block responses through the murine CCR8. Because...

  11. Multicentre trial on the efficacy and toxicity of single-dose samarium-153-ethylene diamine tetramethylene phosphonate as a palliative treatment for painful skeletal metastases in China

    International Nuclear Information System (INIS)

    Tian Jia-he; Zhang Jin-ming; He Yi-jie; Hou Qing-tian; Oyang Qiao-hong; Wang Jian-min; Chuan Ling

    1999-01-01

    A multicentre trial was organized in China as part of an international coordinated research project to study the efficacy and toxicity of single-dose samarium-153 ethylene diamine tetramethylene phosphonate (EDTMP) as a palliative treatment for painful skeletal metastases. One hundred and five patients with painful bone metastases from various primaries were treated with 153 Sm-EDTMP at a dose of 37 MBq/kg(group I) or 18.5 MBq/kg (group II). The effects were evaluated according to change in daily analgesic consumption, pain score, sum of effect product (SEP), Physician's Global Assessment (PGA), blood counts, and organ function tests conducted regularly for 16 weeks. Fifty-eight of 70 patients in group I and 30 of 35 in group II had a positive response, with SEPs of 22.29±14.47 and 20.13±13.90 respectively. Of 72 patients who had been receiving analgesics, 63 reduced their consumption. PGA showed that the Karnofsky score (KS) increased from 58.54±25.90 to 71.67±26.53, indicating improved general condition, but the difference was not significant. Among subgroups of patients, only those with breast cancer showed a significant change in the Karnofsky score after treatment. Inter-group differences were found for net change in KS between patients with lung and patients with breast cancer, and between patients with lung and patients with oesophageal cancer. Seventeen patients showed no response. No serious side-effects were noted, except for falls in the white blood cell (nadir 1.5 x 10 9 /l) and platelet (nadir 6.0 x 10 10 /l) counts in 44/105 and 34/105 cases, respectively. Ten patients had an abnormal liver function test. Response and side-effects were both independent of dose. In conclusion, 153 Sm-EDTMP provided effective palliation in 83.8% of patients with painful bone metastases; the major toxicity was temporary myelosuppression. Further studies are needed to identify better ways of determining the appropriate dose in the individual case and the efficacy of

  12. Light-ion spectroscopy with exotic targets

    International Nuclear Information System (INIS)

    Struble, G.L.; Lanier, R.G.

    1992-01-01

    Understanding the rich and diverse aspects underlying the physics of nuclear structure requires a variety of experimental techniques. In our laboratory, we have concentrated on experimental techniques using light-ion probes and isotopes that are technically difficult to fabricate into targets. In particular, our studies of p-, d-, and t-induced nuclear reactions on the radioactive targets of 152,154 Eu and 148 Gd have illuminated some very specific and very interesting features of nuclear structure near the N = 89 shape-transition region

  13. IFN-τ Mediated Control of Bovine Major Histocompatibility Complex Class I Expression and Function via the Regulation of bta-miR-148b/152 in Bovine Endometrial Epithelial Cells

    Directory of Open Access Journals (Sweden)

    Haichong Wu

    2018-02-01

    Full Text Available IFN-τ, a type I interferon produced by the trophoblasts of ruminants, has various important immune functions, including effects on the expression of major histocompatibility complex (MHC class I (MHC-I. A previous study has reported that IFN-τ promotes the expression of MHC-I molecules on endometrial cells. However, the immunological mechanisms by which IFN-τ regulates MHC-I molecules remain unknown. Here, we investigated which microRNA (miRNAs may be involved in the regulation of MHC-I molecule expression and function in bovine endometrial epithelial cells (bEECs. By using TargetScan 6.2 and http://www.microRNA.org, two miRNAs were suggested to target the 3′UTR of the bovine MHC-I heavy chain: bta-miR-148b and bta-miR-152. Dual luciferase reporter and miRNA mimic/inhibitor assays suggested that bta-miR-148b/152 were negatively correlated with bovine MHC-I heavy chain genes. The function of the MHC-I heavy chain was then investigated using qRT-PCR, ELISA, western blotting, immunofluorescence, and RNA interference assays in primary bEECs and an endometrial epithelial cell line (BEND. The results demonstrated that bta-miR-148b/152 could promote TLR4-triggered inflammatory responses by targeting the bovine MHC-I heavy chain, and the MHC-I molecule negatively regulated TLR4-induced inflammatory reactions may through the Fps-SHP-2 pathway. Our discovery offers novel insight into negative regulation of the TLR4 pathway and elucidates the mechanism by which bovine MHC-I molecules control congenital inflammatory reactions.

  14. Measurement of 167Er(n,p)167Ho reaction at 13.5 and 14.8 MeV

    International Nuclear Information System (INIS)

    Luo, Junhua; Liu, Jun; Han, Jiuning; Jiang, Li; Liu, Rong; Ge, Suhong; Liu, Zhenlai

    2013-01-01

    We have measured the 167 Er(n,p) 167 Ho cross-sections at two different neutron energies 13.5 and 14.8 MeV. Measurements were performed at Pd-300 neutron generator of Chinese Academy of Engineering Physics (CAEP) with monoenergetic neutrons produced via the 3 H(d,n) 4 He reaction using a tritium–titanium (T–Ti) target. Induced gamma activities were measured by a high-resolution gamma-ray spectrometer with high-purity germanium (HPGe) detector. The data for 167 Er(n,p) 167 Ho reaction cross-sections are reported to be 2.2±0.6 and 2.8±1.4 mb at 13.5±0.2 and 14.8±0.2 MeV incident neutron energies, respectively. The cross sections were also estimated with the TALYS-1.4 nuclear model code and compared with experimental data found in the literature, and with the comprehensive evaluation data in ENDF/B-VII.1 and JEFF-3.1/A libraries. - Highlights: • D–T neutron source was used to measure cross sections using activation method. • 27 Al(n,α) 24 Na was used as the monitor for the measurement. • The cross sections for the 167 Er(n,p) 167 Ho reactions have been measured. • Contribution of the interfering reaction 170 Er(n,α) 167 Dy was subtracted. • The results were compared with previous data and with evaluation data

  15. CERN: Fixed target targets

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1993-03-15

    Full text: While the immediate priority of CERN's research programme is to exploit to the full the world's largest accelerator, the LEP electron-positron collider and its concomitant LEP200 energy upgrade (January, page 1), CERN is also mindful of its long tradition of diversified research. Away from LEP and preparations for the LHC proton-proton collider to be built above LEP in the same 27-kilometre tunnel, CERN is also preparing for a new generation of heavy ion experiments using a new source, providing heavier ions (April 1992, page 8), with first physics expected next year. CERN's smallest accelerator, the LEAR Low Energy Antiproton Ring continues to cover a wide range of research topics, and saw a record number of hours of operation in 1992. The new ISOLDE on-line isotope separator was inaugurated last year (July, page 5) and physics is already underway. The remaining effort concentrates around fixed target experiments at the SPS synchrotron, which formed the main thrust of CERN's research during the late 1970s. With the SPS and LEAR now approaching middle age, their research future was extensively studied last year. Broadly, a vigorous SPS programme looks assured until at least the end of 1995. Decisions for the longer term future of the West Experimental Area of the SPS will have to take into account the heavy demand for test beams from work towards experiments at big colliders, both at CERN and elsewhere. The North Experimental Area is the scene of larger experiments with longer lead times. Several more years of LEAR exploitation are already in the pipeline, but for the longer term, the ambitious Superlear project for a superconducting ring (January 1992, page 7) did not catch on. Neutrino physics has a long tradition at CERN, and this continues with the preparations for two major projects, the Chorus and Nomad experiments (November 1991, page 7), to start next year in the West Area. Delicate neutrino oscillation effects could become visible for the first

  16. Association of β-fibrinogen promoter gene polymorphism (−148C/T), hyperfibrinogenemia and ischemic stroke in young adult patients

    OpenAIRE

    Imran, Imran; Lamsudin, Rusdi; Idjradinata, Ponpon; Achmad, Tri Hanggono; Maskoen, Amelani; Wibowo, Samekto; Harapan, Harapan

    2015-01-01

    Background: Single nucleotide polymorphism (SNP) −148C/T which is located in β-fibrinogen gene (FGB) promoter has correlation with fibrinogen levels; however, the association of SNP −148C/T and ischemic stroke in young adult patients is contradictory. Aim: To determine the association of SNP −148C/T in FGB promoter with plasma fibrinogen levels and ischemic stroke in young adults. Subjects and methods: In this case-control study, SNP −148C/T among 107 ischemic stroke patients and 94 con...

  17. CERN: Fixed target targets

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    Full text: While the immediate priority of CERN's research programme is to exploit to the full the world's largest accelerator, the LEP electron-positron collider and its concomitant LEP200 energy upgrade (January, page 1), CERN is also mindful of its long tradition of diversified research. Away from LEP and preparations for the LHC proton-proton collider to be built above LEP in the same 27-kilometre tunnel, CERN is also preparing for a new generation of heavy ion experiments using a new source, providing heavier ions (April 1992, page 8), with first physics expected next year. CERN's smallest accelerator, the LEAR Low Energy Antiproton Ring continues to cover a wide range of research topics, and saw a record number of hours of operation in 1992. The new ISOLDE on-line isotope separator was inaugurated last year (July, page 5) and physics is already underway. The remaining effort concentrates around fixed target experiments at the SPS synchrotron, which formed the main thrust of CERN's research during the late 1970s. With the SPS and LEAR now approaching middle age, their research future was extensively studied last year. Broadly, a vigorous SPS programme looks assured until at least the end of 1995. Decisions for the longer term future of the West Experimental Area of the SPS will have to take into account the heavy demand for test beams from work towards experiments at big colliders, both at CERN and elsewhere. The North Experimental Area is the scene of larger experiments with longer lead times. Several more years of LEAR exploitation are already in the pipeline, but for the longer term, the ambitious Superlear project for a superconducting ring (January 1992, page 7) did not catch on. Neutrino physics has a long tradition at CERN, and this continues with the preparations for two major projects, the Chorus and Nomad experiments (November 1991, page 7), to start next year in the West Area. Delicate neutrino oscillation effects could become

  18. 75 FR 61696 - Foreign-Trade Zone 148-Knoxville, TN; Application for Subzone; Toho Tenax America, Inc. (Carbon...

    Science.gov (United States)

    2010-10-06

    ... Board (the Board) by the Industrial Development Board of Blount County, Tennessee, grantee of FTZ 148... market. The company manufactures standard grade carbon fiber for industrial and recreational uses... competitiveness. In accordance with the Board's regulations, Diane Finver of the FTZ Staff is designated examiner...

  19. Regulation of Src family kinases involved in T cell receptor signaling by protein-tyrosine phosphatase CD148

    Czech Academy of Sciences Publication Activity Database

    Štěpánek, Ondřej; Kalina, T.; Dráber, Peter; Skopcová, Tereza; Svojgr, K.; Angelisová, Pavla; Hořejší, Václav; Weiss, A.; Brdička, Tomáš

    2011-01-01

    Roč. 286, č. 25 (2011), s. 22101-22112 ISSN 0021-9258 R&D Projects: GA MŠk 2B06064; GA MŠk 1M0506 Institutional research plan: CEZ:AV0Z50520514 Keywords : CD148 * tyrosine phosphatase * Src family kinases Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.773, year: 2011

  20. Comparison of the elastic and inelastic scattering between 152Sm + 12C and 148Nd + 16O

    International Nuclear Information System (INIS)

    Zhao Kui; Lu Xiuqin; Cheng Yehao; Li Qingli; Li Min; Li Zhichang; Guo Jiyu; Li Shuyuan; Zhang Qinghua; Song Xiaobin; Jiang Chenglie

    1994-01-01

    Angular distributions of elastic and inelastic scattering have been measured for 152 Sm+ 12 C at 63.2 MeV and 148 Nd+ 16 O at 90.9 MeV. An evident interference pattern in the inelastic scattering has been observed for the first time in a strong Coulomb coupling system. (orig.)

  1. QA for helical tomotherapy: Report of the AAPM Task Group 148

    Energy Technology Data Exchange (ETDEWEB)

    Langen, Katja M.; Papanikolaou, Niko; Balog, John; Crilly, Richard; Followill, David; Goddu, S. Murty; Grant, Walter III; Olivera, Gustavo; Ramsey, Chester R.; Shi Chengyu [Department of Radiation Oncology, M. D. Anderson Cancer Center Orlando, Orlando, Florida 32806 (United States); Department of Radiation Oncology, Cancer Therapy and Research Center, University of Texas Health Science Center at San Antonio, San Antonio, Texas 78229 (United States); Mohawk Valley Medical Physics, Rome, New York 13440 (United States); Department of Radiation Medicine, Oregon Health and Science University, Portland, Oregon 97239 (United States); Section of Outreach Physics, University of Texas M. D. Anderson Cancer Center, Houston, Texas 77030 (United States); Department of Radiation Oncology, Washington University School of Medicine, St. Louis, Missouri 63110 (United States); Department of Radiology/Section of Radiation Oncology, Baylor College of Medicine, Methodist Hospital, Houston, Texas 77030 (United States); TomoTherapy, Inc., Madison, Wisconsin 53717 and Department of Medical Physics, University of Wisconsin, Madison, Wisconsin 53706 (United States); Thompson Cancer Survival Center, Knoxville, Tennessee 37916 (United States); Department of Radiation Oncology, Cancer Therapy and Research Center, University of Texas Health Science Center at San Antonio, San Antonio, Texas 78229 (United States)

    2010-09-15

    Helical tomotherapy is a relatively new modality with integrated treatment planning and delivery hardware for radiation therapy treatments. In view of the uniqueness of the hardware design of the helical tomotherapy unit and its implications in routine quality assurance, the Therapy Physics Committee of the American Association of Physicists in Medicine commissioned Task Group 148 to review this modality and make recommendations for quality assurance related methodologies. The specific objectives of this Task Group are: (a) To discuss quality assurance techniques, frequencies, and tolerances and (b) discuss dosimetric verification techniques applicable to this unit. This report summarizes the findings of the Task Group and aims to provide the practicing clinical medical physicist with the insight into the technology that is necessary to establish an independent and comprehensive quality assurance program for a helical tomotherapy unit. The emphasis of the report is to describe the rationale for the proposed QA program and to provide example tests that can be performed, drawing from the collective experience of the task group members and the published literature. It is expected that as technology continues to evolve, so will the test procedures that may be used in the future to perform comprehensive quality assurance for helical tomotherapy units.

  2. Studies on the rare earth complexes with pyridine derivatives and their N-oxide(II) - Synthesis and properties of fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with 2,2'-bipyridine-N,N'-dioxide

    International Nuclear Information System (INIS)

    Minyu, T.; Ning, T.; Yingli, Z.; Jiyuan, B.

    1985-01-01

    The solid complexes of rare earth nitrates perchlorates and thiocyanates with 2,2'-bipyridine-N,N'-dioxide (bipyO/sub 2/) have been reported. However, the corresponding complexes of other rear earth chlorides have not been investigated except lanthanum, cerium and yttrium. As an extension of our previous work on the synthesis of complexes of praseodymium and neodymium chlorides wiht bipoyO/sub 2/, the authors have now prepared fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with biphyO/sub 2/, using methanol as a reaction medium. The new synthesized compounds have been identified by means of elemental analysis, infrared spectrometry, conductometry, differential thermal analysis (DTA), thermogravimetry (TG) and X-ray powder diffraction

  3. Target laboratory

    International Nuclear Information System (INIS)

    Ephraim, D.C.; Pednekar, A.R.

    1993-01-01

    A target laboratory to make stripper foils for the accelerator and various targets for use in the experiments is set up in the pelletron accelerator facility. The facilities available in the laboratory are: (1) D.C. glow discharge setup, (2) carbon arc set up, and (3) vacuum evaporation set up (resistance heating), electron beam source, rolling mill - all for target preparation. They are described. Centrifugal deposition technique is used for target preparation. (author). 3 figs

  4. Ice targets

    International Nuclear Information System (INIS)

    Pacheco, C.; Stark, C.; Tanaka, N.; Hodgkins, D.; Barnhart, J.; Kosty, J.

    1979-12-01

    This report presents a description of ice targets that were constructed for research work at the High Resolution Spectrometer (HRS) and at the Energetic Pion Channel and Spectrometer (EPICS). Reasons for using these ice targets and the instructions for their construction are given. Results of research using ice targets will be published at a later date

  5. The herpesvirus 8-encoded chemokine vMIP-II, but not the poxvirus-encoded chemokine MC148, inhibits the CCR10 receptor

    DEFF Research Database (Denmark)

    Lüttichau, H R; Lewis, I C; Gerstoft, J

    2001-01-01

    The viral chemokine antagonist vMIP-II encoded by human herpesvirus 8 (HHV8) and MC148 encoded by the poxvirus - Molluscum contagiosum - were tested against the newly identified chemokine receptor CCR10. As the CCR10 ligand ESkine / CCL27 had the highest identity to MC148 and because both...

  6. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  7. The shielding performance of multilayer composite shielding structures to 14.8 MeV fast neutrons

    International Nuclear Information System (INIS)

    Shen Zhiqiang; Kang Qing; Xu Jun; Wang Zhenggang; Lu Nan

    2014-01-01

    Cement-based round thin-layer samples mixed with 30% quality content of barite, and 20% quality content of carbide boron has Prepared, the same-diameter sliced samples of pure graphite and pure polyethylene has cut, then, samples combination and cross stack order has designed, formed four species Multilayer Composite shield structure, at last, neutron attenuation measurements has been done by experimental system of using 14.8 MeV neutrons from the 5SDH-2 accelerator and long counter composition, penetrating rate of samples and the shield structure to 14.8 MeV fast neutron has tested, and attenuation section has calculated. Results show that 14.8 MeV fast neutrons to higher penetration rates of thin layer samples, attenuation cross section of samples distinguish small between each other, must be increasing the thickness of the samples to reduce the experimental uncertainty; through composed of attenuation cross section and thickness parameters of composite structure, can more accurately predict the shielding ability of composite structures, error between calculation results and experimental results in 4%. (authors)

  8. Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

    Science.gov (United States)

    Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

    2017-10-01

    The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

  9. Antiproton Target

    CERN Multimedia

    1980-01-01

    Antiproton target used for the AA (antiproton accumulator). The first type of antiproton production target used from 1980 to 1982 comprised a rod of copper 3mm diameter and 120mm long embedded in a graphite cylinder that was itself pressed into a finned aluminium container. This assembly was air-cooled and it was used in conjunction with the Van der Meer magnetic horn. In 1983 Fermilab provided us with lithium lenses to replace the horn with a view to increasing the antiproton yield by about 30%. These lenses needed a much shorter target made of heavy metal - iridium was chosen for this purpose. The 50 mm iridium rod was housed in an extension to the original finned target container so that it could be brought very close to the entrance to the lithium lens. Picture 1 shows this target assembly and Picture 2 shows it mounted together with the lithium lens. These target containers had a short lifetime due to a combination of beam heating and radiation damage. This led to the design of the water-cooled target in...

  10. PNPLA 3 I148M genetic variant associates with insulin resistance and baseline viral load in HCV genotype 2 but not in genotype 3 infection

    DEFF Research Database (Denmark)

    Rembeck, Karolina; Maglio, Cristina; Lagging, Martin

    2012-01-01

    ABSTRACT: BACKGROUND: Hepatic steatosis in HCV patients has been postulated as a risk factor associated with a higher frequency of fibrosis and cirrhosis. A single genetic variant, PNPLA3 I148M, has been widely associated with increased hepatic steatosis. Previous studies of the PNPLA3 I148M...... sequence variant in HCV infected individuals have reported an association between this variant and prevalence of steatosis, fibrosis, and cirrhosis. To evaluate the impact of PNPLA3 I148M variant on metabolic traits and treatment response in HCV genotype 2 and 3 infected patients. METHODS: Three hundred...

  11. Doing worse, but feeling happy : Social comparison and identification in response to upward and downward targets

    NARCIS (Netherlands)

    Groothof, H.; Siero, F.W.; Buunk, Abraham (Bram)

    2007-01-01

    We investigated people's responses to exposure to downward and upward targets. In Study 1, among 197 participants, it was predicted and found that such exposure led to a contrast effect on self-evaluation, and to an assimilation effect on affect. In Study 2, among 148 participants, it was predicted

  12. Targeted Learning

    CERN Document Server

    van der Laan, Mark J

    2011-01-01

    The statistics profession is at a unique point in history. The need for valid statistical tools is greater than ever; data sets are massive, often measuring hundreds of thousands of measurements for a single subject. The field is ready to move towards clear objective benchmarks under which tools can be evaluated. Targeted learning allows (1) the full generalization and utilization of cross-validation as an estimator selection tool so that the subjective choices made by humans are now made by the machine, and (2) targeting the fitting of the probability distribution of the data toward the targe

  13. Target preparation

    International Nuclear Information System (INIS)

    Hinn, G.M.

    1984-01-01

    A few of the more interesting of the 210 targets prepared in the Laboratory last year are listed. In addition the author continues to use powdered silver mixed with /sup 9,10/BeO to produce sources for accelerator radio dating of Alaskan and South Polar snow. Currently, he is trying to increase production by multiple sample processing. Also the author routinely makes 3 μg/cm 2 cracked slacked carbon stripper foils and is continuing research with some degree of success in making enriched 28 Si targets starting with the oxide

  14. miR-148a is upregulated by Twist1 and T-bet and promotes Th1-cell survival by regulating the proapoptotic gene Bim.

    Science.gov (United States)

    Haftmann, Claudia; Stittrich, Anna-Barbara; Zimmermann, Jakob; Fang, Zhuo; Hradilkova, Kristyna; Bardua, Markus; Westendorf, Kerstin; Heinz, Gitta A; Riedel, René; Siede, Julia; Lehmann, Katrin; Weinberger, Esther E; Zimmel, David; Lauer, Uta; Häupl, Thomas; Sieper, Joachim; Backhaus, Marina; Neumann, Christian; Hoffmann, Ute; Porstner, Martina; Chen, Wei; Grün, Joachim R; Baumgrass, Ria; Matz, Mareen; Löhning, Max; Scheffold, Alexander; Wittmann, Jürgen; Chang, Hyun-Dong; Rajewsky, Nikolaus; Jäck, Hans-Martin; Radbruch, Andreas; Mashreghi, Mir-Farzin

    2015-04-01

    Repeatedly activated T helper 1 (Th1) cells present during chronic inflammation can efficiently adapt to the inflammatory milieu, for example, by expressing the transcription factor Twist1, which limits the immunopathology caused by Th1 cells. Here, we show that in repeatedly activated murine Th1 cells, Twist1 and T-bet induce expression of microRNA-148a (miR-148a). miR-148a regulates expression of the proapoptotic gene Bim, resulting in a decreased Bim/Bcl2 ratio. Inhibition of miR-148a by antagomirs in repeatedly activated Th1 cells increases the expression of Bim, leading to enhanced apoptosis. Knockdown of Bim expression by siRNA in miR-148a antagomir-treated cells restores viability of the Th1 cells, demonstrating that miR-148a controls survival by regulating Bim expression. Thus, Twist1 and T-bet not only control the differentiation and function of Th1 cells, but also their persistence in chronic inflammation. © 2014 The Authors. European Journal of Immunology published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  16. Effects of samarium (Sm) additions on the microstructure and mechanical properties of as-cast and hot-extruded Mg-5 wt%Al-3 wt%Ca-based alloys

    International Nuclear Information System (INIS)

    Son, Hyeon-Taek; Lee, Jae-Seol; Kim, Dae-Guen; Yoshimi, Kyosuke; Maruyama, Kouichi

    2009-01-01

    Samarium (Sm) additions to as-cast Mg-5Al-3Ca-based alloys result in changes, such as equiaxed grains and a refined grain size. The microstructure of as-cast Mg-5Al-3Ca-xSm alloys consists of an α-Mg matrix, a (Mg, Al) 2 Ca eutectic phase, and an Al 2 Sm intermetallic compound. In as-cast alloys, the (Mg, Al) 2 Ca eutectic phase was located at grain boundaries with a chain structure, and the Al 2 Sm intermetallic compounds were homogeneously distributed at the α-Mg matrix and grain boundaries. The eutectic phase of the extruded alloys was elongated in the extrusion direction and crushed into fine particles because of severe deformation during hot extrusion, and the grain size was refined with an increased amount of Sm addition. The maximum values of the yield strength and tensile strength were 313 MPa and 330 MPa at 2 wt%Sm alloy content, respectively

  17. The distribution of urate deposition within the extremities in gout: a review of 148 dual-energy CT cases

    International Nuclear Information System (INIS)

    Mallinson, Paul I.; Reagan, Adrian C.; Munk, Peter L.; Ouellette, Hugue; Nicolaou, Savvas; Coupal, Tyler

    2014-01-01

    Clinical detection of gout can be difficult due to co-existent and mimicking arthropathies and asymptomatic disease. Understanding of the distribution of urate within the body can aid clinical diagnosis and further understanding of the resulting pathology. Our aim was to determine this distribution of urate within the extremities in patients with gout. All patients who underwent a four-limb dual-energy computed tomography (DECT) scan for suspected gout over a 2-year period were identified (n = 148, 121 male, 27 female, age range, 16-92 years, mean = 61.3 years, median = 63 years). The reports of the positive cases were retrospectively analyzed and the locations of all urate deposition recorded and classified by anatomical location. A total of 241 cases met the inclusion criteria, of which 148 cases were positive. Of these, 101 (68.2 %) patients had gout in the foot, 81 (56.1 %) in the knee, 79 (53.4 %) in the ankle, 41 (27.7 %) in the elbow, 25 (16.9 %) in the hand, and 25 (16.9 %) in the wrist. The distribution was further subcategorized for each body part into specific bone and soft tissue structures. In this observational study, we provide for the first time a detailed analysis of extremity urate distribution in gout, which both supports and augments to the current understanding based on clinical and microscopic findings. (orig.)

  18. The distribution of urate deposition within the extremities in gout: a review of 148 dual-energy CT cases

    Energy Technology Data Exchange (ETDEWEB)

    Mallinson, Paul I. [Vancouver General Hospital, Radiology Department, Vancouver (Canada); Vancouver General Hospital, Clinical Fellow in Musculoskeletal Radiology, Vancouver, BC (Canada); Reagan, Adrian C.; Munk, Peter L.; Ouellette, Hugue; Nicolaou, Savvas [Vancouver General Hospital, Radiology Department, Vancouver (Canada); Coupal, Tyler [McMaster University, De Groote School of Medicine, Hamilton, Ontario (Canada)

    2014-03-15

    Clinical detection of gout can be difficult due to co-existent and mimicking arthropathies and asymptomatic disease. Understanding of the distribution of urate within the body can aid clinical diagnosis and further understanding of the resulting pathology. Our aim was to determine this distribution of urate within the extremities in patients with gout. All patients who underwent a four-limb dual-energy computed tomography (DECT) scan for suspected gout over a 2-year period were identified (n = 148, 121 male, 27 female, age range, 16-92 years, mean = 61.3 years, median = 63 years). The reports of the positive cases were retrospectively analyzed and the locations of all urate deposition recorded and classified by anatomical location. A total of 241 cases met the inclusion criteria, of which 148 cases were positive. Of these, 101 (68.2 %) patients had gout in the foot, 81 (56.1 %) in the knee, 79 (53.4 %) in the ankle, 41 (27.7 %) in the elbow, 25 (16.9 %) in the hand, and 25 (16.9 %) in the wrist. The distribution was further subcategorized for each body part into specific bone and soft tissue structures. In this observational study, we provide for the first time a detailed analysis of extremity urate distribution in gout, which both supports and augments to the current understanding based on clinical and microscopic findings. (orig.)

  19. Sustainability, Risk Society and Genetically Modified Foods: Definitions Disputes and the Bill Nº 4.148/08

    Directory of Open Access Journals (Sweden)

    Maria Claudia da Silva Antunes de Souza

    2016-10-01

    Full Text Available The paper has for object the analysis of the Bill n. 4.148/08, which significantly changes the way the labeling of GM foods, replacing the currently existing symbol by a phrase inserted between other label data. It is the goal of the reserach to show that this proposal, beyond a mere legislative amendment least, is embedded in a much larger context and is living proof of the hypothesis of Professor Ulrich Beck that socially recognized risks would be subject and object of definitions disputes much less depend on scientific knowledge of what actually the political game that involves power, money, information and media space. In addition, it follows the assertion  in response to the problem of the research  that, in the light of the sustainability paradigm, the PL 4.148/08 represents an environmental setback and itself a threat to the construction of this new ethical imperative. In the methodology we used the inductive method in the investigation phase; in the data processing phase the Cartesian method and in the research report was employed the inductive base. They were also triggered the techniques of reference, category, operational concepts, bibliographic research and book report.

  20. Study on the method for determination of the nuclear fuel elements burnout by the quantitative analysis of 148Nd

    International Nuclear Information System (INIS)

    Enoshita, Margarida

    1978-01-01

    The scope of present work to study the precision and accuracy of a method for separation and determination of the.stable isotope 148 Nd. The extraction chromatography and ion exchange techniques were used for the separation of fission products and uranium. Kieselguhr and di(2-ethyl-hexyl)phosphoric acid were used as inert support and stationary phase, respectively, in the steps of the separation procedure where the extraction chromatography technique was applied, and anionic resin mixed with Pb0 2 was used for the ion exchange operation. The behaviour of each element in the separation procedure was verified by means of radioactive tracers, namely, 147 Nd, 141 Ce and 137 Cs. Use was made of the thermal neutron activation analysis in order to determine the 148 Nd percentage recovered after the separation procedure was run. On the other hand, the radioactive isotope 147 Nd was used to find chemical yield achieved for the separation procedure. Student's t test applied to verify the accuracy of the method used whose acceptability was verified by using the criterion recommended by McFarren and also taking into account the suggestion proposed by Eckschlager. The precision of the method was verified by means of the standard deviation of the several determinations. (author)

  1. Identification of transcription factors ZmMYB111and ZmMYB148 involved in phenylpropanoid metabolism

    Directory of Open Access Journals (Sweden)

    Junjie eZhang

    2016-02-01

    Full Text Available Maize is the leading crop worldwide in terms of both planting area and total yields, but environmental stresses cause significant losses in productivity. Phenylpropanoid compounds play an important role in plant stress resistance; however, the mechanism of their synthesis is not fully understood, especially in regard to the expression and regulation of key genes. Phenylalanine ammonia-lyase (PAL is the first key enzyme involved in phenylpropanoid metabolism, and it has a significant effect on the synthesis of important phenylpropanoid compounds. According to the results of sequence alignments and functional prediction, we selected two conserved R2R3-MYB transcription factors as candidate genes for the regulation of phenylpropanoid metabolism. The two candidate R2R3-MYB genes, which we named ZmMYB111and ZmMYB148, were cloned, and then their structural characteristics and phylogenetic placement were predicted and analyzed. In addition, a series of evaluations were performed, including expression profiles, subcellular localization, transcription activation, protein-DNA interaction, and transient expression in maize endosperm. Our results indicated that both ZmMYB111 and ZmMYB148 are indeed R2R3-MYB transcription factors and that they may play a regulatory role in PAL gene expression.

  2. Osteosarcoma target therapy with stem cell transplant: A case review

    International Nuclear Information System (INIS)

    Fawzy, A.

    2005-01-01

    Full text: Radioisotopes with medium-energy beta emission and half life of a few days are attractive option for systemic delivery of targeted irradiation. Samarium-153 ethylene diamine tetra-ethylene phosphonale (153Sm-EDTMP), a bone-seeking radiopharmaceutical, provides therapeutic irradiation to osteoblastic osseous lesion. The usual dose of Sm-153 in metastatic disease is 1mCi/Kg (37MBq/Kg) and the dose limiting toxicity is thrombocytopenia. As local radiotherapy has only a limited therapeutic role in the treatment of osteosarcoma, and some types of the tumour portray an unpredictable response to chemotherapy. High dose Sm-153 (30mCi/Kg) was proposed for the target management of recurrent osteosarcoma, this was followed by stem cell transplant (peripheral-blood progenitor, PBPCs). A female child, 10 years old, with polyostotic osteosarcoma with local recurrence in the right hipbone was chosen for therapy. She had left knee prosthesis, right lower limb dis-articulation, and was given chemotherapy in multiple regions. She was subjected to MDP bone scan showing active uptake in an expanding bone lesion in the right hip bone, and was also subjected to MIBI scan, which showed negative uptake. She received 30mCi/Kg Sm-153 (660mCi in total dose), with no major events occurring in the post-injection period. After 10 days the patient went into pancytopenia, which necessitated haematological support. By day 14, there was minimal radiation in the whole body image and the child received her bone marrow transplant. There was marked improvement in the tumour size after 6 weeks of therapy, with improvement in the alkaline phosphatase level (from 1350Iu, before treatment to 350 post treatment). This was confirmed by serial MDP bone scan. High dose Sm-153 with stem cell transplant is considered view a promising method in the management of osteosarcoma. (author)

  3. Myxoid Liposarcoma: Prognostic Factors and Metastatic Pattern in a Series of 148 Patients Treated at a Single Institution

    Directory of Open Access Journals (Sweden)

    Francesco Muratori

    2018-01-01

    Full Text Available Objectives. The authors reported a retrospective study on myxoid liposarcomas (MLs, evaluating factors that may influence overall survival (OS, local recurrence-free survival (LRFS, metastasis-free survival (MFS, and analyzing the metastatic pattern. Methods. 148 MLs were analyzed. The sites of metastases were investigated. Results. Margins (p = 0.002, grading (p = 0,0479, and metastasis (p < 0,0001 were significant risk factors affecting overall survival (OS. Type of presentation (p = 0.0243, grading (p = 0,0055, margin (p = 0.0001, and local recurrence (0.0437 were risk factors on metastasis-free survival (MFS. Authors did not observe statistically significant risk factors for local recurrence-free survival (LRFS and reported 55% extrapulmonary metastases and 45% pulmonary metastases. Conclusion. Margins, grading, presentation, local recurrence, and metastasis were prognostic factors. Extrapulmonary metastases were more frequent in myxoid liposarcoma.

  4. Study of the flux attenuation and energy degradation of 14.8 MeV neutrons in different materials

    International Nuclear Information System (INIS)

    Boufraqech, A.

    1981-01-01

    The attenuation of 14.8 MeV neutrons has been determined using the 63-Cu(n,2n)62-Cu threshold reaction for the detection of the primary neutrons. The attenuation of primary flux in different materials can be well described by a simple exponential relation based on the removal cross section. The microscopic removal cross sections determined for graphite, aluminium, iron and lead are as follows 0.73 +- 0.04, 1.04 +-0.04, 1.41 +- 0.02 and 2.63 +- 0.12 barn respectively. The dependance of secondary neutron spectrum on the thickness of slabs has also been investigated by threshold detectors. 15 refs., 38 figs., 23 tabs. (author)

  5. V79 survival following simultaneous or sequential irradiation by 14.8-MeV neutrons and 60Co photons

    International Nuclear Information System (INIS)

    Higgins, P.D.; DeLuca, P.M. Jr.; Pearson, D.W.; Gould, M.N.

    1981-01-01

    A unique tandem source irradiation facility, comprised of an intense d-T neutron source and a 60 Co teletherapy unit, has been used to investigate biological response for different neutron/photon configurations. V79 Chinese hamster cells, attached as monolayers in log phase growth, were irradiated at 37 0 C by either 14.8 MeV neutrons, 60 Co or by a mixture of 40% neutrons - 60% photons in simultaneous or sequential application. Measurements of cell survival indicate an increased effectiveness in cell killing for simultaneously administered neutrons and photons than was measured or predicted for sequentially applied beam modalities. An understanding of the magnitude of these interactive effects is important both for calculating accurate effective doses for neutron radiotherapy of deep-seated tumors, for which the photon component is appreciable and for determination of environmental hazards to people occupationally exposed to low levels of photons and neutrons

  6. Results of the independent verification of radiological remedial action at 148 East 4th South Street, Monticello, Utah (MS00087)

    International Nuclear Information System (INIS)

    Crutcher, J.W.; Smuin, M.W.

    1989-12-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1984, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 148 East 4th South Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  7. Structural and superconducting properties of (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} grown by MOCVD on samarium zirconate buffered IBAD-MgO

    Energy Technology Data Exchange (ETDEWEB)

    Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X [Los Alamos National Laboratory, PO Box 1663, Los Alamos, NM 87545 (United States); Chen, Y; Selvamanickam, V [SuperPower, Incorporated, 450 Duane Avenue, Schenectady, NY 12304 (United States)

    2008-10-01

    Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 {mu}m thick (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9{sup 0} and 3.4{sup 0} for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J{sub c}) of over 2 MA cm{sup -2} at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J{sub c} and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd){sub 2}O{sub 3} particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes.

  8. Energy Dependence of Fission Product Yields from 235U, 238U and 239Pu for Incident Neutron Energies Between 0.5 and 14.8 MeV

    Science.gov (United States)

    Gooden, M. E.; Arnold, C. W.; Becker, J. A.; Bhatia, C.; Bhike, M.; Bond, E. M.; Bredeweg, T. A.; Fallin, B.; Fowler, M. M.; Howell, C. R.; Kelley, J. H.; Krishichayan; Macri, R.; Rusev, G.; Ryan, C.; Sheets, S. A.; Stoyer, M. A.; Tonchev, A. P.; Tornow, W.; Vieira, D. J.; Wilhelmy, J. B.

    2016-01-01

    Fission Product Yields (FPY) have historically been one of the most observable features of the fission process. They are known to have strong variations that are dependent on the fissioning species, the excitation energy, and the angular momentum of the compound system. However, consistent and systematic studies of the variation of these FPY with energy have proved challenging. This is caused primarily by the nature of the experiments that have traditionally relied on radiochemical procedures to isolate specific fission products. Although radiochemical procedures exist that can isolate all products, each element presents specific challenges and introduces varying degrees of systematic errors that can make inter-comparison of FPY uncertain. Although of high importance in fields such as nuclear forensics and Stockpile Stewardship, accurate information about the energy dependence of neutron induced FPY are sparse, due primarily to the lack of suitable monoenergetic neutron sources. There is a clear need for improved data, and to address this issue, a collaboration was formed between Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL) and the Triangle Universities Nuclear Laboratory (TUNL) to measure the energy dependence of FPY for 235U, 238U and 239Pu. The measurements have been performed at TUNL, using a 10 MV Tandem Van de Graaff accelerator to produce monoenergetic neutrons at energies between 0.6 MeV to 14.8 MeV through a variety of reactions. The measurements have utilized a dual-fission chamber, with thin (10-100 μg/cm2) reference foils of similar material to a thick (100-400 mg) activation target held in the center between the chambers. This method allows for the accurate determination of the number of fissions that occurred in the thick target without requiring knowledge of the fission cross section or neutron fluence on target. Following activation, the thick target was removed from the dual-fission chamber and gamma

  9. Energy Dependence of Fission Product Yields from {sup 235}U, {sup 238}U and {sup 239}Pu for Incident Neutron Energies Between 0.5 and 14.8 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Gooden, M.E., E-mail: m_gooden@lanl.gov [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Arnold, C.W. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Becker, J.A. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States); Bhatia, C. [McMaster University, Ontario (Canada); Bhike, M. [Department of Physics, Duke University,Durham, North Carolina 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 (United States); Bond, E.M.; Bredeweg, T.A. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Fallin, B. [Department of Physics, Duke University,Durham, North Carolina 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 (United States); Fowler, M.M. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Howell, C.R. [Department of Physics, Duke University,Durham, North Carolina 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 (United States); Kelley, J.H. [Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 (United States); Department of Physics, North Carolina State University, Raleigh, North Carolina 27605 (United States); Krishichayan [Department of Physics, Duke University,Durham, North Carolina 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 (United States); Macri, R. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States); Rusev, G. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Ryan, C.; Sheets, S.A.; Stoyer, M.A.; Tonchev, A.P. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States); Tornow, W. [Department of Physics, Duke University,Durham, North Carolina 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 (United States); and others

    2016-01-15

    Fission Product Yields (FPY) have historically been one of the most observable features of the fission process. They are known to have strong variations that are dependent on the fissioning species, the excitation energy, and the angular momentum of the compound system. However, consistent and systematic studies of the variation of these FPY with energy have proved challenging. This is caused primarily by the nature of the experiments that have traditionally relied on radiochemical procedures to isolate specific fission products. Although radiochemical procedures exist that can isolate all products, each element presents specific challenges and introduces varying degrees of systematic errors that can make inter-comparison of FPY uncertain. Although of high importance in fields such as nuclear forensics and Stockpile Stewardship, accurate information about the energy dependence of neutron induced FPY are sparse, due primarily to the lack of suitable monoenergetic neutron sources. There is a clear need for improved data, and to address this issue, a collaboration was formed between Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL) and the Triangle Universities Nuclear Laboratory (TUNL) to measure the energy dependence of FPY for {sup 235}U, {sup 238}U and {sup 239}Pu. The measurements have been performed at TUNL, using a 10 MV Tandem Van de Graaff accelerator to produce monoenergetic neutrons at energies between 0.6 MeV to 14.8 MeV through a variety of reactions. The measurements have utilized a dual-fission chamber, with thin (10-100 μg/cm2) reference foils of similar material to a thick (100-400 mg) activation target held in the center between the chambers. This method allows for the accurate determination of the number of fissions that occurred in the thick target without requiring knowledge of the fission cross section or neutron fluence on target. Following activation, the thick target was removed from the dual-fission chamber

  10. Nuclei far from stability using exotic targets

    International Nuclear Information System (INIS)

    Wilhelmy, J.B.; Bentley, C.E.; Thomas, K.E.; Brown, R.E.; Flynn, E.R.; Van der Plicht, J.; Mann, L.G.; Struble, G.L.

    1981-01-01

    The meson factories such as the Los Alamos Meson Physics Facility have made possible high fluence medium energy proton beams that can be used for spallation reactions to produce macro quantities of unstable isotopes. Targets of over 10 g/cm 2 can be exposed to total fluence approaching 1 A-hour resulting in spallation yields in the 0.01-10 mg range for many isotopes of potential interest for nuclear structure studies. With the use of hot cell facilities, chemical processing can isolate the desired material and this coupled with subsequent isotope separation can result in usable quantities of material for nuclear target applicaton. With offstable isotopes are target materials, conventional nuclear spectroscopy techniques can be employed to study nuclei far from stability. The irradiation and processing requirements for such an operation, along with the isotope production possibilities, are discussed. Also presented are initial experiments using a 148 Gd (tsub(1/2) = 75a) target to perform the (p,t) reaction to extablish levels in the proposed double magic nucleus 146 Gd. (orig.)

  11. Isolation of a random cosmid clone, cX5, which defines a new polymorphic locus DXS148 near the locus for Duchenne muscular dystrophy

    NARCIS (Netherlands)

    Hofker, M. H.; Bergen, A. A.; Skraastad, M. I.; Bakker, E.; Francke, U.; Wieringa, B.; Bartley, J.; van Ommen, G. J.; Pearson, P. L.

    1986-01-01

    We have isolated a random cosmid cX5 (DXS148), which maps into a small Xp21 deletion associated with Duchenne muscular dystrophy (DMD), chronic granulomatous disease (CGD), retinitis pigmentosa (RP) and McLeod syndrome, cX5 maps proximally outside several other deletions associated with DMD,

  12. 33 CFR 148.707 - What type of criteria will be used in an environmental review and how will they be applied?

    Science.gov (United States)

    2010-07-01

    ...: GENERAL Environmental Review Criteria for Deepwater Ports § 148.707 What type of criteria will be used in... patterns; (3) The potential risks to a deepwater port from waves, winds, weather, and geological conditions... children from environmental health and safety risks. ...

  13. 25 CFR 900.148 - How can an Indian tribe or tribal organization secure a determination that a law or regulation...

    Science.gov (United States)

    2010-04-01

    ... determination that a law or regulation has been superseded by the Indian Self-Determination Act, as specified in... SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Waiver Procedures § 900.148 How can an Indian tribe or tribal organization secure a determination that a law or regulation has been superseded by the Indian...

  14. Corrections to the 148Nd method of evaluation of burnup for the PIE samples from Mihama-3 and Genkai-1 reactors

    International Nuclear Information System (INIS)

    Suyama, Kenya; Mochizuki, Hiroki

    2006-01-01

    The value of the burnup is one of the most important parameters of samples taken by post-irradiation examination (PIE). Generally, it is evaluated by the Neodymium-148 method. Precise evaluation of the burnup value requires: (1) an effective fission yield of 148 Nd; (2) neutron capture reactions of 147 Nd and 148 Nd; (3) a conversion factor from fissions per initial heavy metal to the burnup unit GWd/t. In this study, the burnup values of the PIE data from Mihama-3 and Genkai-1 PWRs, which were taken by the Japan Atomic Energy Research Institute, were re-evaluated using more accurate corrections for each of these three items. The PIE data were then re-analyzed using SWAT and SWAT2 code systems with JENDL-3.3 library. The re-evaluation of the effective fission yield of 148 Nd has an effect of 1.5-2.0% on burnup values. Considering the neutron capture reactions of 147 Nd and 148 Nd removes dependence of C/E values of 148 Nd on the burnup value. The conversion factor from FIMA(%) to GWd/t changes according to the burnup value. Its effect on the burnup evaluation is small for samples having burnup of larger than 30 GWd/t. The analyses using the corrected burnup values showed that the calculated 148 Nd concentrations and the PIE data is approximately 1%, whereas this was 3-5% in prior analyses. This analysis indicates that the burnup values of samples from Mihama-3 and Genkai-1 PWRs should be corrected by 2-3%. The effect of re-evaluation of the burnup value on the neutron multiplication factor is an approximately 0.6% change in PIE samples having the burnup of larger than 30 GWd/t. Finally, comparison between calculation results using a single pin-cell model and an assembly model is carried out. Because the results agreed with each other within a few percent, we concluded that the single pin-cell model is suitable for the analysis of PIE samples and that the underestimation of plutonium isotopes, which occurred in the previous analyses, does not result from a geometry

  15. Corrections to the {sup 148}Nd method of evaluation of burnup for the PIE samples from Mihama-3 and Genkai-1 reactors

    Energy Technology Data Exchange (ETDEWEB)

    Suyama, Kenya [Fuel Cycle Facility Safety Research Group, Nuclear Safety Research Center, Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan)]. E-mail: suyama.kenya@jaea.go.jp; Mochizuki, Hiroki [Japan Research Institute, Limited, 16 Ichiban-cho, Chiyoda-ku, Tokyo 102-0082 (Japan)

    2006-03-15

    The value of the burnup is one of the most important parameters of samples taken by post-irradiation examination (PIE). Generally, it is evaluated by the Neodymium-148 method. Precise evaluation of the burnup value requires: (1) an effective fission yield of {sup 148}Nd; (2) neutron capture reactions of {sup 147}Nd and {sup 148}Nd; (3) a conversion factor from fissions per initial heavy metal to the burnup unit GWd/t. In this study, the burnup values of the PIE data from Mihama-3 and Genkai-1 PWRs, which were taken by the Japan Atomic Energy Research Institute, were re-evaluated using more accurate corrections for each of these three items. The PIE data were then re-analyzed using SWAT and SWAT2 code systems with JENDL-3.3 library. The re-evaluation of the effective fission yield of {sup 148}Nd has an effect of 1.5-2.0% on burnup values. Considering the neutron capture reactions of {sup 147}Nd and {sup 148}Nd removes dependence of C/E values of {sup 148}Nd on the burnup value. The conversion factor from FIMA(%) to GWd/t changes according to the burnup value. Its effect on the burnup evaluation is small for samples having burnup of larger than 30 GWd/t. The analyses using the corrected burnup values showed that the calculated {sup 148}Nd concentrations and the PIE data is approximately 1%, whereas this was 3-5% in prior analyses. This analysis indicates that the burnup values of samples from Mihama-3 and Genkai-1 PWRs should be corrected by 2-3%. The effect of re-evaluation of the burnup value on the neutron multiplication factor is an approximately 0.6% change in PIE samples having the burnup of larger than 30 GWd/t. Finally, comparison between calculation results using a single pin-cell model and an assembly model is carried out. Because the results agreed with each other within a few percent, we concluded that the single pin-cell model is suitable for the analysis of PIE samples and that the underestimation of plutonium isotopes, which occurred in the previous

  16. Magnetic and structural properties of the magnetic shape memory compound Ni2Mn1.48Sb0.52

    International Nuclear Information System (INIS)

    Brown, P J; Gandy, A P; Neumann, K U; Sheikh, A; Ziebeck, K R A; Ishida, K; Oikawa, K; Ito, W; Kainuma, R; Kanomata, T; Ouladdiaf, B

    2010-01-01

    Magnetization and high resolution neutron powder diffraction measurements on the magnetic shape memory compound Ni 2 Mn 1.48 Sb 0.52 have confirmed that it is ferromagnetic below 350 K and undergoes a structural phase transition at T M ∼310 K. The high temperature phase has the cubic L2 1 structure with a = 5.958 A, with the excess manganese atoms occupying the 4(b) Sb sites. In the cubic phase above ∼310 K the manganese moments are ferromagnetically aligned. The magnetic moment at the 4(a) site is 1.57(12) μ B and it is almost zero (0.15(9) μ B ) at the 4(b) site. The low temperature orthorhombic phase which is only fully established below 50 K has the space group Pmma with a cell related to the cubic one by a Bain transformation a orth = (a cub + b cub )/2; b orth = c cub and c orth = (a cub - b cub ). The change in cell volume is ∼2.5%. The spontaneous magnetization of samples cooled in fields less than 0.5 T decreases at temperatures below T M and at 2 K the magnetic moment per formula unit in fields up to 5.5 T is 2.01(5) μ B . Neutron diffraction patterns obtained below ∼132 K gave evidence for a weak incommensurate magnetic modulation with propagation vector (2/3, 1/3, 0).

  17. Radiotoxicity of gadolinium-148 and radium-223 in mouse testes: Relative biological effectiveness of alpha-particle emitters in vivo

    International Nuclear Information System (INIS)

    Howell, R.W.; Goddu, S.M.; Narra, V.R.

    1997-01-01

    The biological effects of radionuclides that emit α particles are of considerable interest in view of their potential for therapy and their presence in the environment. The present work is a continuation of our ongoing effort to study the radiotoxicity of α-particle emitters in vivo using the survival of murine testicular sperm heads as the biological end point. Specifically, the relative biological effectiveness (RBE) of very low-energy α particles (3.2 MeV) emitted by 148 Gd is investigated and determined to be 7.4 ± 2.4 when compared to the effects of acute external 120 kVp X rays. This datum, in conjunction with our earlier results for 210 Po and 212 Pb in equilibrium with its daughters, is used to revise and extend the range of validity of our previous RBE-energy relationship for α particles emitted by tissue-incorporated radionuclides. The new empirical relationship is given by RBE α = 9.14 - 0.510 E α , where 3 α 223 Ra (in equilibrium with its daughters) experimentally in the same biological model and comparing the value obtained experimentally with the predicted value. The resulting RBE values are 5.4 ± 0.9 and 5.6, respectively. This close agreement strongly supports the adequacy of the empirical RBE-E α relationship to predict the biological effects of α-particle emitters in vivo. 42 refs., 5 figs., 1 tab

  18. The Atacama Cosmology Telescope: Sunyaev-Zel'dovich-Selected Galaxy Clusters AT 148 GHz in the 2008 Survey

    Science.gov (United States)

    Marriage, Tobias A.; Acquaviva, Viviana; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John William; Barrientos, L. Felipe; Battistelli, Elia S.; Bond, J. Richard; Brown, Ben; hide

    2011-01-01

    We report on 23 clusters detected blindly as Sunyaev-Zel'dovich (SZ) decrements in a 148 GHz, 455 deg (exp 2) map of the southern sky made with data from the Atacama Cosmology Telescope 2008 observing season. All SZ detections announced in this work have confirmed optical counterparts. Ten of the clusters are new discoveries. One newly discovered cluster, ACT-CL 10102-4915, with a redshift of 0.75 (photometric), has an SZ decrement comparable to the most massive systems at lower redshifts. Simulations of the cluster recovery method reproduce the sample purity measured by optical follow-up. In particular, for clusters detected with a signal-to-noise ratio greater than six, simulations are consistent with optical follow-up that demonstrated this subsample is 100% pure, The simulations further imply that the total sample is 80% complete for clusters with mass in excess of 6 x 10(exp 14) solar masses referenced to the cluster volume characterized by 500 times the critical density. The Compton gamma-X-ray luminosity mass comparison for the 11 best-detected clusters visually agrees with both self-similar and non-adiabatic, simulation-derived scaling laws,

  19. [Comorbidity in panic disorders and alcoholism (II). Alcoholism in a sample of 148 patients with panic disorders].

    Science.gov (United States)

    Segui, J; Salvador, L; Canet, J; Aragón, C; Herrera, C

    1995-01-01

    Among 148 patients presenting Panic Disorder (DSM-III-R), 18.9% have an alcohol disorder, 8.8% present abuse and 10.1% dependence. Mean age of onset of alcoholism was much earlier than panic disorder. Patients with alcoholism: a) are males more frequently (0.001); b) present more alcoholism in first grade relatives (0.05); c) use more often other drugs like: tobacco (0.01), coffee (p cannabis (p < 0.001), d) patients with alcoholism refer a greater severity of their panic attacks when drinking large amounts of alcohol (25%) than the group without these problems (2.5%) (x2:14.8) (p < 0.001) e) according to the GAS the overall level of performance is lower in alcoholics (p < 0.005); f) present more anxiety measured by the HARS (p < 0.01), and therefore have more comorbid anxiety disorders according to DSM-III-R (p < 0.01). The clinical significance of these findings is discussed.

  20. 1.48 GHz (34.8 T) ^1H NMR measurements of SDW fluctuations in (TMTSF)_2PF_6

    Science.gov (United States)

    Clark, W. G.; Vonlanthen, P.; Goto, A.; Tanaka, K. B.; Alavi, B.; Kuhns, P.; Reyes, A. P.; Moulton, W. G.

    2001-03-01

    We report ^1H spin-lattice relaxation rate (T_1-1) measurements that probe the spin-density-wave (SDW) fluctuations in the quasi 1-d system (TMTSF)_2PF6 up to 1.48 GHz (34.8 T) in the NHMFL hybrid magnet. In the critical regime above the SDW transition near 12 K, T_1-1 has no frequency dependence and the angular dependence of T_1-1 attributed to the spin-flop condition in the ordered phase is absent. These results indicate that amplitude fluctuations of the SDW drive T_1-1 in the critical regime and that the SDW critical fluctuation correlation time is <1× 10-10 s. Somewhat below the transition, T_1-1 continues the decrease with increasing NMR frequency observed at lower frequencies. We attribute it to the power spectrum of the SDW phason fluctuations. The dependence of T_1-1 upon the field orientation in this phase reflects the spin-flop condition, but with parameters that are different from the expected ones. The UCLA part of this work was supported by NSF Grants DMR-9705369 and DMR-0072524.

  1. Starch-fueled microbial fuel cells by two-step and parallel fermentation using Shewanella oneidensis MR-1 and Streptococcus bovis 148.

    Science.gov (United States)

    Uno, Megumi; Phansroy, Nichanan; Aso, Yuji; Ohara, Hitomi

    2017-08-01

    Shewanella oneidensis MR-1 generates electricity from lactic acid, but cannot utilize starch. On the other hand, Streptococcus bovis 148 metabolizes starch and produces lactic acid. Therefore, two methods were trialed for starch-fueled microbial fuel cell (MFC) in this study. In electric generation by two-step fermentation (EGT) method, starch was first converted to lactic acid by S. bovis 148. The S. bovis 148 were then removed by centrifugation, and the fermented broth was preserved for electricity generation by S. oneidensis MR-1. Another method was electric generation by parallel fermentation (EGP) method. In this method, the cultivation and subsequent fermentation processes of S. bovis 148 and S. oneidensis MR-1 were performed simultaneously. After 1, 2, and 3 terms (5-day intervals) of S. oneidensis MR-1 in the EGT fermented broth of S. bovis 148, the maximum currents at each term were 1.8, 2.4, and 2.8 mA, and the maximum current densities at each term were 41.0, 43.6, and 49.9 mW/m 2 , respectively. In the EGP method, starch was also converted into lactic acid with electricity generation. The maximum current density was 140-200 mA/m 2 , and the maximum power density of this method was 12.1 mW/m 2 . Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  2. Increasing of miR-148a 0061nd Decreasing of miR-146a Gene Expression in the Stomach with Ageing in Men

    Directory of Open Access Journals (Sweden)

    Shirin Abdolvand

    2017-06-01

    Full Text Available Abstract Background: The incidence of gastric cancer is different in two sexes with ratio 2 to 1 that it is more common in men. The most important biologically reason is sexual hormones between two sexes that lead to sexual dimorphism and in turn can cause a sex bias in incidence of disease between two sexes. Recently, studies have shown that microRNA is involved in sexual dimorphism in gene expression. Given the sexual dimorphism in the incidence of gastric cancer and sex hormones response elements in the regulatory regions of miR-146a and miR-148a genes, in this study, the expression of these two genes in the stomach of healthy men and women at different age groups were compared. Materials and Methods: Using endoscopy, gastric antrum tissues of 35 healthy women and 35 healthy men were collected. After RNA extraction and synthesis of cDNA, the expression of miR-146a and miR-148a genes were compared between sexes by Real time RT-PCR and data were analyzed using independent sample t and ANOVA tests. Results: There was no difference between men and women in genes expression of miR-146a and miR-148a. However, expression of miR-146a gene was significantly more in men under 45 years than men over 45 years (p= 0.017, df= 14, t= 1.47. Also, expression of miR-148a gene was significantly more in men over 45 years than men under 45 years (p=0.001, df= 12, t= 1.28. But the expression of both genes had no significant difference between women under 45 years and women over 45 years. Conclusion: Expression of miR-146a and miR-148a genes in the stomach is increased and decreased with aging in men, respectively.

  3. Triangulated categories (AM-148)

    CERN Document Server

    Neeman, Amnon

    2014-01-01

    The first two chapters of this book offer a modern, self-contained exposition of the elementary theory of triangulated categories and their quotients. The simple, elegant presentation of these known results makes these chapters eminently suitable as a text for graduate students. The remainder of the book is devoted to new research, providing, among other material, some remarkable improvements on Brown''s classical representability theorem. In addition, the author introduces a class of triangulated categories""--the ""well generated triangulated categories""--and studies their properties. This

  4. Analysis and modeling of low voltage electrical network at power line carrier frequencies (3-148.5 kHz); Analyse et modelisation du reseau basse tension aux frequences courants porteurs (3 KHZ-148,5 KHZ)

    Energy Technology Data Exchange (ETDEWEB)

    Duval, G.

    1998-07-01

    Electricite de France (EdF) wishes to establish a physical communication link between his clients and the EdF centres. The final link, i.e. between the high/low voltage transformation substation and the residential clients, being ensured by carrier currents. With this aim, an analysis and a modeling of the low voltage network at the carrier frequencies (3 kHz - 148.5 kHz) has been performed. This work has been carried out in parallel with an experiment involving 3500 apparatuses that use carrier currents. The diversity of the French low voltage networks and the limitations imposed by the EN50065-1 standard about the use of carrier currents in Europe do not favour the development of such carrier current systems. Disturbing voltages and localized impedances represent the main difficulties to get round. Inside accommodations, domotic carrier currents have a reduced range but a higher disturbance amplitude because of the proximity of appliances. A differential mode to common mode conversion phenomenon has been evidenced which generates network couplings and important electromagnetic fields. Energy lines and cables have been analyzed using numerical models. Load peaks have been analyzed using statistical tools in order to take into account the daily fluctuations. The modeling of the network is made in two steps: a double-wire model is considered first. Then a three-phase model is developed which analyzes the inter-phases coupling and the effect of the distribution of clients' loads on each phase. The results of this model are conformable with measurements except for underground networks. As perspectives of future works and beyond todays standard framework, the techniques that allow a sensible increase of communication flow rates have been reviewed. (J.S.)

  5. The outcome and prognosis factors of adolescent nasopharyngeal carcinoma treated in a single institute-analysis of 148 patients

    International Nuclear Information System (INIS)

    Pei Su; Gao Li; Yi Junlin

    2011-01-01

    Objective: To evaluate the clinical characteristics, outcome and prognostic factors of adolescent nasopharyngeal carcinoma. Methods: Between Jan 1990 and Dec 2009, totally 148 pathological confirmed nasopharyngeal carcinoma (NPC) patients with age ≤20 years were treated in our hospital, including stage II 8, stage III 58, stage IV 81, and unknown 1 when restaged by TNM system (UICC 2002), ninety-four (63.5%) patients were treated with radiotherapy alone, 54 (36.5%)patients were treated with radiotherapy combined with cisplatin-based chemotherapy. Results: The median follow-up time for all patients was 44.5 months. The 5-year overall survival (OS), local-regional control (LRC) and distant metastasis-free survival (DMFS) rates were 82.9%, 85.1% and 78.6%. There were 42 patients (28.4%) failed with 16 regional recurrence and 29 distant metastasis, and 3 with both; bone metastasis was the most common site of distant metastasis(22/29). In univariate analysis,the adverse prognostic factors for OS were stage T 4 (χ 2 =5.61, P=0.018), radiation dose 2 =5.30, P=0.021), for LRC was radiation dose 2 =4.24, P=0.039). In multivariate analysis, radiation dose 4 were the independent prognostic factors for OS (χ 2 =5.73, 5.56, P=0.017, 0.018), for LRC was radiation dose 2 =5.81, P=0.016). Conclusions: The outcome of the present series was excellent, total nasopharyngeal radiation dose less than 70 Gy is inappropriate. Reduce the distant metastasis and late toxicities were the future direction for the treatment of adolescent nasopharyngeal carcinoma. (authors)

  6. Perovskite/silicon-based heterojunction tandem solar cells with 14.8% conversion efficiency via adopting ultrathin Au contact

    Science.gov (United States)

    Fan, Lin; Wang, Fengyou; Liang, Junhui; Yao, Xin; Fang, Jia; Zhang, Dekun; Wei, Changchun; Zhao, Ying; Zhang, Xiaodan

    2017-01-01

    A rising candidate for upgrading the performance of an established narrow-bandgap solar technology without adding much cost is to construct the tandem solar cells from a crystalline silicon bottom cell and a high open-circuit voltage top cell. Here, we present a four-terminal tandem solar cell architecture consisting of a self-filtered planar architecture perovskite top cell and a silicon heterojunction bottom cell. A transparent ultrathin gold electrode has been used in perovskite solar cells to achieve a semi-transparent device. The transparent ultrathin gold contact could provide a better electrical conductivity and optical reflectance-scattering to maintain the performance of the top cell compared with the traditional metal oxide contact. The four-terminal tandem solar cell yields an efficiency of 14.8%, with contributions of the top (8.98%) and the bottom cell (5.82%), respectively. We also point out that in terms of optical losses, the intermediate contact of self-filtered tandem architecture is the uppermost problem, which has been addressed in this communication, and the results show that reducing the parasitic light absorption and improving the long wavelength range transmittance without scarifying the electrical properties of the intermediate hole contact layer are the key issues towards further improving the efficiency of this architecture device. Project supported by the International Cooperation Projects of the Ministry of Science and Technology (No. 2014DFE60170), the National Natural Science Foundation of China (Nos. 61474065, 61674084), the Tianjin Research Key Program of Application Foundation and Advanced Technology (No. 15JCZDJC31300), the Key Project in the Science & Technology Pillar Program of Jiangsu Province (No. BE2014147-3), and the 111 Project (No. B16027).

  7. Rayleigh SAW-Assisted SH-SAW Immunosensor on X-Cut 148-Y LiTaO3.

    Science.gov (United States)

    Kogai, Takashi; Yatsuda, Hiromi; Kondoh, Jun

    2017-09-01

    In this paper, we describe a shear horizontal surface acoustic wave (SH-SAW) immunosensor that utilizes induce agitation by a Rayleigh SAW (R-SAW) on an X-cut 148-Y LiTaO 3 substrate. On this substrate, SH-SAWs and R-SAWs with different frequencies can be effectively generated at an interdigital transducer (IDT). First, to consider the power flow angles of SH-SAWs and R-SAWs on this substrate, the 360-MHz delay lines with six different tilt angles were designed and fabricated. From the experiments, an optimal power flow angle of 9° for the SH-SAW on this substrate is obtained. Second, in order to consider the immunoreactions of the SH-SAW immunosensors, a delay line with a tilt angle of 9° was designed and fabricated on this substrate. The delay line, which can generate two SAWs, namely, a 100-MHz SH-SAW and an 88.8-MHz R-SAW, has a propagation area covered with antigens of human serum albumin between transmitting and receiving IDTs. The immunoreactions caused by antigen-antibody binding events on the surface of the delay line were investigated on the basis of the velocity changes of the SH-SAWs for sensing with and without the assistance of an R-SAW. As a result, it was confirmed that the SH-SAW velocity changes due to antigen-antibody reactions can be markedly increased by the assistance of R-SAW agitation.

  8. A comparison of the free vacancy production in α brass by fission reactor neutrons and 14.8-MeV neutrons

    International Nuclear Information System (INIS)

    Damask, A.C.; Van Konynenburg, R.; Borg, R.J.; Dienes, G.J.

    1976-01-01

    Enhancement of substitutional diffusion is observed in α brass (30 wt% Zn) by following the decrease in electrical resistivity with neutron irradiation of a thermally equilibrated alloy; the decrease arises from the increase in short-range order. It was determined by previous research that this diffusion enhancement is largely caused by the annealling of radiation-produced vacancies in excess of the thermal equilibrium concentration. Therefore, the results reported here are based upon a well-established technique. The rate of resistivity change per neutron of different energies will give the relative number of free vacancies produced per neutron. This experiment compares the effect of 14.8 MeV neutrons with neutrons from a fission reactor. The results indicate that 14.8 MeV neutrons produce 10 +- 2 times as many free vacancies as reactor neutrons when the latter are expressed in terms of those neutrons with energies greater than 0.1 MeV. (author)

  9. Heavy-ion targets

    International Nuclear Information System (INIS)

    Adair, H.L.; Kobisk, E.H.

    1985-01-01

    This chapter examines the characteristics of targets required in heavy-ion accelerator physics experiments. The effects of target parameters on heavy-ion experimental results are reviewed. The target fabrication and characterization techniques used to minimize experimental problems during heavy-ion bombardment are described. Topics considered include target thickness and uniformity, target lifetime, target purity, substrate materials, Doppler shift effects, metal preparations, and target preparation methods

  10. Contribution of ARLTS1 Cys148Arg (T442C variant with prostate cancer risk and ARLTS1 function in prostate cancer cells.

    Directory of Open Access Journals (Sweden)

    Sanna Siltanen

    Full Text Available ARLTS1 is a recently characterized tumor suppressor gene at 13q14.3, a region frequently deleted in both sporadic and hereditary prostate cancer (PCa. ARLTS1 variants, especially Cys148Arg (T442C, increase susceptibility to different cancers, including PCa. In this study the role of Cys148Arg substitution was investigated as a risk factor for PCa using both genetic and functional analysis. Cys148Arg genotypes and expression of the ARLTS1 were explored in a large set of familial and unselected PCa cases, clinical tumor samples, xenografts, prostate cancer cell lines and benign prostatic hyperplasia (BPH samples. The frequency of the variant genotype CC was significantly higher in familial (OR = 1.67, 95% CI = 1.08-2.56, P = 0.019 and unselected patients (OR = 1.52, 95% CI = 1.18-1.97, P = 0.001 and the overall risk was increased (OR = 1.54, 95% CI = 1.20-1.98, P = 0.0007. Additional analysis with clinicopathological data revealed an association with an aggressive disease (OR = 1.28, 95% CI = 1.05-∞, P = 0.02. The CC genotype of the Cys148Arg variant was also contributing to the lowered ARLTS1 expression status in lymphoblastoid cells from familial patients. In addition significantly lowered ARLTS1 expression was observed in clinical tumor samples compared to BPH samples (P = 0.01. The ARLTS1 co-expression signature based on previously published microarray data was generated from 1587 cancer samples confirming the low expression of ARLTS1 in PCa and showed that ARLTS1 expression was strongly associated with immune processes. This study provides strong confirmation of the important role of ARLTS1 Cys148Arg variant as a contributor in PCa predisposition and a potential marker for aggressive disease outcome.

  11. Downregulated microRNA-148b in circulating PBMCs in chronic myeloid leukemia patients with undetectable minimal residual disease: a possible biomarker to discontinue imatinib safely

    Directory of Open Access Journals (Sweden)

    Ohyashiki JH

    2014-08-01

    Full Text Available Junko H Ohyashiki,1 Kazushige Ohtsuki,1 Izuru Mizoguchi,2 Takayuki Yoshimoto,2 Seiichiro Katagiri,3 Tomohiro Umezu,1,4 Kazuma Ohyashiki3,4 1Department of Molecular Oncology, Institute of Medical Science, 2Department of Immunoregulation, Institute of Medical Science, 3Department of Hematology, 4Department of Molecular Science, Tokyo Medical University, Tokyo, Japan Background: A subset of patients with chronic myeloid leukemia (CML can sustain a complete molecular response after discontinuing imatinib mesylate (IM. We focused on microRNAs (miRNAs, with the aim of finding a molecular biomarker to discriminate which patients can safely and successfully discontinue IM use. Methods: To identify miRNAs that showed altered expression in patients who had discontinued IM (STOP-IM group, we first screened miRNA expression of peripheral blood mononuclear cells by using a TaqMan miRNA array on samples from five unselected patients from the STOP-IM group, seven CML patients receiving IM (IM group, and five healthy volunteers. We then performed miRNA quantification in 49 CML patients with deep molecular response. Mann–Whitney U and chi-square tests were used to determine statistical significance for comparisons between the control (healthy volunteers and test groups (STOP-IM and IM groups. Multiple groups were compared by one-way analysis of variance. Results: Downregulation of miR-148b was noted in patients in the STOP-IM group and in a subset of the IM group. We then subdivided the IM patients into two groups: one with downregulated miR-148b expression (IM-1; less than the cut-off value and the other without downregulated miR-148b expression (IM-2; greater than the cut-off value. The number of patients who had a sustained stable molecular response was significantly lower in IM-2 group. This group also had a significantly lower percentage of natural killer cells. Conclusion: Downregulated miR-148 may contribute to immune surveillance in STOP-IM patients

  12. Vol. 4(1), S/No 13, January, 2015:148-167 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka

    2015-01-13

    Jan 13, 2015 ... The basic assumption in Public interest discourse is that regulation is .... households on a self-targeting basis by relevant service authorities in their .... Pricing policy (EPP) documents into perspective, it is necessary to summarize the ... the attraction and retention of a competent work force (EPP 2008: 8).

  13. Half-life of samarium-147

    CERN Document Server

    Kinoshita, N; Nakanishi, T

    2003-01-01

    The alpha-decay half-life of sup 1 sup 4 sup 7 Sm has been reevaluated. Known amounts of natural Sm and an alpha-emitter standard ( sup 2 sup 1 sup 0 Po, sup 2 sup 3 sup 8 U, or sup 2 sup 4 sup 1 Am) were mixed well to prepare thin sources for the simultaneous counting of sup 1 sup 4 sup 7 Sm and the alpha-emitter standard by means of an alpha-spectrometer using a silicon surface barrier detector. The alpha-disintegration rate of known amounts of sup 1 sup 4 sup 7 Sm was determined by reference to the alpha activity of the standard. The source preparation and counting were repeated to establish the reproducibility of the present half-life determination, and supplementary alpha spectrometry was carried out by a liquid-scintillation spectrometer. The arithmetic mean of the experimental half-life values was obtained to be (1.17 +- 0.02) x 10 sup 1 sup 1 y. This value is about 10% longer than the currently adopted value, (1.06 +- 0.02) x 10 sup 1 sup 1 y, and the possible factors for this difference are discussed...

  14. Vaporization of Samarium trichloride studied by thermogravimetry

    International Nuclear Information System (INIS)

    Esquivel, Marcelo R.; Pasquevich, Daniel M.

    2003-01-01

    In the present work, the vaporization reaction of SmCl 3 (l) obtained from the 'in situ' reaction of Sm 2 O 3 (s) and Cl 2 (g)-C(s) was studied by thermogravimetry under controlled atmosphere. The effects of both the temperature between 825 C degrees and 950 C degrees and the total flow gas on the vaporization rate of the following reaction: SmCl 3 (l) = SmCl 3 (g) were analyzed. The vaporization rate of the process was found to be independent of then total gas flow rate and highly dependent on the temperature. E ap calculation led to a value of 240 ± 10 kJ.mol -1 . A comparison between this value and that of the molar enthalpy of vaporization allow to the conclusion that the reaction occur in conditions near to equilibrium. The SmCl 3 identity was determined by X-ray diffraction (XRD) and energy dispersive spectroscopy (EDS). (author)

  15. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    2017 Chemical Society of Ethiopia and The Authors ... 1Institute of Applied Chemistry, School of Chemistry and Chemical Engineering, Jinggangshan ... 3State Key Laboratory of Structural Chemistry, Fujian Institute of Research ... INTRODUCTION ..... Fenamate cocrystals with 4,4'-bipyridine: structural and thermodynamic ...

  16. SU-D-304-02: Magnetically Focused Proton Irradiation of Small Field Targets

    International Nuclear Information System (INIS)

    McAuley, GA; Slater, JM; Slater, JD; Wroe, AJ

    2015-01-01

    Purpose: To investigate the use of magnetic focusing for small field proton irradiations. It is hypothesized that magnetic focusing will provide significant dose distribution benefits over standard collimated beams for fields less than 10 mm diameter. Methods: Magnets consisting of 24 segments of radiation hard samarium-cobalt adhered into hollow cylinders were designed and manufactured. Two focusing magnets were placed on a positioning track on our Gantry 1 treatment table. Proton beams with energies of 127 and 157 MeV, 15 and 30 mm modulation, and 8 mm initial diameters were delivered to a water tank using single-stage scattering. Depth dose distributions were measured using a PTW PR60020 diode detector and transverse profiles were measured with Gafchromic EBT3 film. Monte Carlo simulations were also performed - both for comparison with experimental data and to further explore the potential of magnetic focusing in silica. For example, beam spot areas (based on the 90% dose contour) were matched at Bragg depth between simulated 100 MeV collimated beams and simulated beams focused by two 400 T/m gradient magnets. Results: Preliminary experimental results show 23% higher peak to entrance dose ratios and flatter spread out Bragg peak plateaus for 8 mm focused beams compared with uncollimated beams. Monte Carlo simulations showed 21% larger peak to entrance ratios and a ∼9 fold more efficient dose to target delivery compared to spot-sized matched collimated beams. Our latest results will be presented. Conclusion: Our results suggest that rare earth focusing magnet assemblies could reduce skin dose and beam number while delivering dose to nominally spherical radiosurgery targets over a much shorter time compared to unfocused beams. Immediate clinical applications include those associated with proton radiosurgery and functional radiosurgery of the brain and spine, however expanded treatment sites can be also envisaged

  17. WE-D-17A-04: Magnetically Focused Proton Irradiation of Small Volume Targets

    Energy Technology Data Exchange (ETDEWEB)

    McAuley, G; Slater, J [Loma Linda University, Loma Linda, CA (United States); Wroe, A [Loma Linda University Medical Center, Loma Linda, CA (United States)

    2014-06-15

    Purpose: To explore the advantages of magnetic focusing for small volume proton irradiations and the potential clinical benefits for radiosurgery targets. The primary goal is to create narrow elongated proton beams of elliptical cross section with superior dose delivery characteristics compared to current delivery modalities (eg, collimated beams). In addition, more general beam shapes are also under investigation. Methods: Two prototype magnets consisting of 24 segments of samarium-cobalt (Sm2Co17) permanent magnetic material adhered into hollow cylinders were manufactured for testing. A single focusing magnet was placed on a positioning track on our Gantry 1 treatment table and 15 mm diameter proton beams with energies and modulation relevant to clinical radiosurgery applications (127 to 186 MeV, and 0 to 30 mm modulation) were delivered to a terminal water tank. Beam dose distributions were measured using a PTW diode detector and Gafchromic EBT2 film. Longitudinal and transverse dose profiles were analyzed and compared to data from Monte Carlo simulations analogous to the experimental setup. Results: The narrow elongated focused beam spots showed high elliptical symmetry indicating high magnet quality. In addition, when compared to unfocused beams, peak-to-entrance depth dose ratios were 11 to 14% larger (depending on presence or extent of modulation), and minor axis penumbras were 11 to 20% smaller (again depending on modulation) for focused beams. These results suggest that the use of rare earth magnet assemblies is practical and could improve dose-sparing of normal tissue and organs at risk while delivering enhanced dose to small proton radiosurgery targets. Conclusion: Quadrapole rare earth magnetic assemblies are a promising and inexpensive method to counteract particle out scatter that tends to degrade the peak to entrance performance of small field proton beams. Knowledge gained from current experiments will inform the design of a prototype treatment

  18. SU-D-304-02: Magnetically Focused Proton Irradiation of Small Field Targets

    Energy Technology Data Exchange (ETDEWEB)

    McAuley, GA; Slater, JM [Loma Linda University, Loma Linda, CA (United States); Slater, JD; Wroe, AJ [Loma Linda University Medical Center, Loma Linda, CA (United States)

    2015-06-15

    Purpose: To investigate the use of magnetic focusing for small field proton irradiations. It is hypothesized that magnetic focusing will provide significant dose distribution benefits over standard collimated beams for fields less than 10 mm diameter. Methods: Magnets consisting of 24 segments of radiation hard samarium-cobalt adhered into hollow cylinders were designed and manufactured. Two focusing magnets were placed on a positioning track on our Gantry 1 treatment table. Proton beams with energies of 127 and 157 MeV, 15 and 30 mm modulation, and 8 mm initial diameters were delivered to a water tank using single-stage scattering. Depth dose distributions were measured using a PTW PR60020 diode detector and transverse profiles were measured with Gafchromic EBT3 film. Monte Carlo simulations were also performed - both for comparison with experimental data and to further explore the potential of magnetic focusing in silica. For example, beam spot areas (based on the 90% dose contour) were matched at Bragg depth between simulated 100 MeV collimated beams and simulated beams focused by two 400 T/m gradient magnets. Results: Preliminary experimental results show 23% higher peak to entrance dose ratios and flatter spread out Bragg peak plateaus for 8 mm focused beams compared with uncollimated beams. Monte Carlo simulations showed 21% larger peak to entrance ratios and a ∼9 fold more efficient dose to target delivery compared to spot-sized matched collimated beams. Our latest results will be presented. Conclusion: Our results suggest that rare earth focusing magnet assemblies could reduce skin dose and beam number while delivering dose to nominally spherical radiosurgery targets over a much shorter time compared to unfocused beams. Immediate clinical applications include those associated with proton radiosurgery and functional radiosurgery of the brain and spine, however expanded treatment sites can be also envisaged.

  19. The Atacama Cosmology Telescope: Sunyaev-Zel'dovich selected galaxy clusters at 148 GHz from three seasons of data

    Energy Technology Data Exchange (ETDEWEB)

    Hasselfield, Matthew; Hlozek, Renée [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Hilton, Matt [Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics and Computer Science, University of KwaZulu-Natal, Durban, 4041 (South Africa); Marriage, Tobias A.; Crichton, Devin; Gralla, Megan B. [Dept. of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218-2686 (United States); Addison, Graeme E.; Halpern, Mark [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC, V6T 1Z4 (Canada); Barrientos, L. Felipe; Dünner, Rolando [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificía Universidad Católica, Casilla 306, Santiago 22 (Chile); Battaglia, Nicholas [Department of Physics, Carnegie Mellon University, Pittsburgh, PA 15213 (United States); Battistelli, Elia S. [Department of Physics, University of Rome ' ' La Sapienza' ' , Piazzale Aldo Moro 5, I-00185 Rome (Italy); Bond, J. Richard; Hajian, Amir; Hincks, Adam D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON, M5S 3H8 (Canada); Das, Sudeep [High Energy Physics Division, Argonne National Laboratory, 9700 S Cass Avenue, Lemont, IL 60439 (United States); Devlin, Mark J.; Dicker, Simon R. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Dunkley, Joanna [Department of Astrophysics, Oxford University, Oxford, OX1 3RH (United Kingdom); Fowler, Joseph W., E-mail: mhasse@astro.princeton.edu, E-mail: hiltonm@ukzn.ac.za, E-mail: marriage@pha.jhu.edu [NIST Quantum Devices Group, 325 Broadway Mailcode 817.03, Boulder, CO 80305 (United States); and others

    2013-07-01

    We present a catalog of 68 galaxy clusters, of which 19 are new discoveries, detected via the Sunyaev-Zel'dovich effect (SZ) at 148 GHz in the Atacama Cosmology Telescope (ACT) survey on the celestial equator. With this addition, the ACT collaboration has reported a total of 91 optically confirmed, SZ detected clusters. The 504 square degree survey region includes 270 square degrees of overlap with SDSS Stripe 82, permitting the confirmation of SZ cluster candidates in deep archival optical data. The subsample of 48 clusters within Stripe 82 is estimated to be 90% complete for M{sub 500c} > 4.5 × 10{sup 14}M{sub s}un and redshifts 0.15 < z < 0.8. While a full suite of matched filters is used to detect the clusters, the sample is studied further through a ''Profile Based Amplitude Analysis'' using a statistic derived from a single filter at a fixed θ{sub 500} = 5.'9 angular scale. This new approach incorporates the cluster redshift along with prior information on the cluster pressure profile to fix the relationship between the cluster characteristic size (R{sub 500}) and the integrated Compton parameter (Y{sub 500}). We adopt a one-parameter family of ''Universal Pressure Profiles'' (UPP) with associated scaling laws, derived from X-ray measurements of nearby clusters, as a baseline model. Three additional models of cluster physics are used to investigate a range of scaling relations beyond the UPP prescription. Assuming a concordance cosmology, the UPP scalings are found to be nearly identical to an adiabatic model, while a model incorporating non-thermal pressure better matches dynamical mass measurements and masses from the South Pole Telescope. A high signal to noise ratio subsample of 15 ACT clusters with complete optical follow-up is used to obtain cosmological constraints. We demonstrate, using fixed scaling relations, how the constraints depend on the assumed gas model if only SZ measurements are used, and

  20. The Atacama Cosmology Telescope: Sunyaev-Zel'dovich selected galaxy clusters at 148 GHz from three seasons of data

    International Nuclear Information System (INIS)

    Hasselfield, Matthew; Hlozek, Renée; Hilton, Matt; Marriage, Tobias A.; Crichton, Devin; Gralla, Megan B.; Addison, Graeme E.; Halpern, Mark; Barrientos, L. Felipe; Dünner, Rolando; Battaglia, Nicholas; Battistelli, Elia S.; Bond, J. Richard; Hajian, Amir; Hincks, Adam D.; Das, Sudeep; Devlin, Mark J.; Dicker, Simon R.; Dunkley, Joanna; Fowler, Joseph W.

    2013-01-01

    We present a catalog of 68 galaxy clusters, of which 19 are new discoveries, detected via the Sunyaev-Zel'dovich effect (SZ) at 148 GHz in the Atacama Cosmology Telescope (ACT) survey on the celestial equator. With this addition, the ACT collaboration has reported a total of 91 optically confirmed, SZ detected clusters. The 504 square degree survey region includes 270 square degrees of overlap with SDSS Stripe 82, permitting the confirmation of SZ cluster candidates in deep archival optical data. The subsample of 48 clusters within Stripe 82 is estimated to be 90% complete for M 500c > 4.5 × 10 14 M s un and redshifts 0.15 500 = 5.'9 angular scale. This new approach incorporates the cluster redshift along with prior information on the cluster pressure profile to fix the relationship between the cluster characteristic size (R 500 ) and the integrated Compton parameter (Y 500 ). We adopt a one-parameter family of ''Universal Pressure Profiles'' (UPP) with associated scaling laws, derived from X-ray measurements of nearby clusters, as a baseline model. Three additional models of cluster physics are used to investigate a range of scaling relations beyond the UPP prescription. Assuming a concordance cosmology, the UPP scalings are found to be nearly identical to an adiabatic model, while a model incorporating non-thermal pressure better matches dynamical mass measurements and masses from the South Pole Telescope. A high signal to noise ratio subsample of 15 ACT clusters with complete optical follow-up is used to obtain cosmological constraints. We demonstrate, using fixed scaling relations, how the constraints depend on the assumed gas model if only SZ measurements are used, and show that constraints from SZ data are limited by uncertainty in the scaling relation parameters rather than sample size or measurement uncertainty. We next add in seven clusters from the ACT Southern survey, including their dynamical mass measurements, which are based on galaxy velocity

  1. Organelle targeting: third level of drug targeting

    Directory of Open Access Journals (Sweden)

    Sakhrani NM

    2013-07-01

    Full Text Available Niraj M Sakhrani, Harish PadhDepartment of Cell and Molecular Biology, BV Patel Pharmaceutical Education and Research Development (PERD Centre, Gujarat, IndiaAbstract: Drug discovery and drug delivery are two main aspects for treatment of a variety of disorders. However, the real bottleneck associated with systemic drug administration is the lack of target-specific affinity toward a pathological site, resulting in systemic toxicity and innumerable other side effects as well as higher dosage requirement for efficacy. An attractive strategy to increase the therapeutic index of a drug is to specifically deliver the therapeutic molecule in its active form, not only into target tissue, nor even to target cells, but more importantly, into the targeted organelle, ie, to its intracellular therapeutic active site. This would ensure improved efficacy and minimize toxicity. Cancer chemotherapy today faces the major challenge of delivering chemotherapeutic drugs exclusively to tumor cells, while sparing normal proliferating cells. Nanoparticles play a crucial role by acting as a vehicle for delivery of drugs to target sites inside tumor cells. In this review, we spotlight active and passive targeting, followed by discussion of the importance of targeting to specific cell organelles and the potential role of cell-penetrating peptides. Finally, the discussion will address the strategies for drug/DNA targeting to lysosomes, mitochondria, nuclei and Golgi/endoplasmic reticulum.Keywords: intracellular drug delivery, cancer chemotherapy, therapeutic index, cell penetrating peptides

  2. Effect of pulsed dose in simultaneous and sequential irradiation of V-79 cells by 14.8-MeV neutrons and 60Co photons

    International Nuclear Information System (INIS)

    Higgins, P.D.; DeLuca, P.M. Jr.; Gould, M.N.

    1984-01-01

    The effect of irradiating V-79 Chinese hamster cells with a mixture of 40% 14.8-MeV neutrons and 60% 69 Co photons with simultaneous or sequential exposures is investigated. Sample doses are obtained by irradiating cells with alternating 3-min pulses of neutrons and photons (in the sequential case) or with mixed neutrons and photons followed by equal beam-off periods to ensure equal total exposure times for sequential and simultaneous irradiations. Differences between the survival results under each beam configuration that are consistent with previous observations with nonpulsed irradiations are observed

  3. The analysis of 14.8 percent cold leg break without the application of hydroaccumulators in the PMK-NHV test facility

    International Nuclear Information System (INIS)

    Szabados, L.; Ezsoel, Gy.; Perneczky, L.

    1990-12-01

    A series of reactor safety tests have been performed in the experimental reactor simulation facility PMK-NHV of the Paks Nuclear Power Plant, Hungary, with and without the use of hydroaccumulator (SIT) operation. 14.8 percent cold leg break simulation experiments are reported without SITs in action, and the measurement results were analyzed using the RELAP5/mod2 computer code. The description of the experiment is followed by the parameter variations and their analysis, together with an interpretation of the measurement results. The lessons from the LOCA simulation tests are evaluated. (R.P.) 10 refs.; 48 figs.; 3 tabs

  4. Wavelet signatures of K-splitting of the Isoscalar Giant Quadrupole Resonance in deformed nuclei from high-resolution (p,p‧) scattering off 146, 148, 150Nd

    Science.gov (United States)

    Kureba, C. O.; Buthelezi, Z.; Carter, J.; Cooper, G. R. J.; Fearick, R. W.; Förtsch, S. V.; Jingo, M.; Kleinig, W.; Krugmann, A.; Krumbolz, A. M.; Kvasil, J.; Mabiala, J.; Mira, J. P.; Nesterenko, V. O.; von Neumann-Cosel, P.; Neveling, R.; Papka, P.; Reinhard, P.-G.; Richter, A.; Sideras-Haddad, E.; Smit, F. D.; Steyn, G. F.; Swartz, J. A.; Tamii, A.; Usman, I. T.

    2018-04-01

    The phenomenon of fine structure of the Isoscalar Giant Quadrupole Resonance (ISGQR) has been studied with high energy-resolution proton inelastic scattering at iThemba LABS in the chain of stable even-mass Nd isotopes covering the transition from spherical to deformed ground states. A wavelet analysis of the background-subtracted spectra in the deformed 146, 148, 150Nd isotopes reveals characteristic scales in correspondence with scales obtained from a Skyrme RPA calculation using the SVmas10 parameterization. A semblance analysis shows that these scales arise from the energy shift between the main fragments of the K = 0 , 1 and K = 2 components.

  5. Final Design for an International Intercomparison Exercise for Nuclear Accident Dosimetry at the DAF Using Godiva-IV: IER-148 CED-2 Report

    Energy Technology Data Exchange (ETDEWEB)

    Heinrichs, Dave [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beller, Tim [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Burch, Jennifer [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cummings, Rick [National Security Technologies, LLC. (NSTec), Mercury, NV (United States) Nevada National Security Site; Duluc, Matthieu [Inst. de Radioprotection et de Sûrete Nucleaire (ISRN), Fontenay-aux-Roses (France); Gadd, Milan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Goda, Joetta [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hickman, David [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McAvoy, Doug [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rathbone, Bruce [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sullivan, Randy [Savannah River Site (SRS), Aiken, SC (United States); Trompier, Francois [Inst. de Radioprotection et de Sûrete Nucleaire (ISRN), Fontenay-aux-Roses (France); Veinot, Ken [Y-12 National Security Complex, Oak Ridge, TN (United States); Ward, Dann [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Will, Rashelle [National Security Technologies, LLC. (NSTec), Mercury, NV (United States) Nevada National Security Site; Wilson, Chris [Atomic Weapons Establishment (AWE), Berkshire (United Kingdom); Zieziulewicz, Thomas [Knolls Atomic Power Lab. (KAPL), Niskayuna, NY (United States)

    2014-09-30

    This document is the Final Design (CED-2) Report for IER-148, “International Inter-comparison Exercise for Nuclear Accident Dosimetry at the DAF Using Godiva-IV.” The report describes the structure of the exercise consisting of three irradiations; identifies the participating laboratories and their points of contact; provides the details of all dosimetry elements and their placement in proximity to Godiva-IV on support stands or phantoms ; and lists the counting and spectroscopy equipment each laboratory will utilize in the Mercury NAD Lab. The exercise is tentatively scheduled for one week in August 2015.

  6. Nature of the magnetic order in the charge-ordered cuprate La1.48Nd0.4Sr0.12CuO4

    DEFF Research Database (Denmark)

    Christensen, Niels Bech; Rønnow, H.M.; Mesot, J.

    2007-01-01

    Using polarized neutron scattering we establish that the magnetic order in La1.48Nd0.4Sr0.12CuO4 is either (i) one dimensionally modulated and collinear, consistent with the stripe model or (ii) two dimensionally modulated with a novel noncollinear structure. The measurements rule out a number...... of alternative models characterized by 2D electronic order or 1D helical spin order. The low-energy spin excitations are found to be primarily transversely polarized relative to the stripe ordered state, consistent with conventional spin waves....

  7. Deuterium pass through target

    International Nuclear Information System (INIS)

    Alger, D.L.

    1975-01-01

    A neutron emitting target is described for use in neutron generating apparatus including a deuteron source and an accelerator vacuum chamber. The target consists of a tritium-containing target layer, a deuteron accumulation layer, and a target support containing passages providing communication between the accumulation layer and portions of the surface of the support exposed to the accelerator vacuum chamber. With this arrangement, deuterons passing through the target layer and implanting in and diffusing through the accumulation layer, diffuse into the communicating passages and are returned to the accelerator vacuum chamber. The invention allows the continuous removal of deuterons from the target in conventional water cooled neutron generating apparatus. Preferably, the target is provided with thin barrier layers to prevent undesirable tritium diffusion out of the target layer, as well as deuteron diffusion into the target layer

  8. Molecular Targets for Targeted Radionuclide Therapy

    International Nuclear Information System (INIS)

    Mather, S.J.

    2009-01-01

    Molecular targeted radionuclide cancer therapy is becoming of increasing importance, especially for disseminated diseases. Systemic chemotherapies often lack selectivity while targeted radionuclide therapy has important advantages as the radioactive cytotoxic unit of the targeting vector is specifically directed to the cancer, sparing normal tissues. The principle strategy to improve cancer selectivity is to couple therapeutic agents to tumour-targeting vectors. In targeted radionuclide therapy (TRT), the cytotoxic portion of the conjugates normally contains a therapeutic radiometal immobilised by a bifunctional chelator. The aim is therefore to use as ligand-targeted therapeutics vectors coupled to Auger-, alpha- and/or beta-emitting radionuclides. An advantage of using radiation instead of chemotherapeutics as the cytotoxic agent is the so called 'crossfire effect'. This allows sterilisation of tumour cells that are not directly targeted due to heterogeneity in target molecule expression or inhomogeneous vector delivery. However, before the targeting ligands can be selected, the target molecule on the tumour has to be selected. It should be uniquely expressed, or at least highly overexpressed, on or in the target cells relative to normal tissues. The target should be easily accessible for ligand delivery and should not be shed or down- regulated after ligand binding. An important property of a receptor (or antigen) is its potential to be internalized upon binding of the ligand. This provides an active uptake mechanism and allows the therapeutic agent to be trapped within the tumour cells. Molecular targets of current interest include: Receptors: G-protein coupled receptors are overexpressed on many major human tumours. The prototype of these receptors are somatostatin receptors which show very high density in neuroendocrine tumours, but there are many other most interesting receptors to be applied for TRT. The targeting ligands for these receptors are

  9. Determination of the cross section for (n,p) and (n,α) reactions on 165Ho at 13.5 and 14.8 MeV

    International Nuclear Information System (INIS)

    Luo, Junhua; An, Li; Jiang, Li; He, Long

    2015-01-01

    Activation cross-sections for the 165 Ho(n,p) 165 Dy and 165 Ho(n,α) 162 Tb reactions were measured by means of the activation method at 13.5 and 14.8 MeV, to resolve inconsistencies in existing data. A neutron beam produced via the 3 H(d,n) 4 He reaction was used. Statistical model calculations were performed using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. Results are also discussed and compared with some corresponding values found in the literature. The calculational results on the 165 Ho(n,α) 162 Tb reaction agreed fairly well with experimental data, but there were large discrepancies in the results for the 165 Ho(n,p) 165 Dy reaction. - Highlights: • 27 Al(n,α) 24 Na was used as a monitor for neutron fleunce. • The cross sections for the 165 Ho(n,p) 165 Dy and 165 Ho(n,α) 162 Tb reactions were measured at 13.5 and 14.8 MeV neutron energies. • Nuclear reaction codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • Inconsistency with previous data and with model calculations are noted

  10. Safety and complications of absorbable threads made of poly-L-lactic acid and poly lactide/glycolide: Experience with 148 consecutive patients.

    Science.gov (United States)

    Sarigul Guduk, Sukran; Karaca, Nezih

    2018-04-01

    Thread lifting is a minimally invasive procedure for lifting and repositioning tissues. Few articles with absorbable sutures exist in the literature. Furthermore there is no study focusing on complications of absorbable sutures. To describe complications of thread lifting using a totally absorbable suture composed of poly-L-lactic acid affixed with poly lactide/glycolide cones. Data regarding complications were analyzed retrospectively for 148 patients underwent thread lifting between June 2014 and February 2017. A total of 321 pairs of sutures used in the 148 patients studied. Overall 40 (27%) patients had complications regarded as minimal or moderate without permanent sequela. The most common complication was skin dimpling and irregularity (n = 17, 11.4%) followed by ecchymosis (n = 12, 8.1%), suture extrusion (n = 4, 2.7%), and pain (n = 4, 2.7%) Except one patient, dimpling, and irregularity resolved in all patients after 3-7 days spontaneously. Suture migration was observed in 2 (1.35%) patients. Hematoma and infection were seen in 2 patients one for each. The procedure using sutures made of absorbable poly-L-lactic acid and poly lactide/glycolide is a relatively safe procedure without major complications. © 2018 Wiley Periodicals, Inc.

  11. Collective Dynamics and Strong Pinning near the Onset of Charge Order in La1.48Nd0.4Sr0.12CuO4

    Science.gov (United States)

    Baity, P. G.; Sasagawa, T.; Popović, Dragana

    2018-04-01

    The dynamics of charge-ordered states is one of the key issues in underdoped cuprate high-temperature superconductors, but static short-range charge-order (CO) domains have been detected in almost all cuprates. We probe the dynamics across the CO (and structural) transition in La1.48Nd0.4Sr0.12CuO4 by measuring nonequilibrium charge transport, or resistance R as the system responds to a change in temperature and to an applied magnetic field. We find evidence for metastable states, collective behavior, and criticality. The collective dynamics in the critical regime indicates strong pinning by disorder. Surprisingly, nonequilibrium effects, such as avalanches in R , are revealed only when the critical region is approached from the charge-ordered phase. Our results on La1.48Nd0.4Sr0.12CuO4 provide the long-sought evidence for the fluctuating order across the CO transition, and also set important constraints on theories of dynamic stripes.

  12. TU-H-CAMPUS-TeP1-03: Magnetically Focused Proton Irradiation of Small Volume Radiosurgery Targets

    Energy Technology Data Exchange (ETDEWEB)

    McAuley, GA; Slater, JM [Loma Linda University, Loma Linda, CA (United States); Wroe, AJ [Loma Linda University, Loma Linda, CA (United States); Loma Linda University Medical Center, Loma Linda, CA (United States)

    2016-06-15

    Purpose: To investigate the use of magnetic focusing for small volume proton radiosurgery targets using a triplet combination of quadrupole rare earth permanent magnet Halbach cylinder assemblies Methods: Fourteen quadrupole magnets consisting of 24 segments of radiation hard samarium-cobalt adhered into k=3 Halbach cylinders with various field gradients (100 to 250 T/m) were designed and manufactured. Triplet combinations of the magnets were placed on a positioning track on our Gantry 1 treatment table. Unmodulated 127 MeV proton beams with initial diameters of 3 to 20 mm were delivered to a water tank using single-stage scattering. Depth and transverse dose distributions were measured using a PTW PR60020 diode detector and EBT3 film, respectively. This data was compared with unfocused passively collimated beams. Monte Carlo simulations were also performed - both for comparison with experimental data and to further investigate the potential of triplet magnetic focusing. Results: Experimental results using 150 T/m gradient magnets and 15 to 20 mm initial diameter beams show peak to entrance dose ratios that are ∼ 43 to 48 % larger compared with spot size matched 8 mm collimated beams (ie, transverse profile full-widths at 90% maximum dose match within 0.5 mm of focused beams). In addition, the focusing beams were ∼ 3 to 4.4 times more efficient per MU in dose to target delivery. Additional results using different magnet combinations will also be presented. Conclusion: Our results suggest that triplet magnetic focusing could reduce entrance dose and beam number while delivering dose to small (∼≤ 10 mm diameter) radiosurgery targets in less time compared to unfocused beams. Immediate clinical applications include those associated with proton radiosurgery and functional radiosurgery of the brain and spine, however other treatment sites can be also envisioned. This project was sponsored with funding from the Department of Defense (DOD# W81XWH-BAA-10-1).

  13. Monitoring production target thickness

    International Nuclear Information System (INIS)

    Oothoudt, M.A.

    1993-01-01

    Pion and muon production targets at the Clinton P. Anderson Meson Physics Facility consist of rotating graphite wheels. The previous target thickness monitoring Procedure scanned the target across a reduced intensity beam to determine beam center. The fractional loss in current across the centered target gave a measure of target thickness. This procedure, however, required interruption of beam delivery to experiments and frequently indicated a different fractional loss than at normal beam currents. The new monitoring Procedure compares integrated ups and downs toroid current monitor readings. The current monitors are read once per minute and the integral of readings are logged once per eight-hour shift. Changes in the upstream to downstream fractional difference provide a nonintrusive continuous measurement of target thickness under nominal operational conditions. Target scans are now done only when new targets are installed or when unexplained changes in the current monitor data are observed

  14. Active targeted HIV testing and linkage to care among men who have sex with men attending a gay sauna in Thailand.

    Science.gov (United States)

    Khawcharoenporn, Thana; Apisarnthanarak, Anucha; Phanuphak, Nittaya

    2017-03-01

    Existing data on the feasibility of human immunodeficiency virus (HIV) testing and counseling (HTC) and linkage to care among men who have sex with men (MSM) in hotspots are currently limited. A prospective study on active targeted HTC and linkage to care among MSM (≥18 years old) was conducted at a gay sauna in Thailand from November 2013 to October 2015. HIV risks and risk perception were evaluated through an anonymous survey. HIV testing with result notification and care appointment arrangement were provided on-site. Of the 358 participants; median age was 30 years; 206/358(58%) were at high risk for HIV acquisition; 148/358(41%) accepted HTC, all of whom either had prior negative HIV tests [98/148 (66%)] or had not known their HIV status [50/148 (34%)]. The three most common reasons for declining HTC were prior HIV testing within 6 months (48%), not ready (19%) and perceiving self as no risk (11%). Of the 262 moderate- and high-risk participants, 172 (66%) had false perception of low HIV risk which was significantly associated with declining HTC. Among the 148 participants undergoing HTC, 25 (17%) were HIV-infected. Having false perception of low risk (P = 0.004) and age antiretroviral therapy. The active targeted HTC and facilitating care establishment was feasible among MSM attending the gay sauna but required strategies to improve accuracy of HIV-risk perception and linkage to care.

  15. Charged particle fusion targets

    International Nuclear Information System (INIS)

    Bangerter, R.O.; Meeker, D.J.

    1977-01-01

    The power, voltage, energy and other requirements of electron and ion beam fusion targets are reviewed. Single shell, multiple shell and magnetically insulated target designs are discussed. Questions of stability are also considered. In particular, it is shown that ion beam targets are stabilized by an energy spread in the ion beam

  16. Liquid helium target

    International Nuclear Information System (INIS)

    Fujii, Y.; Kitami, T.; Torikoshi, M.

    1984-12-01

    A liquid helium target system has been built and used for the experiment on the reaction 4 He(γ, p). The target system has worked satisfactorily; the consumption rate of liquid helium is 360 ml/h and the cryogenic system retains liquid helium for about ten hours. The structure, operation and performance of the target system are reported. (author)

  17. Graphite targets at LAMPF

    International Nuclear Information System (INIS)

    Brown, R.D.; Grisham, D.L.

    1983-01-01

    Rotating polycrystalline and stationary pyrolytic graphite target designs for the LAMPF experimental area are described. Examples of finite element calculations of temperatures and stresses are presented. Some results of a metallographic investigation of irradiated pyrolytic graphite target plates are included, together with a brief description of high temperature bearings for the rotating targets

  18. Determination of the cross section for (n,p) reaction with producing short-lived nuclei on the 162,163Dy isotopes at 13.5 and 14.8 MeV

    International Nuclear Information System (INIS)

    Luo, Junhua; Feng, Zhifu; An, Li; Jiang, Li; He, Long

    2016-01-01

    Activation cross-sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb reactions have been measured by means of the activation technique and a coaxial HPGe γ-ray detector at 13.5 and 14.8 MeV. The fast neutrons were produced via the 3 H(d,n) 4 He reaction on Pd-300 neutron generator. The natural high-purity Dy 2 O 3 powder was used as target material. Theoretical excitation functions were calculated using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were also discussed and compared with some corresponding values found in the literature, with the comprehensive evaluation data in ENDF/B-VII.1 and JENDF-4.0 libraries, and with the estimates obtained from a published empirical formula based on the statistical model with Q-value dependence and odd–even effects taken into consideration. - Highlights: • The cross sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb have been measured. • 93 Nb(n,2n) 92m Nb was used as a monitor for neutron fluence. • Codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • The results were compared with previous data. • Inconsistency with previous data and with model calculations are noted.

  19. The interaction between AMPKβ2 and the PP1-targeting subunit R6 is dynamically regulated by intracellular glycogen content.

    Science.gov (United States)

    Oligschlaeger, Yvonne; Miglianico, Marie; Dahlmans, Vivian; Rubio-Villena, Carla; Chanda, Dipanjan; Garcia-Gimeno, Maria Adelaida; Coumans, Will A; Liu, Yilin; Voncken, J Willem; Luiken, Joost J F P; Glatz, Jan F C; Sanz, Pascual; Neumann, Dietbert

    2016-04-01

    AMP-activated protein kinase (AMPK) is a metabolic stress-sensing kinase. We previously showed that glucose deprivation induces autophosphorylation of AMPKβ at Thr-148, which prevents the binding of AMPK to glycogen. Furthermore, in MIN6 cells, AMPKβ1 binds to R6 (PPP1R3D), a glycogen-targeting subunit of protein phosphatase type 1 (PP1), thereby regulating the glucose-induced inactivation of AMPK. In the present study, we further investigated the interaction of R6 with AMPKβ and the possible dependency on Thr-148 phosphorylation status. Yeast two-hybrid (Y2H) analyses and co-immunoprecipitation (IP) of the overexpressed proteins in human embryonic kidney (HEK) 293T) cells revealed that both AMPKβ1 and AMPK-β2 wild-type (WT) isoforms bind to R6. The AMPKβ-R6 interaction was stronger with the muscle-specific AMPKβ2-WT and required association with the substrate-binding motif of R6. When HEK293T cells or C2C12 myotubes were cultured in high-glucose medium, AMPKβ2-WT and R6 weakly interacted. In contrast, glycogen depletion significantly enhanced this protein interaction. Mutation of AMPKβ2 Thr-148 prevented the interaction with R6 irrespective of the intracellular glycogen content. Treatment with the AMPK activator oligomycin enhanced the AMPKβ2-R6 interaction in conjunction with increased Thr-148 phosphorylation in cells grown in low-glucose medium. These data are in accordance with R6 binding directly to AMPKβ2 when both proteins detach from the diminishing glycogen particle, which is simultaneous with increased AMPKβ2 Thr-148 autophosphorylation. Such a model points to a possible control of AMPK by PP1-R6 upon glycogen depletion in muscle. © 2016 Authors; published by Portland Press Limited.

  20. Wake Shield Target Protection

    International Nuclear Information System (INIS)

    Valmianski, Emanuil I.; Petzoldt, Ronald W.; Alexander, Neil B.

    2003-01-01

    The heat flux from both gas convection and chamber radiation on a direct drive target must be limited to avoid target damage from excessive D-T temperature increase. One of the possibilities of protecting the target is a wake shield flying in front of the target. A shield will also reduce drag force on the target, thereby facilitating target tracking and position prediction. A Direct Simulation Monte Carlo (DSMC) code was used to calculate convection heat loads as boundary conditions input into ANSYS thermal calculations. These were used for studying the quality of target protection depending on various shapes of shields, target-shield distance, and protective properties of the shield moving relative to the target. The results show that the shield can reduce the convective heat flux by a factor of 2 to 5 depending on pressure, temperature, and velocity. The protective effect of a shield moving relative to the target is greater than the protective properties of a fixed shield. However, the protective effect of a shield moving under the drag force is not sufficient for bringing the heat load on the target down to the necessary limit. Some other ways of diminishing heat flux using a protective shield are discussed

  1. Development of distributed target

    CERN Document Server

    Yu Hai Jun; Li Qin; Zhou Fu Xin; Shi Jin Shui; Ma Bing; Chen Nan; Jing Xiao Bing

    2002-01-01

    Linear introduction accelerator is expected to generate small diameter X-ray spots with high intensity. The interaction of the electron beam with plasmas generated at the X-ray converter will make the spot on target increase with time and debase the X-ray dose and the imaging resolving power. A distributed target is developed which has about 24 pieces of thin 0.05 mm tantalum films distributed over 1 cm. due to the structure adoption, the distributed target material over a large volume decreases the energy deposition per unit volume and hence reduces the temperature of target surface, then reduces the initial plasma formalizing and its expansion velocity. The comparison and analysis with two kinds of target structures are presented using numerical calculation and experiments, the results show the X-ray dose and normalized angle distribution of the two is basically the same, while the surface of the distributed target is not destroyed like the previous block target

  2. Polarized targets and beams

    International Nuclear Information System (INIS)

    Meyer, W.

    1985-01-01

    First the experimental situation of the single-pion photoproduction and the photodisintegration of the deuteron is briefly discussed. Then a description of the Bonn polarization facilities is given. The point of main effort is put on the polarized target which plays a vital role in the program. A facility for photon induced double polarization experiments at ELSA will be presented in section 4. Properties of a tensor polarized deuteron target are discussed in section 5. The development in the field of polarized targets, especially on new target materials, enables a new generation of polarized target experiments with (polarized) electrons. Some comments on the use of a polarized target in combination with electron beams will be discussed in section 6. Electron deuteron scattering from a tensor polarized deuteron target is considered and compared with other experimental possibilities. (orig./HSI)

  3. Measurements of the 40Ar(n, γ)41Ar radiative-capture cross section between 0.4 and 14.8 MeV

    Science.gov (United States)

    Bhike, Megha; Fallin, B.; Tornow, W.

    2014-09-01

    The 40Ar(n, γ)41Ar neutron capture cross section has been measured between 0.4 and 14.8 MeV neutron energy using the activation technique. The data are important for estimating backgrounds in argon-based neutrino and dark-matter detectors and in the neutrino-less double-beta decay search GERDA, which uses liquid argon as cooling and shielding medium. For the first time the 40Ar(n, γ)41Ar cross section has been measured for neutron energies above 1 MeV. Our results are compared to the evaluation ENDF/B-VII.1 and the calculated prediction TENDL-2013. The latter agrees very well with the present results.

  4. Experimental investigations on the fluid flow through an asymmetric rod bundle (P/D = 1.148, W/D = 1.045)

    International Nuclear Information System (INIS)

    Rehme, K.

    1983-11-01

    Measurements of the distributions of the mean velocity, the wall shear stresses and the turbulence were performed in a wall subchannel of a rod bundle of four parallel rods arranged asymmetrically in a rectangular channel (P/D = 1.148, W/D = 1.045). The Reynolds number of this investigations was Re = 5.88 x 10 4 . The experimental results show that the momentum transport is highly anisotropic especially in the gaps of the rod bundle. Influences of secondary flow cannot be detected in the distribution of the time-mean velocity. The comparison between experimental wall shear stress distributions and those calculated with the VELASCO-code shows discrepancies both in the gap between the rod and channel walls and in the gap between the rods caused by the high momentum transport between the two subchannels. (orig.) [de

  5. Experimental investigations on the fluid flow through an asymmetric rod bundle (P/D = 1.148, W/D = 1.074)

    International Nuclear Information System (INIS)

    Rehme, K.

    1984-12-01

    Measurements of the distributions of the mean velocity, the wall shear stresses and the turbulence were performed in a wall subchannel of a rod bundle of four prallel rods arranged asymmetrically in a rectangular (P/D = 1.148, W/D = 1.074). The Reynolds number of this investigations was Re = 7.89 x 10 4 . The results obtained by a fully automated rig are compared with those from manual operation. The experimental results show that the momentum transport is highly anisotropyc especially in the gaps of the rod bundle. Influences of secondary flow cannot be detected in the distribution of the time-mean velocity. The comparison between experimental wall shear stress distributions and those calculated with the VELASCO-code shows discrepancies both in the gap between the rod and channel walls and in the gap between the rods caused by the high momentum transport between the two subchannels. (orig.) [de

  6. The Atacama Cosmology Telescope: A Measurement of the Cosmic Microwave Background Power Spectrum at 148 AND 218 GHz from the 2008 Southern Survey

    Science.gov (United States)

    Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben; hide

    2010-01-01

    We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results dearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ACDM cosmological model. At l > 3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8(sigma) level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.

  7. Measurements of the 40Ar(n, γ41Ar radiative-capture cross section between 0.4 and 14.8 MeV

    Directory of Open Access Journals (Sweden)

    Megha Bhike

    2014-09-01

    Full Text Available The 40Ar(n, γ41Ar neutron capture cross section has been measured between 0.4 and 14.8 MeV neutron energy using the activation technique. The data are important for estimating backgrounds in argon-based neutrino and dark-matter detectors and in the neutrino-less double-beta decay search GERDA, which uses liquid argon as cooling and shielding medium. For the first time the 40Ar(n, γ41Ar cross section has been measured for neutron energies above 1 MeV. Our results are compared to the evaluation ENDF/B-VII.1 and the calculated prediction TENDL-2013. The latter agrees very well with the present results.

  8. Nova target experiments

    International Nuclear Information System (INIS)

    Drake, R.P.

    1985-11-01

    The Nova laser, at the Lawrence Livermore National Laboratory, provides unique opportunities for target experiments. It has unprecedented energy on target and significant flexibility. The paper presented by John Hunt described the capabilities and the status of Nova. This paper discusses plans for future experiments using Nova, and the present status of target experiments. We plan to perform high-quality physics experiments that exploit the unique capabilities of Nova. Because this is our goal, we are fielding an extensive array of well-characterized target diagnostics to measure the emissions from the target. The first section of this paper discusses the basic target diagnostics. We are also taking care to quantify the performance of the laser

  9. Targeting and Persuasive Advertising

    OpenAIRE

    Egli, Alain (Autor/in)

    2015-01-01

    Firms face a prisoner's dilemma when advertising in a competitive environment. In a Hotelling framework with persuasive advertisingfirms counteract this prisoner's dilemma with targeting. The firms even solve the prisoner's problem if targeted advertising is effective enough. Advertising turns from wasteful competition into profits. This is in contrast to wasteful competition as argument for regulations. A further result is maximum advertising differentiation: thefirms target their advertisin...

  10. The ISOLDE target robots

    CERN Multimedia

    Maximilein Brice

    2002-01-01

    ISOLDE targets need to be changed frequently, around 80 times per year. The high radiation levels do not permit this to be done by human hands and the target changes are effected by 2 industrial robots (picture _01). On the left, in the distance, the front-end of the GPS (General Purpose Separator) is seen, while the HRS (High Resolution Separator) is at the right. Also seen are the doors to the irradiated-target storage.

  11. Deuterium high pressure target

    International Nuclear Information System (INIS)

    Perevozchikov, V.V.; Yukhimchuk, A.A.; Vinogradov, Yu.I.

    2001-01-01

    The design of the deuterium high-pressure target is presented. The target having volume of 76 cm 3 serves to provide the experimental research of muon catalyzed fusion reactions in ultra-pure deuterium in the temperature range 80-800 K under pressures of up to 150 MPa. The operation of the main systems of the target is described: generation and purification of deuterium gas, refrigeration, heating, evacuation, automated control system and data collection system

  12. Targeted Radionuclide Therapy

    Directory of Open Access Journals (Sweden)

    David Cheng

    2011-10-01

    Full Text Available Targeted radiotherapy is an evolving and promising modality of cancer treatment. The killing of cancer cells is achieved with the use of biological vectors and appropriate radionuclides. Among the many advantages of this approach are its selectiveness in delivering the radiation to the target, relatively less severe and infrequent side effects, and the possibility of assessing the uptake by the tumor prior to the therapy. Several different radiopharmaceuticals are currently being used by various administration routes and targeting mechanisms. This article aims to briefly review the current status of targeted radiotherapy as well as to outline the advantages and disadvantages of radionuclides used for this purpose.

  13. Targeted Radionuclide Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Ersahin, Devrim, E-mail: devrimersahin@yahoo.com; Doddamane, Indukala; Cheng, David [Department of Diagnostic Radiology, School of Medicine, Yale University, 333 Cedar St., New Haven, CT 06520 (United States)

    2011-10-11

    Targeted radiotherapy is an evolving and promising modality of cancer treatment. The killing of cancer cells is achieved with the use of biological vectors and appropriate radionuclides. Among the many advantages of this approach are its selectiveness in delivering the radiation to the target, relatively less severe and infrequent side effects, and the possibility of assessing the uptake by the tumor prior to the therapy. Several different radiopharmaceuticals are currently being used by various administration routes and targeting mechanisms. This article aims to briefly review the current status of targeted radiotherapy as well as to outline the advantages and disadvantages of radionuclides used for this purpose.

  14. Target Assembly Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Target Assembly Facility integrates new armor concepts into actual armored vehicles. Featuring the capability ofmachining and cutting radioactive materials, it...

  15. Targeted Radionuclide Therapy

    International Nuclear Information System (INIS)

    Ersahin, Devrim; Doddamane, Indukala; Cheng, David

    2011-01-01

    Targeted radiotherapy is an evolving and promising modality of cancer treatment. The killing of cancer cells is achieved with the use of biological vectors and appropriate radionuclides. Among the many advantages of this approach are its selectiveness in delivering the radiation to the target, relatively less severe and infrequent side effects, and the possibility of assessing the uptake by the tumor prior to the therapy. Several different radiopharmaceuticals are currently being used by various administration routes and targeting mechanisms. This article aims to briefly review the current status of targeted radiotherapy as well as to outline the advantages and disadvantages of radionuclides used for this purpose

  16. Targeting the tumor microenvironment

    Energy Technology Data Exchange (ETDEWEB)

    Kenny, P.A.; Lee, G.Y.; Bissell, M.J.

    2006-11-07

    Despite some notable successes cancer remains, for the most part, a seemingly intractable problem. There is, however, a growing appreciation that targeting the tumor epithelium in isolation is not sufficient as there is an intricate mutually sustaining synergy between the tumor epithelial cells and their surrounding stroma. As the details of this dialogue emerge, new therapeutic targets have been proposed. The FDA has already approved drugs targeting microenvironmental components such as VEGF and aromatase and many more agents are in the pipeline. In this article, we describe some of the 'druggable' targets and processes within the tumor microenvironment and review the approaches being taken to disrupt these interactions.

  17. Analysis of Deregulated microRNAs and Their Target Genes in Gastric Cancer.

    Directory of Open Access Journals (Sweden)

    Simonas Juzėnas

    Full Text Available MicroRNAs (miRNAs are widely studied non-coding RNAs that modulate gene expression. MiRNAs are deregulated in different tumors including gastric cancer (GC and have potential diagnostic and prognostic implications. The aim of our study was to determine miRNA profile in GC tissues, followed by evaluation of deregulated miRNAs in plasma of GC patients. Using available databases and bioinformatics methods we also aimed to evaluate potential target genes of confirmed differentially expressed miRNA and validate these findings in GC tissues.The study included 51 GC patients and 51 controls. Initially, we screened miRNA expression profile in 13 tissue samples of GC and 12 normal gastric tissues with TaqMan low density array (TLDA. In the second stage, differentially expressed miRNAs were validated in a replication cohort using qRT-PCR in tissue and plasma samples. Subsequently, we analyzed potential target genes of deregulated miRNAs using bioinformatics approach, determined their expression in GC tissues and performed correlation analysis with targeting miRNAs.Profiling with TLDA revealed 15 deregulated miRNAs in GC tissues compared to normal gastric mucosa. Replication analysis confirmed that miR-148a-3p, miR-204-5p, miR-223-3p and miR-375 were consistently deregulated in GC tissues. Analysis of GC patients' plasma samples showed significant down-regulation of miR-148a-3p, miR-375 and up-regulation of miR-223-3p compared to healthy subjects. Further, using bioinformatic tools we identified targets of replicated miRNAs and performed disease-associated gene enrichment analysis. Ultimately, we evaluated potential target gene BCL2 and DNMT3B expression by qRT-PCR in GC tissue, which correlated with targeting miRNA expression.Our study revealed miRNA profile in GC tissues and showed that miR-148a-3p, miR-223-3p and miR-375 are deregulated in GC plasma samples, but these circulating miRNAs showed relatively weak diagnostic performance as sole biomarkers

  18. Target reactor development problems

    International Nuclear Information System (INIS)

    Lathrop, K.D.; Vigil, J.C.

    1977-01-01

    Target-blanket design studies are discussed for an accelerator-breeder concept employing a linear accelerator in conjunction with a modified conventional power reactor to produce both fissile fuel and power. The following problems in target and blanket system design are discussed: radiation damage, heat removal, neutronic design, and economics

  19. The CNGS target

    CERN Multimedia

    Patrice Loïez

    2005-01-01

    The CERN Neutrinos to Gran Sasso (CNGS) target ‘magazine’ of five target units. Each unit contains a series of 10-cm long graphite rods distributed over a length of 2 m. It is designed to maximize the number of secondary particles produced and hence the number of neutrinos. One unit is used at a time to prevent over heating.

  20. Targeted radionuclide therapy

    African Journals Online (AJOL)

    target for which a speci c treatment/drug is intended (Fig. 1). eranostics .... Using an anti-CD20 antibody as a delivery device to target the follicular ... systems combine diagnostic imaging (Ga-68-DOTATATE PET/CT) .... Intra-articular injected ...

  1. Modelling Recycling Targets

    DEFF Research Database (Denmark)

    hill, amanda; Leinikka Dall, Ole; Andersen, Frits Møller

    2014-01-01

    % for household waste, and sets an ambitious goal of a 50% recycling rate by 2020. This study integrates the recycling target into the FRIDA model to project how much waste and from which streams should be diverted from incineration to recycling in order to achieve the target. Furthermore, it discusses how...

  2. Strategic Targeted Advertising

    NARCIS (Netherlands)

    A. Galeotti; J.L. Moraga-Gonzalez (José Luis)

    2003-01-01

    textabstractWe present a strategic game of pricing and targeted-advertising. Firms can simultaneously target price advertisements to different groups of customers, or to the entire market. Pure strategy equilibria do not exist and thus market segmentation cannot occur surely. Equilibria exhibit

  3. Seedling root targets

    Science.gov (United States)

    Diane L. Haase

    2011-01-01

    Roots are critical to seedling performance after outplanting. Although root quality is not as quick and simple to measure as shoot quality, target root characteristics should be included in any seedling quality assessment program. This paper provides a brief review of root characteristics most commonly targeted for operational seedling production. These are: root mass...

  4. Internal targets for LEAR

    International Nuclear Information System (INIS)

    Kilian, K.; Gspann, J.; Mohl, D.; Poth, H.

    1984-01-01

    This chapter considers the use of thin internal targets in conjunction with phase-space cooling at the Low-Energy Antiproton Ring (LEAR). Topics considered include the merits of internal target operation; the most efficient use of antiprotons and of proton synchrotron (PS) protons, highest center-of-mass (c.m.) energy resolution; highest angular resolution and access to extreme angles; the transparent environment for all reaction products; a windowless source and pure targets; highest luminosity and count rates; access to lowest energies with increasing resolution; internal target thickness and vacuum requirements; required cooling performance; and modes of operation. It is demonstrated that an internal target in conjunction with phase-space cooling has the potential of better performance in terms of the economic use of antiprotons and consequently of PS protons; energy resolution; angular resolution; maximum reaction rate capability (statistical precision); efficient parasitic operation; transparency of the target for reaction products; access to low energies; and the ease of polarized target experiments. It is concluded that all p - experiments which need high statistics and high p - flux, such as studies of rare channels or broad, weak resonance structures, would profit from internal targets

  5. Fusion target design

    International Nuclear Information System (INIS)

    Bangerter, R.O.

    1978-01-01

    Most detailed fusion target design is done by numerical simulation using large computers. Although numerical simulation is briefly discussed, this lecture deals primarily with the way in which basic physical arguments, driver technology considerations and economical power production requirements are used to guide and augment the simulations. Physics topics discussed include target energetics, preheat, stability and symmetry. A specific design example is discussed

  6. Electron beam fusion targets

    International Nuclear Information System (INIS)

    Clauser, M.J.; Sweeney, M.A.

    1975-01-01

    R The behavior of the DT filled gold shells when irradiated by a variety of pulse shapes was studied. In these pulses the power (and beam current) was varied, but the voltage was kept constant at 1 MeV. In general the performance of the target, for a given peak power, was not significantly affected by the pulse shape. Pulses with rise times of up to half the implosion time do not significantly degrade the target performance. The use of the ''optimal pulse'' of laser fusion with a fixed peak power does not appear to improve the performance of these targets. The main function of the ''optimal pulse'' is to produce a large rho r of the target during the thermonuclear burn. In e-beam targets a total rho r of 5--10 g/cm 2 can be obtained without pulse shaping; the problem here is one of achieving high enough temperatures to ignite the DT. (U.S.)

  7. AA antiproton production target

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The first version of the antiproton production target was a tungsten rod, 11 cm long and 3 mm in diameter. The rod was embedded in graphite, pressure-seated into an outer casing of stainless steel. At the entrance to the target assembly was a scintillator screen, imprinted with circles every 5 mm in radius, which allowed to precisely aim the 26 GeV high-intensity proton beam from the PS onto the centre of the target rod. The scintillator screen was a 1 mm thick plate of Cr-doped alumina. See also 7903034 and 7905091.

  8. Shiva target irradiation facility

    International Nuclear Information System (INIS)

    Manes, K.R.; Ahlstrom, H.G.; Coleman, L.W.; Storm, E.K.; Glaze, J.A.; Hurley, C.A.; Rienecker, F.; O'Neal, W.C.

    1977-01-01

    The first laser/plasma studies performed with the Shiva laser system will be two sided irradiations extending the data obtained by other LLL lasers to higher powers. The twenty approximately 1 TW laser pulses will reach the target simultaneously from above and below in nested pentagonal clusters. The upper and lower clusters of ten beams each are radially polarized so that they strike the target in p-polarization and maximize absorption. This geometry introduces laser system isolation problems which will be briefly discussed. The layout and types of target diagnostics will be described and a brief status report on the facility given

  9. STANFORD: Internal targets

    Energy Technology Data Exchange (ETDEWEB)

    Riordan, Michael

    1989-05-15

    Of burgeoning interest to many nuclear and particle physicists is a storage ring technique for fixed target experiments. It hinges on the use of gas-jet targets, shooting a narrow stream of atoms through a circulating beam of electrons or protons. Pioneered at CERN and the Soviet Novosibirsk Laboratory, more such 'internal targets' are being built or contemplated for storage rings in Europe, the Soviet Union, and the United States. From 9-12 January, physicists from around the world met at the Stanford Linear Accelerator Center (SLAC) to discuss prospects and problems in this expanding field.

  10. TARGET Research Goals

    Science.gov (United States)

    TARGET researchers use various sequencing and array-based methods to examine the genomes, transcriptomes, and for some diseases epigenomes of select childhood cancers. This “multi-omic” approach generates a comprehensive profile of molecular alterations for each cancer type. Alterations are changes in DNA or RNA, such as rearrangements in chromosome structure or variations in gene expression, respectively. Through computational analyses and assays to validate biological function, TARGET researchers predict which alterations disrupt the function of a gene or pathway and promote cancer growth, progression, and/or survival. Researchers identify candidate therapeutic targets and/or prognostic markers from the cancer-associated alterations.

  11. The Landscape of microRNA Targeting in Prostate Cancer Defined by AGO-PAR-CLIP

    Directory of Open Access Journals (Sweden)

    Mark P. Hamilton

    2016-06-01

    Full Text Available MicroRNA (miRNA deregulation in prostate cancer (PCa contributes to PCa initiation and metastatic progression. To comprehensively define the cancer-associated changes in miRNA targeting and function in commonly studied models of PCa, we performed photoactivatable ribonucleoside-enhanced cross-linking immunoprecipitation of the Argonaute protein in a panel of PCa cell lines modeling different stages of PCa progression. Using this comprehensive catalogue of miRNA targets, we analyzed miRNA targeting on known drivers of PCa and examined tissue-specific and stage-specific pathway targeting by miRNAs. We found that androgen receptor is the most frequently targeted PCa oncogene and that miR-148a targets the largest number of known PCa drivers. Globally, tissue-specific and stage-specific changes in miRNA targeting are driven by homeostatic response to active oncogenic pathways. Our findings indicate that, even in advanced PCa, the miRNA pool adapts to regulate continuing alterations in the cancer genome to balance oncogenic molecular changes. These findings are important because they are the first to globally characterize miRNA changes in PCa and demonstrate how the miRNA target spectrum responds to staged tumorigenesis.

  12. Structured cylindrical targets

    International Nuclear Information System (INIS)

    Arnold, R.

    1986-01-01

    A variety of experimental concepts using high-energy heavy-ion beams in cylindrical targets have been studied through numerical simulation. With an accelerator planned for GSl, plasma temperatures of 100 eV can be reached by cylindrical compression, using inhomogeneous hollow-shell targets. Magnetic insulation, using external fields, has been explored as an aid in reaching high core temperatures. Experiments on collision-pumped x-ray laser physics are also discussed. (ii) Two-dimensional PlC code simulations of homogeneous solid targets show hydrodynamic effects not found in previous 1-D calculations. (iii) Preliminary ideas for an experiment on non-equilibrium heavy-ion charge-states using an existing accelerator and a pre-formed plasma target are outlined. (author)

  13. Structured cylindrical targets

    International Nuclear Information System (INIS)

    Arnold, R.; Lackner-Russo, D.; Meyer-ter-Vehn, J.; Hoffmann, I.

    1986-01-01

    A variety of experimental concepts using high-energy heavy-ion beams in cylindrical targets have been studied through numerical simulation. With an accelerator planned for GSl, plasma temperatures of 100 eV can be reached by cylindrical compression, using inhomogenous hollow-shell targets. Magnetic insulation, using external fields, has been explored as an aid in reaching high core temperatures. Experiments on collision-pumped x-ray laser physics are also discussed. (ii) Two-dimensional PlC code simulations of homogeneous solid targets show hydrodynamic effects not found in previous l-D calculations. (iii) Preliminary ideas for an experiment on non-equilibrium heavy-ion charge-states using an existing accelerator and a pre-formed plasma target are outlined. (author)

  14. Target Price Accuracy

    Directory of Open Access Journals (Sweden)

    Alexander G. Kerl

    2011-04-01

    Full Text Available This study analyzes the accuracy of forecasted target prices within analysts’ reports. We compute a measure for target price forecast accuracy that evaluates the ability of analysts to exactly forecast the ex-ante (unknown 12-month stock price. Furthermore, we determine factors that explain this accuracy. Target price accuracy is negatively related to analyst-specific optimism and stock-specific risk (measured by volatility and price-to-book ratio. However, target price accuracy is positively related to the level of detail of each report, company size and the reputation of the investment bank. The potential conflicts of interests between an analyst and a covered company do not bias forecast accuracy.

  15. Autonomous Target Ranging Techniques

    DEFF Research Database (Denmark)

    Jørgensen, Peter Siegbjørn; Jørgensen, John Leif; Denver, Troelz

    2003-01-01

    of this telescope, a fast determination of the range to and the motion of the detected targets are important. This is needed in order to prepare the future observation strategy for each target, i.e. when is the closest approach where imaging will be optimal. In order to quickly obtain such a determination two...... ranging strategies are presented. One is an improved laser ranger with an effective range with non-cooperative targets of at least 10,000 km, demonstrated in ground tests. The accuracy of the laser ranging will be approximately 1 m. The laser ranger may furthermore be used for trajectory determination...... of nano-gravity probes, which will perform direct mass measurements of selected targets. The other is triangulation from two spacecraft. For this method it is important to distinguish between detection and tracking range, which will be different for Bering since different instruments are used...

  16. Targeted Cancer Therapies

    Science.gov (United States)

    ... are sometimes referred to as the product of "rational" drug design.) One approach to identify potential targets ... molecules that stimulate new blood vessel growth. Immunotherapies trigger the immune system to destroy cancer cells. Some ...

  17. Targeting radiation to tumours

    International Nuclear Information System (INIS)

    Wheldon, T.E.; Greater Glasgow Health Board, Glasgow

    1994-01-01

    Biologically targeted radiotherapy entails the preferential delivery of radiation to solid tumours or individual tumour cells by means of tumour-seeking delivery vehicles to which radionuclides can be conjugated. Monoclonal antibodies have attracted attention for some years as potentially selective targeting agents, but advances in tumour and molecular biology are now providing a much wider choice of molecular species. General radiobiological principles may be derived which are applicable to most forms of targeted radiotherapy. These principles provide guidelines for the appropriate choice of radionuclide in specific treatment situations and its optimal combination with other treatment modalities. In future, the availability of gene targeting agents will focus attention on the use of Auger electron emitters whose high potency and short range selectivity makes them attractive choices for specific killing of cancer cells whose genetic peculiarities are known. (author)

  18. Strategic Targeted Advertising

    OpenAIRE

    Andrea Galeotti; Jose Luis Moraga

    2003-01-01

    textabstractWe present a strategic game of pricing and targeted-advertising. Firms can simultaneously target price advertisements to different groups of customers, or to the entire market. Pure strategy equilibria do not exist and thus market segmentation cannot occur surely. Equilibria exhibit random advertising --to induce an unequal distribution of information in the market-- and random pricing --to obtain profits from badly informed buyers--. We characterize a positive profits equilibrium...

  19. Targets and teamwork

    DEFF Research Database (Denmark)

    Skinner, Timothy C.; Lange, Karin S.; Hoey, Hilary

    2017-01-01

    differences in mean HbA1c between centers ranging from 7.3±0.8% (53mmol/mol±8.7) to 8.9±1.1% (74mmol/mol±12.0). Centers with lower mean HbA1c had (1) parents who reported lower targets for their children, (2) health-care professionals that reported lower targets and more frequent testing, and (3) teams...

  20. Targets and special materials

    International Nuclear Information System (INIS)

    Blanc, R.; Bouriant, M.; Richaud, J.P.

    1997-01-01

    The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)

  1. The ISIS target

    International Nuclear Information System (INIS)

    Carne, A.; Broome, T.A.; Hogston, J.R.; Holding, M.

    1989-01-01

    This presentation discusses the two target failures that have occurred, gives the understanding of the causes and indicates the steps being taken to alleviate the problems. At the outset of the design it was understood that the target would have a finite lifetime, due to radiation damage effects, exacerbated by mechanical damage due to thermal cycling and fatigue. Estimates of target lifetime at full intensity are about 2 years for radiation damage swelling and about 10E4 gross thermal excursions. The latter number is the one which gives uncertainty in defining the life of the target, since it is dependent on the reliability of the accelerator and quality of the proton beam. The commissioning of an accelerator system and bringing it up to high beam intensities have their own special problems. There must be protection of components against uncontrolled beam loss, which produces thermal damage, prompt radiation and induced activity. Fast beam trips for beam loss protection, or equipment failures, result in quenches from high temperature in the target which get bigger with increasing beam intensity. But the target itself is a difficult device to make, taking about 12 months to manufacture. Further, changing one is a complex and time consuming task, not without its hazards. There is thus something of a balancing act to bring the accelerator towards specification before the target fails due to thermal cycling fatigue. In the early days of ISIS beam loss protection was the dominant consideration and the target was regarded somewhat as a sacrificial lamb to the goddess of machine reliability. 2 refs., 6 figs

  2. An ISOLDE target unit

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    A good dozen different targets are available for ISOLDE, made of different materials and equipped with different kinds of ion-sources, according to the needs of the experiments. Each separator (GPS: general purpose; HRS: high resolution) has its own target. Because of the high radiation levels, robots effect the target changes, about 80 times per year. In the standard unit shown in picture _01, the target is the cylindrical object in the front. It contains uranium-carbide kept at a temperature of 2200 deg C, necessary for the isotopes to be able to escape. At either end, one sees the heater current leads, carrying 700 A. The Booster beam, some 3E13 protons per pulse, enters the target from left. The evaporated isotope atoms enter a hot-plasma ion source (the black object behind the target). The whole unit sits at 60 kV potential (pulsed in synchronism with the arrival of the Booster beam) which accelerates the ions (away from the viewer) towards one of the 2 separators.

  3. Laser targets: introduction

    International Nuclear Information System (INIS)

    Rosen, M.D.

    1985-01-01

    The laser target design group was engaged in three main tasks in 1984: (1) analyzing Novette implosion and hohlraum-scaling data, (2) planning for the first experiments on Nova, and (3) designing laboratory x-ray laser targets and experiments. The Novette implosion and hohlraum scaling data are mostly classified and are therefore not discussed in detail here. The authors achieved average final/initial pusher pr ratios of about 50, some 3 times higher than the value achieved in the best Shiva shots. These pr values imply a fuel compression to 100 times liquid density, although this figure and other aspects of the experiments are subject to further interpretation because of detailed questions of target symmetry and stability. Their main long-term goal for Nova is to produce a so-called hydrodynamically equivalent target (HET) - that is, a target whose hydrodynamic behavior (implosion velocity, convergence ratio, symmetry and stability requirements, etc.) is very much like that of a high-gain target, but one that is scaled down in size to match the energy available from Nova and is too small to achieve enough hot-spot pr to ignite the cold, near-Fermi-degenerate fuel around it. Their goal for Nova's first year is to do experiments that will teach them how to achieve the symmetry and stability conditions required by an HET

  4. Argus target chamber

    International Nuclear Information System (INIS)

    Rienecker, F. Jr.; Glaros, S.S.; Kobierecki, M.

    1975-01-01

    A target chamber for application in the laser fusion program must satisfy some very basic requirements. (1) Provide a vacuum on the order of 10 -6 torr. (2) Support a microscopically small target in a fixed point in space and verify its location within 5 micrometers. (3) Contain an adjustable beam focusing system capable of delivering a number of laser beams onto the target simultaneously, both in time and space. (4) Provide access for diagnostics to evaluate the results of target irradiation. (5) Have flexibility to allow changes in targets, focusing optics and number of beams. The ARGUS laser which is now under construction at LLL will have a target chamber which meets these requirements in a simple economic manner. The chamber and auxiliary equipment are described, with reference to two double beam focusing systems; namely, lenses and ellipsoidal mirrors. Provision is made for future operation with four beams, using ellipsoidal mirrors for two-sided illumination and lens systems for tetragonal and tetrahedral irradiation

  5. A comparative study of superdeformation in 146,147,148Gd. Possible manifestations of the pseudo-SU3 symmetry, octupole shape susceptibility and superdeformed deep-hole excitations

    International Nuclear Information System (INIS)

    Zuber, K.; Balouka, D.; Beck, F.A.; Byrski, T.; Curien, D.; France, G. de; Duchene, G.; Gehringer, C.; Haas, B.; Merdinger, J.C.; Romain, P.; Santos, D.; Styczen, J.; Vivien, J.P.; Dudek, J.; Szymanski, Z.; Werner, T.R.

    1991-01-01

    Two discrete superdeformed (SD) bands have been identified in the nucleus 147 Gd and the twin-band mechanism studied by comparison with SD results for 146,148 Gd. Theoretical interprettion in terms of nucleonic orbitals with the Woods-Saxon potential is consistent with the pseudo-spin symmetry picture and the octupole susceptibility mechanism predicted by theory. (orig.)

  6. A comparative study of superdeformation in sup 146,147,148 Gd. Possible manifestations of the pseudo-SU sub 3 symmetry, octupole shape susceptibility and superdeformed deep-hole excitations

    Energy Technology Data Exchange (ETDEWEB)

    Zuber, K.; Balouka, D.; Beck, F.A.; Byrski, T.; Curien, D.; France, G. de; Duchene, G.; Gehringer, C.; Haas, B.; Merdinger, J.C.; Romain, P.; Santos, D.; Styczen, J.; Vivien, J.P.; Dudek, J.; Szymanski, Z.; Werner, T.R. (Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires)

    1991-01-24

    Two discrete superdeformed (SD) bands have been identified in the nucleus {sup 147}Gd and the twin-band mechanism studied by comparison with SD results for {sup 146,148}Gd. Theoretical interprettion in terms of nucleonic orbitals with the Woods-Saxon potential is consistent with the pseudo-spin symmetry picture and the octupole susceptibility mechanism predicted by theory. (orig.).

  7. Modulation of FABP4 hypomethylation by DNMT1 and its inverse interaction with miR-148a/152 in the placenta of preeclamptic rats and HTR-8 cells.

    Science.gov (United States)

    Yang, Anning; Zhang, Huiping; Sun, Yue; Wang, Yanhua; Yang, Xiaoming; Yang, Xiaoling; Zhang, Hui; Guo, Wei; Zhu, Guangrong; Tian, Jue; Jia, Yuexia; Jiang, Yideng

    2016-10-01

    Inflammation and dysregulated lipid metabolism are involved in the pathogenesis of preeclampsia, and fatty acid binding protein 4 (FABP4) is known to regulate both inflammation and lipid metabolism. In the present study, we elucidated the role of FABP4 using in vitro and in vivo models of preclampsia. We found increased expression of FABP4 in the placenta of preeclamptic rats, which was further confirmed in HTR-8 cells, an extravillous trophoblast cell line, treated with L-NAME. Overexpression of FABP4 in HTR-8 cells resulted in upregulated expression of pro-inflammatory cytokines IL-6 and TNF-α, and increased lipid accumulation, suggesting that FABP4 plays a role in preeclampsia. Furthermore, downregulation of methylation in the promotor resulted in increased FABP4 expression, which was mediated by downregulated DNA methyltransferase 1 (DNMT1). Bioinformatics analysis showed that miR-148a/152 regulated the expression of DNMT1, and additional in vitro studies revealed that miR-148a/152 inhibited DNMT1 expression by directly binding to its 3'-UTR. Interestingly, DNMT1 enhanced the expression of miR-148a/152 by downregulation of methylation in its promotor. Taken together, our results showed that FABP4 may be involved in the pathogenesis of preeclampsia, and the expression of FABP4 is enhanced by miR-148a/152 mediated inhibition of DNMT1 expression. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Testing a newly developed single-sphere neutron spectrometer in reference monochromatic fields from 147 keV to 14.8 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN—LNF Laboratori Nazionali di Frascati, Via E. Fermi n. 40, 00044 Frascati (Italy); Gómez-Ros, J.M. [INFN—LNF Laboratori Nazionali di Frascati, Via E. Fermi n. 40, 00044 Frascati (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Pola, A.; Introini, M.V. [Politecnico di Milano - Dipartimento di Energia, Via Ponzio 34/3, 20133 Milano (Italy); Bortot, D. [INFN—LNF Laboratori Nazionali di Frascati, Via E. Fermi n. 40, 00044 Frascati (Italy); Politecnico di Milano - Dipartimento di Energia, Via Ponzio 34/3, 20133 Milano (Italy); Gentile, A.; Esposito, A.; Mazzitelli, G.; Buonomo, B.; Quintieri, L.; Foggetta, L. [INFN—LNF Laboratori Nazionali di Frascati, Via E. Fermi n. 40, 00044 Frascati (Italy)

    2013-06-21

    A new neutron spectrometer, designed to simultaneously respond from the thermal domain up to hundreds of MeV neutrons, was designed and built in the framework of the INFN project NESCOFI@BTF. It has been called SP{sup 2} (SPherical SPectrometer) and it consists of 31 thermal neutron detectors embedded in a 25 cm diameter polyethylene sphere with an internal 1 cm thick lead shell. The new spectrometer shows similar performance as the Bonner sphere spectrometer, but has the notable advantage of requiring only one exposure to determine the whole spectrum. The SP{sup 2} response matrix, previously calculated with MCNP, has been experimentally evaluated with monochromatic reference neutron fields from 147 keV to 14.8 MeV at PTB Braunschweig. As suitable thermal neutron detectors, Dysprosium activation foils were adopted at this stage. The results of the experiment confirmed the correctness of the response matrix within an overall uncertainty of ±3%. The next phase of the NESCOFI@BTF project will be the replacement of passive detectors with active counters, thus leading to a real-time spectrometric monitor that is expected to significantly innovate the neutron control task in neutron-producing facilities, such as the beam-lines for industrial irradiation or condensed matter studies.

  9. Neutron-capture cross-section measurements of Xe136 between 0.4 and 14.8 MeV

    Science.gov (United States)

    Bhike, Megha; Tornow, W.

    2014-03-01

    Fast-neutron-capture cross-section data on Xe136 have been measured with the activation method between 0.4 and 14.8 MeV. The cross section was found to be of the order of 1 mb at the eleven energies investigated. This result is important to interpret potential neutron-induced backgrounds in the enriched xenon observatory and KamLAND-Zen neutrinoless double-β decay searches that use xenon as both source and detector. A high-pressure sphere filled with Xe136 was irradiated with monoenergetic neutrons produced by the reactions 3H(p ,n)3He, 2H(d ,n)3He, and 3H(d ,n)4He. Indium and gold monitor foils were irradiated simultaneously with the Xe136 to determine the incident neutron flux. The activities of the reaction products were measured with high-resolution γ-ray spectroscopy. The present results are compared to predictions from ENDF/B-VII.1 and TENDL-2012.

  10. A metagenome-derived thermostable β-glucanase with an unusual module architecture which defines the new glycoside hydrolase family GH148.

    Science.gov (United States)

    Angelov, Angel; Pham, Vu Thuy Trang; Übelacker, Maria; Brady, Silja; Leis, Benedikt; Pill, Nicole; Brolle, Judith; Mechelke, Matthias; Moerch, Matthias; Henrissat, Bernard; Liebl, Wolfgang

    2017-12-11

    The discovery of novel and robust enzymes for the breakdown of plant biomass bears tremendous potential for the development of sustainable production processes in the rapidly evolving new bioeconomy. By functional screening of a metagenomic library from a volcano soil sample a novel thermostable endo-β-glucanase (EngU) which is unusual with regard to its module architecture and cleavage specificity was identified. Various recombinant EngU variants were characterized. Assignment of EngU to an existing glycoside hydrolase (GH) family was not possible. Two regions of EngU showed weak sequence similarity to proteins of the GH clan GH-A, and acidic residues crucial for catalytic activity of EngU were identified by mutation. Unusual, a carbohydrate-binding module (CBM4) which displayed binding affinity for β-glucan, lichenin and carboxymethyl-cellulose was found as an insertion between these two regions. EngU hydrolyzed β-1,4 linkages in carboxymethyl-cellulose, but displayed its highest activity with mixed linkage (β-1,3-/β-1,4-) glucans such as barley β-glucan and lichenin, where in contrast to characterized lichenases cleavage occurred predominantly at the β-1,3 linkages of C4-substituted glucose residues. EngU and numerous related enzymes with previously unknown function represent a new GH family of biomass-degrading enzymes within the GH-A clan. The name assigned to the new GH family is GH148.

  11. Effect of APE1 T2197G (Asp148Glu Polymorphism on APE1, XRCC1, PARP1 and OGG1 Expression in Patients with Colorectal Cancer

    Directory of Open Access Journals (Sweden)

    Juliana C. Santos

    2014-09-01

    Full Text Available It has been hypothesized that genetic variation in base excision repair (BER might modify colorectal adenoma risk. Thus, we evaluated the influence of APE1 T2197G (Asp148Glu polymorphism on APE1, XRCC1, PARP1 and OGG1 expression in normal and tumor samples from patients with colorectal cancer. The results indicate a downregulation of OGG1 and an upregulation of XRCC1 expression in tumor tissue. Regarding the anatomical location of APE1, OGG1 and PARP-1, a decrease in gene expression was observed among patients with cancer in the rectum. In patients with or without some degree of tumor invasion, a significant downregulation in OGG1 was observed in tumor tissue. Interestingly, when taking into account the tumor stage, patients with more advanced grades (III and IV showed a significant repression for APE1, OGG1 and PARP-1. XRCC1 expression levels were significantly enhanced in tumor samples and were correlated with all clinical and histopathological data. Concerning the polymorphism T2197G, GG genotype carriers exhibited a significantly reduced expression of genes of the BER repair system (APE1, XRCC1 and PARP1. In summary, our data show that patients with colorectal cancer present expression changes in several BER genes, suggesting a role for APE1, XRCC1, PARP1 and OGG1 and APE1 polymorphism in colorectal carcinogenesis.

  12. Measurement and calculation of neutron leakage spectra from slab samples of beryllium, gallium and tungsten irradiated with 14.8 MeV neutrons

    Science.gov (United States)

    Nie, Y. B.; Ruan, X. C.; Ren, J.; Zhang, S.; Han, R.; Bao, J.; Huang, H. X.; Ding, Y. Y.; Wu, H. C.; Liu, P.; Zhou, Z. Y.

    2017-09-01

    In order to make benchmark validation of the nuclear data for gallium (Ga), tungsten (W) and beryllium (Be) in existing modern evaluated nuclear data files, neutron leakage spectra in the range from 0.8 to 15 MeV from slab samples were measured by time-of-flight technique with a BC501 scintillation detector. The measurements were performed at China Institute of Atomic Energy (CIAE) using a D-T neutron source. The thicknesses of the slabs were 0.5 to 2.5 mean free path for 14.8 MeV neutrons, and the measured angles were chosen to be 60∘ and 120∘. The measured spectra were compared with those calculated by the continuous energy Monte-Carlo transport code MCNP, using the data from the CENDL-3.1, ENDF/B-VII.1 and JENDL-4.0 nuclear data files, the comparison between the experimental and calculated results show that: The results from all three libraries significantly underestimate the cross section in energy range of 10-13 MeV for Ga; For W, the calculated spectra using data from CENDL-3.1 and JENDL-4.0 libraries show larger discrepancies with the measured ones, especially around 8.5-13.5 MeV; and for Be, all the libraries led to underestimation below 3 MeV at 120∘.

  13. Chemical and biological evaluation of 153Sm and 46/47Sc complexes of indazolebisphosphonates for targeted radiotherapy

    International Nuclear Information System (INIS)

    Neves, Maria; Teixeira, Fatima C.; Antunes, Ines; Majkowska, Agnieszka; Gano, Lurdes; Santos, Ana Cristina

    2011-01-01

    Introduction: Novel 1-hydroxy-1,1-bisphosphonates derived from indazole and substituted at the C-3 position were labeled with the radionuclides 46 Sc and 153 Sm. Several parameters such as molar ligand concentration, pH, reaction time and temperature were studied. The radiolabelling yield, reaction kinetics and stability were assessed and radiocomplexes were evaluated by in vitro and in vivo experiments. Methods: The radionuclides 46 Sc and 153 Sm were obtained by neutron irradiation of natural Sc 2 O 3 and enriched 152 Sm 2 O 3 (98.4%) targets at the neutron flux of 3x10 14 n cm -2 s -1 . The radiolabelling yield, reaction kinetics and stability were accomplished by ascending instant thin layer chromatography. The radiocomplexes were submitted to in vitro experiments (hydroxyapatite binding and lipophilicity) and biodistribution studies in animal models. Results: The radionuclides 46 Sc and 153 Sm were produced with specific activities of 100 and 430 MBq mg -1 , respectively. High radiochemical yields were achieved and the hydrophilic radiocomplexes have shown high degree of binding to hydroxyapatite. Biodistribution studies at 1, 3 and 24 h of the 4 radiocomplexes under study, have showed a similar biodistribution profile with a relatively high bone uptake, slow clearance from blood and a very slow rate of total radioactivity excretion from the whole animal body. Conclusion: We have developed a new class of indazolebisphosphonates complexes with radioisotopes of samarium and scandium. All complexes have shown high degree of binding to hydroxyapatite, which could be attributed to the ionized phosphonate groups. The bone uptake and the bone-to-muscle ratios were relatively low.

  14. Chemical and biological evaluation of {sup 153}Sm and {sup 46/47}Sc complexes of indazolebisphosphonates for targeted radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Neves, Maria, E-mail: mneves@itn.p [Instituto Tecnologico e Nuclear, Sacavem (Portugal); Teixeira, Fatima C.; Antunes, Ines [INETI-Departamento de Tecnologia de Industrias Quimicas, Lisboa (Portugal); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Gano, Lurdes [Instituto Tecnologico e Nuclear, Sacavem (Portugal); Santos, Ana Cristina [IBB-Instituto de Biofisica e Biomatematica, Coimbra (Portugal)

    2011-01-15

    Introduction: Novel 1-hydroxy-1,1-bisphosphonates derived from indazole and substituted at the C-3 position were labeled with the radionuclides {sup 46}Sc and {sup 153}Sm. Several parameters such as molar ligand concentration, pH, reaction time and temperature were studied. The radiolabelling yield, reaction kinetics and stability were assessed and radiocomplexes were evaluated by in vitro and in vivo experiments. Methods: The radionuclides {sup 46}Sc and {sup 153}Sm were obtained by neutron irradiation of natural Sc{sub 2}O{sub 3} and enriched {sup 152}Sm{sub 2}O{sub 3} (98.4%) targets at the neutron flux of 3x10{sup 14} n cm{sup -2} s{sup -1}. The radiolabelling yield, reaction kinetics and stability were accomplished by ascending instant thin layer chromatography. The radiocomplexes were submitted to in vitro experiments (hydroxyapatite binding and lipophilicity) and biodistribution studies in animal models. Results: The radionuclides {sup 46}Sc and {sup 153}Sm were produced with specific activities of 100 and 430 MBq mg{sup -1}, respectively. High radiochemical yields were achieved and the hydrophilic radiocomplexes have shown high degree of binding to hydroxyapatite. Biodistribution studies at 1, 3 and 24 h of the 4 radiocomplexes under study, have showed a similar biodistribution profile with a relatively high bone uptake, slow clearance from blood and a very slow rate of total radioactivity excretion from the whole animal body. Conclusion: We have developed a new class of indazolebisphosphonates complexes with radioisotopes of samarium and scandium. All complexes have shown high degree of binding to hydroxyapatite, which could be attributed to the ionized phosphonate groups. The bone uptake and the bone-to-muscle ratios were relatively low.

  15. Burglar Target Selection

    Science.gov (United States)

    Townsley, Michael; Bernasco, Wim; Ruiter, Stijn; Johnson, Shane D.; White, Gentry; Baum, Scott

    2015-01-01

    Objectives: This study builds on research undertaken by Bernasco and Nieuwbeerta and explores the generalizability of a theoretically derived offender target selection model in three cross-national study regions. Methods: Taking a discrete spatial choice approach, we estimate the impact of both environment- and offender-level factors on residential burglary placement in the Netherlands, the United Kingdom, and Australia. Combining cleared burglary data from all study regions in a single statistical model, we make statistical comparisons between environments. Results: In all three study regions, the likelihood an offender selects an area for burglary is positively influenced by proximity to their home, the proportion of easily accessible targets, and the total number of targets available. Furthermore, in two of the three study regions, juvenile offenders under the legal driving age are significantly more influenced by target proximity than adult offenders. Post hoc tests indicate the magnitudes of these impacts vary significantly between study regions. Conclusions: While burglary target selection strategies are consistent with opportunity-based explanations of offending, the impact of environmental context is significant. As such, the approach undertaken in combining observations from multiple study regions may aid criminology scholars in assessing the generalizability of observed findings across multiple environments. PMID:25866418

  16. LANSCE target system performance

    International Nuclear Information System (INIS)

    Russell, G.J.; Gilmore, J.S.; Robinson, H.; Legate, G.L.; Bridge, A.; Sanchez, R.J.; Brewton, R.J.; Woods, R.; Hughes, H.G. III

    1989-01-01

    We measured neutron beam fluxes at LANSCE using gold foil activation techniques. We did an extensive computer simulation of the as-built LANSCE Target/Moderator/Reflector/Shield geometry. We used this mockup in a Monte Carlo calculation to predict LANSCE neutronic performance for comparison with measured results. For neutron beam fluxes at 1 eV, the ratio of measured data to calculated varies from ∼0.6-0.9. The computed 1 eV neutron leakage at the moderator surface is 3.9 x 10 10 n/eV-sr-s-μA for LANSCE high-intensity water moderators. The corresponding values for the LANSCE high-resolution water moderator and the liquid hydrogen moderator are 3.3 and 2.9 x 10 10 , respectively. LANSCE predicted moderator intensities (per proton) for a tungsten target are essentially the same as ISIS predicted moderator intensities for a depleted uranium target. The calculated LANSCE steady state unperturbed thermal (E 13 n/cm 2 -s. The unique LANSCE split-target/flux-trap-moderator system is performing exceedingly well. The system has operated without a target or moderator change for over three years at nominal proton currents of ∼25 μA of 800-MeV protons. (author)

  17. 143 - 148_Makeri et al.

    African Journals Online (AJOL)

    USER

    2015-06-01

    Jun 1, 2015 ... Yuan et al., 2003), antimicrobial activity (Sundarrao et al., 1993; Betancur-Galvis et al., 1999; Takashi et al., 2006), anti-parasitic, anti-malarial activities (Alali et al., 1998; Jaramillo et al., 2000; Luna et al.,. 2005). This study evaluates the antibacterial activity of extract of stem –bark and leaf extracts of Annona.

  18. Modelling Recycling Targets

    DEFF Research Database (Denmark)

    Hill, Amanda Louise; Leinikka Dall, Ole; Andersen, Frits M.

    2014-01-01

    Within the European Union (EU) a paradigm shift is currently occurring in the waste sector, where EU waste directives and national waste strategies are placing emphasis on resource efficiency and recycling targets. The most recent Danish resource strategy calculates a national recycling rate of 22......% for household waste, and sets an ambitious goal of a 50% recycling rate by 2020. This study integrates the recycling target into the FRIDA model to project how much waste and from which streams should be diverted from incineration to recycling in order to achieve the target. Furthermore, it discusses how...... the existing technological, organizational and legislative frameworks may affect recycling activities. The results of the analysis show that with current best practice recycling rates, the 50% recycling rate cannot be reached without recycling of household biowaste. It also shows that all Danish municipalities...

  19. Targeted Phototherapy (newer phototherapy

    Directory of Open Access Journals (Sweden)

    Zonunsanga

    2015-04-01

    Full Text Available Conventional phototherapy uses a whole body cabinet or body part machine such as hand, foot or scalp machines. They have many disadvantages due to which new phototherapy technique was then developed to overcome this situation. This new technique is called targeted phototherapy which includes excimer laser, intense pulse light system (IPL, photodynamic therapy and ultraviolet (UV light source with a sophisticated delivery system which is easy to be operated by hands. The mechanisms of action of targeted phototherapy systems are similar to those in conventional UVB/UVA therapy. They have many advantages like less chances of side effects, avoidance of exposure of unnecessary sites, faster response, shortening of the duration of treatments. But they have disadvantages like high costs and inability to use for extensive areas. This review article discusses targeted phototherapy in considerable to the mechanism of actions and advantages and disadvantages in comparison to the conventional phototherapy.

  20. Setting reference targets

    International Nuclear Information System (INIS)

    Ruland, R.E.

    1997-04-01

    Reference Targets are used to represent virtual quantities like the magnetic axis of a magnet or the definition of a coordinate system. To explain the function of reference targets in the sequence of the alignment process, this paper will first briefly discuss the geometry of the trajectory design space and of the surveying space, then continue with an overview of a typical alignment process. This is followed by a discussion on magnet fiducialization. While the magnetic measurement methods to determine the magnetic centerline are only listed (they will be discussed in detail in a subsequent talk), emphasis is given to the optical/mechanical methods and to the task of transferring the centerline position to reference targets

  1. Fine target of deuterium

    International Nuclear Information System (INIS)

    Diaz Diaz, J.; Granados Gonzalez, C. E.; Gutierrez Bernal, R.

    1959-01-01

    A fine target of deuterium on a tantalum plate by the absorption method is obtained. In order to obtain the de gasification temperature an induction generator of high frequency is used and the deuterium pass is regulated by means of a palladium valve. Two vacuum measures are available, one to measure the high vacuum in the de gasification process of the tantalum plate and the other, for low vacuum, to measure the deuterium inlet in the installation and the deuterium pressure change in the installation after the absorption in the tantalum plate. A target of 48 μ gr/cm 2 thick is obtained. (Author) 1 refs

  2. Targeting the right journal.

    Science.gov (United States)

    Piterman, L; McCall, L

    1999-07-01

    While research is scientific, publication is a mixture of science and political pragmatism. Targeting the right journal is influenced by the following factors: the discipline that best represents the subject; the purpose of the message; the audience who are to be recipients of the message; the realities of geographic parochialism; the desire of authors to maximise personal and professional opportunities. If the originally targeted journal rejects the article, authors should have alternative publication strategies that give them professional recognition without requiring them to compromise the message or their ethics.

  3. AA antiproton production target

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The first version of the antiproton production target was a tungsten rod, 11 cm long (actually a row of 11 rods, each 1 cm long) and 3 mm in diameter. The rod was embedded in graphite, pressure-seated into an outer casing made of stainless steel. The casing had fins for forced-air cooling. In this picture, the 26 GeV high-intensity beam from the PS enters from the right, where a scintillator screen, with circles every 5 mm in radius, permits precise aim at the target centre. See also 7903034 and 7905094.

  4. Targets and tactics

    DEFF Research Database (Denmark)

    Woo, V; Shestakova, M V; Ørskov, C

    2008-01-01

    BACKGROUND: The incidence of type 2 diabetes is reaching pandemic proportions, impacting patients and healthcare systems across the globe. Evidence suggests that a majority of patients are not achieving recommended blood glucose targets resulting in an increased risk of micro- and macro-vascular ......BACKGROUND: The incidence of type 2 diabetes is reaching pandemic proportions, impacting patients and healthcare systems across the globe. Evidence suggests that a majority of patients are not achieving recommended blood glucose targets resulting in an increased risk of micro- and macro...... diabetes has never been more compelling; with a clear focus on strategies for glycaemic control, the impact of the diabetes pandemic can be limited....

  5. Optimal exploration target zones

    CSIR Research Space (South Africa)

    Debba, Pravesh

    2008-09-01

    Full Text Available -of-evidence (WofE) method logistic regression canonical favorability analysis neural networks evidential belief functions Optimal Exploration Target Zones Debba, Carranza, Stein, van der Meer Introduction to Remote Sensing Background and Objective of the study... for the following equation: n∑ i=r ( n i ) pi(1− p)n−i = 0.95 . (1) Optimal Exploration Target Zones Debba, Carranza, Stein, van der Meer Introduction to Remote Sensing Background and Objective of the study Methodology Results METHODS (cont. . . ): FITNESS FUNCTION...

  6. ISOLDE back on target

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    Today, Friday 1 August, the ISOLDE installation, supplied by the beams of the PS Booster, restarted its physics programme. After a shutdown of almost a year and a half, there was a real buzz in the air as the first beam of protons hit the target of the first post-LS1 ISOLDE experiment.   One of the new target-handling robots installed by ISOLDE during LS1. Many improvements have been made to the ISOLDE installation during LS1. One of the main projects was the installation of new robots for handling the targets (see photo 1). “Our targets are bombarded by protons from the PS Booster’s beams and become very radioactive,” explains Maria Jose Garcia Borge, spokesperson for the ISOLDE collaboration. “They therefore need to be handled carefully, which is where the robots come in. The robots we had until now were already over 20 years old and were starting to suffer from the effects of radiation. So LS1 was a perfect opportunity to replace them with more moder...

  7. Targeted Therapy for Melanoma

    International Nuclear Information System (INIS)

    Quinn, Thomas; Moore, Herbert

    2016-01-01

    The research project, entitled ''Targeted Therapy for Melanoma,'' was focused on investigating the use of kidney protection measures to lower the non-specific kidney uptake of the radiolabeled Pb-DOTA-ReCCMSH peptide. Previous published work demonstrated that the kidney exhibited the highest non-target tissue uptake of the "2"1"2"P"b"/"2"0"3Pb radiolabeled melanoma targeting peptide DOTA-ReCCMSH. The radiolabeled alpha-melanocyte stimulating hormone (α-MSH) peptide analog DOTA-Re(Arg"1"1)CCMSH, which binds the melanocortin-1 receptor over-expressed on melanoma tumor cells, has shown promise as a PRRT agent in pre-clinical studies. High tumor uptake of "2"1"2Pb labeled DOTA-Re(Arg"1"1)CCMSH resulted in tumor reduction or eradication in melanoma therapy studies. Of particular note was the 20-50% cure rate observed when melanoma mice were treated with alpha particle emitter "2"1"2Pb. However, as with most PRRT agents, high radiation doses to the kidneys where observed. To optimize tumor treatment efficacy and reduce nephrotoxicity, the tumor to kidney uptake ratio must be improved. Strategies to reduce kidney retention of the radiolabeled peptide, while not effecting tumor uptake and retention, can be broken into several categories including modification of the targeting peptide sequence and reducing proximal tubule reabsorption.

  8. Targets of curcumin

    Science.gov (United States)

    Zhou, Hongyu; Beevers, Christopher S.; Huang, Shile

    2010-01-01

    Curcumin (diferuloylmethane), an orange-yellow component of turmeric or curry powder, is a polyphenol natural product isolated from the rhizome of the plant Curcuma longa. For centuries, curcumin has been used in some medicinal preparation or used as a food-coloring agent. In recent years, extensive in vitro and in vivo studies suggested curcumin has anticancer, antiviral, antiarthritic, anti-amyloid, antioxidant, and anti-inflammatory properties. The underlying mechanisms of these effects are diverse and appear to involve the regulation of various molecular targets, including transcription factors (such as nuclear factor-κB), growth factors (such as vascular endothelial cell growth factor), inflammatory cytokines (such as tumor necrosis factor, interleukin 1 and interleukin 6), protein kinases (such as mammalian target of rapamycin, mitogen-activated protein kinases, and Akt) and other enzymes (such as cyclooxygenase 2 and 5 lipoxygenase). Thus, due to its efficacy and regulation of multiple targets, as well as its safety for human use, curcumin has received considerable interest as a potential therapeutic agent for the prevention and/or treatment of various malignant diseases, arthritis, allergies, Alzheimer’s disease, and other inflammatory illnesses. This review summarizes various in vitro and in vivo pharmacological aspects of curcumin as well as the underlying action mechanisms. The recently identified molecular targets and signaling pathways modulated by curcumin are also discussed here. PMID:20955148

  9. Target-Rich Environment

    Science.gov (United States)

    Perna, Mark C.

    2005-01-01

    Target marketing is defining school enrollment goals and then developing a strategic plan to accomplish those goals through the use of specific communication vehicles and community focus. It is critical to reach the right audience, with the right message, at the right time, for the right cost. In this brief article, the author describes several…

  10. Targeted enzyme prodrug therapies.

    Science.gov (United States)

    Schellmann, N; Deckert, P M; Bachran, D; Fuchs, H; Bachran, C

    2010-09-01

    The cure of cancer is still a formidable challenge in medical science. Long-known modalities including surgery, chemotherapy and radiotherapy are successful in a number of cases; however, invasive, metastasized and inaccessible tumors still pose an unresolved and ongoing problem. Targeted therapies designed to locate, detect and specifically kill tumor cells have been developed in the past three decades as an alternative to treat troublesome cancers. Most of these therapies are either based on antibody-dependent cellular cytotoxicity, targeted delivery of cytotoxic drugs or tumor site-specific activation of prodrugs. The latter is a two-step procedure. In the first step, a selected enzyme is accumulated in the tumor by guiding the enzyme or its gene to the neoplastic cells. In the second step, a harmless prodrug is applied and specifically converted by this enzyme into a cytotoxic drug only at the tumor site. A number of targeting systems, enzymes and prodrugs were investigated and improved since the concept was first envisioned in 1974. This review presents a concise overview on the history and latest developments in targeted therapies for cancer treatment. We cover the relevant technologies such as antibody-directed enzyme prodrug therapy (ADEPT), gene-directed enzyme prodrug therapy (GDEPT) as well as related therapies such as clostridial- (CDEPT) and polymer-directed enzyme prodrug therapy (PDEPT) with emphasis on prodrug-converting enzymes, prodrugs and drugs.

  11. Targeting trichothecene biosynthetic genes

    NARCIS (Netherlands)

    Wei, Songhong; Lee, van der Theo; Verstappen, Els; Gent, van Marga; Waalwijk, Cees

    2017-01-01

    Biosynthesis of trichothecenes requires the involvement of at least 15 genes, most of which have been targeted for PCR. Qualitative PCRs are used to assign chemotypes to individual isolates, e.g., the capacity to produce type A and/or type B trichothecenes. Many regions in the core cluster

  12. Targeted Therapy for Melanoma

    Energy Technology Data Exchange (ETDEWEB)

    Quinn, Thomas [Alphamed, Jackson, TN (United States); Moore, Herbert [Alphamed, Jackson, TN (United States)

    2016-12-05

    The research project, entitled ”Targeted Therapy for Melanoma,” was focused on investigating the use of kidney protection measures to lower the non-specific kidney uptake of the radiolabeled Pb-DOTA-ReCCMSH peptide. Previous published work demonstrated that the kidney exhibited the highest non-target tissue uptake of the 212Pb/203Pb radiolabeled melanoma targeting peptide DOTA-ReCCMSH. The radiolabeled alpha-melanocyte stimulating hormone (α-MSH) peptide analog DOTA-Re(Arg11)CCMSH, which binds the melanocortin-1 receptor over-expressed on melanoma tumor cells, has shown promise as a PRRT agent in pre-clinical studies. High tumor uptake of 212Pb labeled DOTA-Re(Arg11)CCMSH resulted in tumor reduction or eradication in melanoma therapy studies. Of particular note was the 20-50% cure rate observed when melanoma mice were treated with alpha particle emitter 212Pb. However, as with most PRRT agents, high radiation doses to the kidneys where observed. To optimize tumor treatment efficacy and reduce nephrotoxicity, the tumor to kidney uptake ratio must be improved. Strategies to reduce kidney retention of the radiolabeled peptide, while not effecting tumor uptake and retention, can be broken into several categories including modification of the targeting peptide sequence and reducing proximal tubule reabsorption.

  13. The targets of curcumin.

    Science.gov (United States)

    Zhou, Hongyu; Beevers, Christopher S; Huang, Shile

    2011-03-01

    Curcumin (diferuloylmethane), an orange-yellow component of turmeric or curry powder, is a polyphenol natural product isolated from the rhizome of the plant Curcuma longa. For centuries, curcumin has been used in some medicinal preparation or used as a food-coloring agent. In recent years, extensive in vitro and in vivo studies suggested curcumin has anticancer, antiviral, antiarthritic, anti-amyloid, antioxidant, and anti-inflammatory properties. The underlying mechanisms of these effects are diverse and appear to involve the regulation of various molecular targets, including transcription factors (such as nuclear factor-kB), growth factors (such as vascular endothelial cell growth factor), inflammatory cytokines (such as tumor necrosis factor, interleukin 1 and interleukin 6), protein kinases (such as mammalian target of rapamycin, mitogen-activated protein kinases, and Akt) and other enzymes (such as cyclooxygenase 2 and 5 lipoxygenase). Thus, due to its efficacy and regulation of multiple targets, as well as its safety for human use, curcumin has received considerable interest as a potential therapeutic agent for the prevention and/or treatment of various malignant diseases, arthritis, allergies, Alzheimer's disease, and other inflammatory illnesses. This review summarizes various in vitro and in vivo pharmacological aspects of curcumin as well as the underlying action mechanisms. The recently identified molecular targets and signaling pathways modulated by curcumin are also discussed here.

  14. The Atacama Cosmology Telescope: A Measurement of the 600 less than l less than 8000 Cosmic Microwave Background Power Spectrum at 148 GHz

    Science.gov (United States)

    Fowler, J. W.; Acquaviva, V.; Ade, P. A. R.; Aguirre, P.; Amiri, M.; Appel, J. W.; Barrientos, L. F.; Bassistelli, E. S.; Bond, J. R.; Brown, B.; hide

    2010-01-01

    We present a measurement of the angular power spectrum of the cosmic microwave background (CMB) radiation observed at 148 GHz. The measurement uses maps with 1.4' angular resolution made with data from the Atacama Cosmology Telescope (ACT). The observations cover 228 deg(sup 2) of the southern sky, in a 4 deg. 2-wide strip centered on declination 53 deg. South. The CMB at arc minute angular scales is particularly sensitive to the Silk damping scale, to the Sunyaev-Zel'dovich (SZ) effect from galaxy dusters, and to emission by radio sources and dusty galaxies. After masking the 108 brightest point sources in our maps, we estimate the power spectrum between 600 less than l less than 8000 using the adaptive multi-taper method to minimize spectral leakage and maximize use of the full data set. Our absolute calibration is based on observations of Uranus. To verify the calibration and test the fidelity of our map at large angular scales, we cross-correlate the ACT map to the WMAP map and recover the WMAP power spectrum from 250 less than l less than 1150. The power beyond the Silk damping tail of the CMB (l approximately 5000) is consistent with models of the emission from point sources. We quantify the contribution of SZ clusters to the power spectrum by fitting to a model normalized to sigma 8 = 0.8. We constrain the model's amplitude A(sub sz) less than 1.63 (95% CL). If interpreted as a measurement of as, this implies sigma (sup SZ) (sub 8) less than 0.86 (95% CL) given our SZ model. A fit of ACT and WMAP five-year data jointly to a 6-parameter ACDM model plus point sources and the SZ effect is consistent with these results.

  15. Sequence analysis of Epstein-Barr virus EBNA-2 gene coding amino acid 148-487 in nasopharyngeal and gastric carcinomas

    Directory of Open Access Journals (Sweden)

    Wang Xinying

    2012-02-01

    Full Text Available Abstract Background The Epstein-Barr virus (EBV nuclear antigen 2 (EBNA-2 plays a key role in the B-cell growth transformation by initiating and maintaining the proliferation of infected B-cell upon EBV infection in vitro. Most studies about EBNA-2 have focused on its functions yet little is known for its intertypic polymorphisms. Results Coding region for amino acid (aa 148-487 of the EBNA-2 gene was sequenced in 25 EBV-associated gastric carcinomas (EBVaGCs, 56 nasopharyngeal carcinomas (NPCs and 32 throat washings (TWs from healthy donors in Northern China. Three variations (g48991t, c48998a, t49613a were detected in all of the samples (113/113, 100%. EBNA-2 could be classified into four distinct subtypes: E2-A, E2-B, E2-C and E2-D based on the deletion status of three aa (294Q, 357K and 358G. Subtypes E2-A and E2-C were detected in 56/113 (49.6%, 38/113 (33.6% samples, respectively. E2-A was observed more in EBVaGCs samples and subtype E2-D was only detected in the NPC samples. Variation analysis in EBNA-2 functional domains: the TAD residue (I438L and the NLS residues (E476G, P484H and I486T were only detected in NPC samples which located in the carboxyl terminus of EBNA-2 gene. Conclusions The subtypes E2-A and E2-C were the dominant genotypes of the EBNA-2 gene in Northern China. The subtype E2-D may be associated with the tumorigenesis of NPC. The NPC isolates were prone harbor to more mutations than the other two groups in the functional domains.

  16. The PNPLA3 rs738409 148M/M genotype is a risk factor for liver cancer in alcoholic cirrhosis but shows no or weak association in hepatitis C cirrhosis.

    Directory of Open Access Journals (Sweden)

    Hans Dieter Nischalke

    Full Text Available BACKGROUND: An isoleucine>methionine mutation at position 148 in the PNPLA3 gene (p.I148M, rs738409 has recently been identified as a susceptibility factor for liver damage in steatohepatitis. Here, we studied whether the PNPLA3 rs738409 polymorphism also affects predisposition to hepatocellular carcinoma (HCC. METHODS: We compared distributions of PNPLA3 genotypes in 80 and 81 Caucasian patients with alcoholic and hepatitis C virus (HCV-associated HCC to 80 and 81 age- and sex-matched patients with alcohol-related and HCV-related cirrhosis without HCC, respectively. PNPLA3 genotypes in 190 healthy individuals from the same population served as reference. Potential confounders obesity, diabetes, HCV genotype and HBV co-infection were controlled by univariate and multivariate logistic regression with forward variable selection. RESULTS: PNPLA3 genotypes were in Hardy-Weinberg equilibrium for all study groups. The frequency of the 148M allele was significantly (p<0.001 increased in alcoholic cirrhosis with (53.7% and without HCC (36.2% but was not different between healthy controls (22.9% and patients with cirrhosis (25.3%; p = 0.545 and HCC (30.2%; p = 0.071 due to hepatitis C. HCC risk was highest in 148M/M homozygous patients with alcoholic liver disease (odds ratio (OR 16.8 versus healthy controls; 95% confidence interval (CI 6.68-42.43, p<0.001. Finally, multivariate regression confirmed 148M/M homozygosity (OR 2.8; 95%-CI: 1.24-6.42; p = 0.013 as HCC risk factor in alcoholic cirrhosis. In HCV-related cirrhosis only HCV genotype 1 was confirmed as a HCC risk factor (OR 4.2; 95%-CI: 1.50-11.52; p = 0.006. CONCLUSION: The PNPLA3 148M variant is a prominent risk factor for HCC in patients with alcoholic cirrhosis, while its effects are negligible in patients with cirrhosis due to HCV. This polymorphism provides an useful tool to identify individuals with particularly high HCC risk in patients with alcoholic liver disease that

  17. Parameter measurement of target

    International Nuclear Information System (INIS)

    Gao Dangzhong

    2001-01-01

    The progress of parameter measurement of target (ICF-15) in 1999 are presented, including the design and contract of the microsphere equator profiler, the precise air bearing manufacturing, high-resolution X-ray image of multi-layer shells and the X-ray photos processed with special image and data software, some plastic shells measured in precision of 0.3 μm, the high-resolution observation and photograph system of 'dew-point method', special fixture of target and its temperature distribution measuring, the dew-point temperature and fuel gas pressure of shells measuring with internal pressure of 5 - 15 (x10 5 ) Pa D 2 and wall thickness of 1.5∼3 μm

  18. Guilty Feelings, Targeted Actions

    Science.gov (United States)

    Cryder, Cynthia E.; Springer, Stephen; Morewedge, Carey K.

    2014-01-01

    Early investigations of guilt cast it as an emotion that prompts broad reparative behaviors that help guilty individuals feel better about themselves or about their transgressions. The current investigation found support for a more recent representation of guilt as an emotion designed to identify and correct specific social offenses. Across five experiments, guilt influenced behavior in a targeted and strategic way. Guilt prompted participants to share resources more generously with others, but only did so when those others were persons whom the participant had wronged and only when those wronged individuals could notice the gesture. Rather than trigger broad reparative behaviors that remediate one’s general reputation or self-perception, guilt triggers targeted behaviors intended to remediate specific social transgressions. PMID:22337764

  19. Inertial confinement fusion target

    International Nuclear Information System (INIS)

    Bourdier, A.

    2001-12-01

    A simple, zero-dimensional model describing the temporal behaviour of an imploding-shell, magnetized fuel inertial confinement fusion target is formulated. The addition of a magnetic field to the fuel reduces thermal conduction losses. As a consequence, it might lead to high gains and reduce the driver requirements. This beneficial effect of the magnetic field on thermonuclear gains is confirmed qualitatively by the zero-dimensional model results. Still, the extent of the initial-condition space for which significant gains can occur is not, by far, as large as previously reported. One-dimensional CEA code simulations which confirm this results are also presented. Finally, we suggest to study the approach proposed by Hasegawa. In this scheme, the laser target is not imploded, and the life-time of the plasma can be very much increased. (author)

  20. Hohlraum targets for HIDIF

    International Nuclear Information System (INIS)

    Ramis, R.; Ramirez, J.; Meyer-ter-Vehn, J.

    2000-01-01

    An optimized high gain IFE indirect target design is presented. Beam parameters (5 MJ of 5 GeV Bi + ions in 10-20 ns and focal spot of 3 mm radius) are in agreement to the ones considered recently for the European Study Group on Heavy Ion Driven Inertial Fusion (HIDIF). The energy yield is close to 530 MJ, giving a large enough gain appropriate for industrial energy production. Numerical and analytical modeling are described and discussed. (authors)

  1. Target Glint Suppression Technology.

    Science.gov (United States)

    1980-09-01

    Rayleigh for either horizontal or vertical polarization). 2.1.2 Spatial Characterization. Before the effects of diversity on target detection can be...ncs) dRCS T If the lower intergration limit is taken as zero for the Rayleigh targct model of interest, then this quantity is unbounded. In...port wing, inner section Trailing edge of starboard .:ing, inner section Leading edge of horizontal stabilizer, inner section, port side TLeal, -g

  2. Conditional targeting for communication

    International Nuclear Information System (INIS)

    Rodrigues, Anselmo; Caldas, Ibere L.; Baptista, Murilo S.; Piqueira, Jose Roberto C.

    2004-01-01

    In this work we propose the use of a targeting method applied to chaotic systems in order to reach special trajectories that encode arbitrary sources of messages. One advantage of this procedure is to overcome dynamical constraints which impose limits in the amount of information that the chaotic trajectories can encode. Another advantage is the message decoding, practically instantaneous and independent of any special technique or algorithm. Furthermore, with this procedure, information can be transmitted with no errors due to bounded noise

  3. Heterogeneous chromatin target model

    International Nuclear Information System (INIS)

    Watanabe, Makoto

    1996-01-01

    The higher order structure of the entangled chromatin fibers in a chromosome plays a key role in molecular control mechanism involved in chromosome mutation due to ionizing radiations or chemical mutagens. The condensed superstructure of chromatin is not so rigid and regular as has been postulated in general. We have proposed a rheological explanation for the flexible network system ('chromatin network') that consists of the fluctuating assembly of nucleosome clusters linked with supertwisting DNA in a chromatin fiber ('Supertwisting Particulate Model'). We have proposed a 'Heterosensitive Target Model' for cellular radiosensitivity that is a modification of 'Heterogeneous Target Model'. The heterogeneity of chromatin target is derived from the highly condensed organization of chromatin segments consist of unstable and fragile sites in the fluctuating assembly of nucleosome clusters, namely 'supranucleosomal particles' or 'superbeads'. The models have been principally supported by our electron microscopic experiments employing 'surface - spreading whole - mount technique' since 1967. However, some deformation and artifacts in the chromatin structure are inevitable with these electron microscopic procedures. On the contrary, the 'atomic force microscope (AFM)' can be operated in liquid as well as in the air. A living specimen can be examined without any preparative procedures. Micromanipulation of the isolated chromosome is also possible by the precise positional control of a cantilever on the nanometer scale. The living human chromosomes were submerged in a solution of culture medium and observed by AFM using a liquid immersion cell. The surface - spreading whole - mount technique was applicable for this observation. The particulate chromatin segments of nucleosome clusters were clearly observed within mitotic human chromosomes in a living hydrated condition. These findings support the heterogeneity of chromatin target in a living cell. (J.P.N.)

  4. Implementing Target Value Design.

    Science.gov (United States)

    Alves, Thais da C L; Lichtig, Will; Rybkowski, Zofia K

    2017-04-01

    An alternative to the traditional way of designing projects is the process of target value design (TVD), which takes different departure points to start the design process. The TVD process starts with the client defining an allowable cost that needs to be met by the design and construction teams. An expected cost in the TVD process is defined through multiple interactions between multiple stakeholders who define wishes and others who define ways of achieving these wishes. Finally, a target cost is defined based on the expected profit the design and construction teams are expecting to make. TVD follows a series of continuous improvement efforts aimed at reaching the desired goals for the project and its associated target value cost. The process takes advantage of rapid cycles of suggestions, analyses, and implementation that starts with the definition of value for the client. In the traditional design process, the goal is to identify user preferences and find solutions that meet the needs of the client's expressed preferences. In the lean design process, the goal is to educate users about their values and advocate for a better facility over the long run; this way owners can help contractors and designers to identify better solutions. This article aims to inform the healthcare community about tools and techniques commonly used during the TVD process and how they can be used to educate and support project participants in developing better solutions to meet their needs now as well as in the future.

  5. The Bochum Polarized Target

    International Nuclear Information System (INIS)

    Reicherz, G.; Goertz, S.; Harmsen, J.; Heckmann, J.; Meier, A.; Meyer, W.; Radtke, E.

    2001-01-01

    The Bochum 'Polarized Target' group develops the target material 6 LiD for the COMPASS experiment at CERN. Several different materials like alcohols, alcanes and ammonia are under investigation. Solid State Targets are polarized in magnetic fields higher than B=2.5T and at temperatures below T=1K. For the Dynamic Nuclear Polarization process, paramagnetic centers are induced chemically or by irradiation with ionizing beams. The radical density is a critical factor for optimization of polarization and relaxation times at adequate magnetic fields and temperatures. In a high sensitive EPR--apparatus, an evaporator and a dilution cryostat with a continuous wave NMR--system, the materials are investigated and optimized. To improve the polarization measurement, the Liverpool NMR-box is modified by exchanging the fixed capacitor for a varicap diode which not only makes the tuning very easy but also provides a continuously tuned circuit. The dependence of the signal area upon the circuit current is measured and it is shown that it follows a linear function

  6. A randomized, controlled, double-blind crossover study on the effects of 2-L infusions of 0.9% saline and plasma-lyte® 148 on renal blood flow velocity and renal cortical tissue perfusion in healthy volunteers.

    Science.gov (United States)

    Chowdhury, Abeed H; Cox, Eleanor F; Francis, Susan T; Lobo, Dileep N

    2012-07-01

    We compared the effects of intravenous infusions of 0.9% saline ([Cl] 154 mmol/L) and Plasma-Lyte 148 ([Cl] 98 mmol/L, Baxter Healthcare) on renal blood flow velocity and perfusion in humans using magnetic resonance imaging (MRI). Animal experiments suggest that hyperchloremia resulting from 0.9% saline infusion may affect renal hemodynamics adversely, a phenomenon not studied in humans. Twelve healthy adult male subjects received 2-L intravenous infusions over 1 hour of 0.9% saline or Plasma-Lyte 148 in a randomized, double-blind manner. Crossover studies were performed 7 to 10 days apart. MRI scanning proceeded for 90 minutes after commencement of infusion to measure renal artery blood flow velocity and renal cortical perfusion. Blood was sampled and weight recorded hourly for 4 hours. Sustained hyperchloremia was seen with saline but not with Plasma-Lyte 148 (P Blood volume changes were identical (P = 0.867), but there was greater expansion of the extravascular fluid volume after saline (P = 0.029). There was a significant reduction in mean renal artery flow velocity (P = 0.045) and renal cortical tissue perfusion (P = 0.008) from baseline after saline, but not after Plasma-Lyte 148. There was no difference in concentrations of urinary neutrophil gelatinase-associated lipocalin after the 2 infusions (P = 0.917). This is the first human study to demonstrate that intravenous infusion of 0.9% saline results in reductions in renal blood flow velocity and renal cortical tissue perfusion. This has implications for intravenous fluid therapy in perioperative and critically ill patients. NCT01087853.

  7. Low-temperature, high yield synthesis, and convenient isolation of the high-electron-density cluster compound Ta6Br14.8H2O for use in biomacromolecular crystallographic phase determination.

    Science.gov (United States)

    Hay, Daniel N T; Messerle, Louis

    2002-09-01

    Reduction of TaBr(5) with Ga in the presence of KBr in a sealed borosilicate ampule at 400 degrees, followed by aqueous Soxhlet extraction and addition of stannous bromide and hydrobromic acid to the extract, yielded Ta(6)Br(14).8H(2)O in 80-84% yield. The new procedure provides a convenient, low temperature, high yield route to the synthesis of the title compound from inexpensive precursors.

  8. Beta blockers and chronic heart failure patients: prognostic impact of a dose targeted beta blocker therapy vs. heart rate targeted strategy.

    Science.gov (United States)

    Corletto, Anna; Fröhlich, Hanna; Täger, Tobias; Hochadel, Matthias; Zahn, Ralf; Kilkowski, Caroline; Winkler, Ralph; Senges, Jochen; Katus, Hugo A; Frankenstein, Lutz

    2018-05-17

    Beta blockers improve survival in patients with chronic systolic heart failure (CHF). Whether physicians should aim for target dose, target heart rate (HR), or both is still under debate. We identified 1,669 patients with systolic CHF due to ischemic heart disease or idiopathic dilated cardiomyopathy from the University Hospital Heidelberg and the Clinic of Ludwigshafen, Germany. All patients were treated with an angiotensin converting enzyme inhibitor or angiotensin receptor blocker and had a history of CHF known for at least 6 months. Target dose was defined as treatment with ≥ 95% of the respective published guideline-recommended dose. Target HR was defined as 51-69 bpm. All-cause mortality during the median follow-up of 42.8 months was analysed with respect to beta blocker dosing and resting HR. 201 (12%) patients met the dose target (group A), 285 (17.1%) met the HR target (group B), 627 (37.6%) met no target (group C), and 556 (33.3%) did not receive beta blockers (Group D). 5-year mortality was 23.7, 22.7, 37.6, and 55.6% for group A, B, C, and D, respectively (p <  0.001). Survival for group A patients with a HR ≥ 70 bpm was 28.8% but 14.8% if HR was 50-70 bpm (p = 0.054). Achieving guidelines recommended beta blocker dose or to HR control has a similar positive impact on survival. When on target dose, supplemental HR control additionally improves survival.

  9. Inflation targeting and core inflation

    OpenAIRE

    Julie Smith

    2005-01-01

    This paper examines the interaction of core inflation and inflation targeting as a monetary policy regime. Interest in core inflation has grown because of inflation targeting. Core inflation is defined in numerous ways giving rise to many potential measures; this paper defines core inflation as the best forecaster of inflation. A cross-country study finds before the start of inflation targeting, but not after, core inflation differs between non-inflation targeters and inflation targeters. Thr...

  10. Behavior of Goss, {411}<148>, and {111}<112> Oriented Grains During Recrystallization and Decarburization After Cold-rolling of Fe-3.1% GrainOriented Electrical Steel

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Sung-Ji; Park, No-Jin [Kumoh National Institute of Technology, Gumi (Korea, Republic of); Joo, Hyung-Don; Park, Jong-Tae [POSCO, Pohang (Korea, Republic of)

    2016-07-15

    Grain-oriented electrical steel is used as a core material in transformers and motors. To obtain improved magnetic properties from the grain-oriented electrical steel, the steel should have a strong {110}<001> Goss texture. Recently, controlled manufacturing processes have been employed for developing electrical steels with a strong Goss texture. It is important to carry out research on the {411}<148> and {111}<112> oriented grains in relation to coincidence site lattice (CSL) boundaries, as they have an effect on the easy growth of the Goss grains upon secondary recrystallization. In this study, the behavior of the{411}<148> and {111}<112> oriented grains, which are neighbored with Goss grains after recrystallization with rapid and typical heating rates, and after decarburization, was examined by using x-ray diffraction (XRD) and electron back-scattered diffraction (EBSD) measurements. In the decarburized specimen, the Goss grains encroached the {411}<148> and {111}<112> oriented grains to a greater extent with a rapid heating rate than with a typical heating rate, and larger Goss grains were observed with the rapid heating rate. The {111}<112> oriented grains especially affect the easy growth of the Goss grains, as they are located near the Goss grains. Therefore, larger Goss grains can be produced at rapid heating rates, and the product is estimated to exhibit improved magnetic properties after secondary recrystallization.

  11. Evaluation of high-resolution GRAMM-GRAL (v15.12/v14.8) NOx simulations over the city of Zürich, Switzerland

    Science.gov (United States)

    Berchet, Antoine; Zink, Katrin; Oettl, Dietmar; Brunner, Jürg; Emmenegger, Lukas; Brunner, Dominik

    2017-09-01

    Hourly NOx concentrations were simulated for the city of Zürich, Switzerland, at 10 m resolution for the years 2013-2014. The simulations were generated with the nested mesoscale meteorology and micro-scale dispersion model system GRAMM-GRAL (versions v15.12 and v14.8) by applying a catalogue-based approach. This approach was specifically designed to enable long-term city-wide building-resolving simulations with affordable computation costs. It relies on a discrete set of possible weather situations and corresponding steady-state flow and dispersion patterns that are pre-computed and then matched hourly with actual meteorological observations. The modelling system was comprehensively evaluated using eight sites continuously monitoring NOx concentrations and 65 passive samplers measuring NO2 concentrations on a 2-weekly basis all over the city. The system was demonstrated to fulfil the European Commission standards for air pollution modelling at nearly all sites. The average spatial distribution was very well represented, despite a general tendency to overestimate the observed concentrations, possibly due to a crude representation of traffic-induced turbulence and to underestimated dispersion in the vicinity of buildings. The temporal variability of concentrations explained by varying emissions and weather situations was accurately reproduced on different timescales. The seasonal cycle of concentrations, mostly driven by stronger vertical dispersion in summer than in winter, was very well captured in the 2-year simulation period. Short-term events, such as episodes of particularly high and low concentrations, were detected in most cases by the system, although some unrealistic pollution peaks were occasionally generated, pointing at some limitations of the steady-state approximation. The different patterns of the diurnal cycle of concentrations observed in the city were generally well captured as well. The evaluation confirmed the adequacy of the catalogue

  12. Evaluation of high-resolution GRAMM–GRAL (v15.12/v14.8 NOx simulations over the city of Zürich, Switzerland

    Directory of Open Access Journals (Sweden)

    A. Berchet

    2017-09-01

    Full Text Available Hourly NOx concentrations were simulated for the city of Zürich, Switzerland, at 10 m resolution for the years 2013–2014. The simulations were generated with the nested mesoscale meteorology and micro-scale dispersion model system GRAMM–GRAL (versions v15.12 and v14.8 by applying a catalogue-based approach. This approach was specifically designed to enable long-term city-wide building-resolving simulations with affordable computation costs. It relies on a discrete set of possible weather situations and corresponding steady-state flow and dispersion patterns that are pre-computed and then matched hourly with actual meteorological observations. The modelling system was comprehensively evaluated using eight sites continuously monitoring NOx concentrations and 65 passive samplers measuring NO2 concentrations on a 2-weekly basis all over the city. The system was demonstrated to fulfil the European Commission standards for air pollution modelling at nearly all sites. The average spatial distribution was very well represented, despite a general tendency to overestimate the observed concentrations, possibly due to a crude representation of traffic-induced turbulence and to underestimated dispersion in the vicinity of buildings. The temporal variability of concentrations explained by varying emissions and weather situations was accurately reproduced on different timescales. The seasonal cycle of concentrations, mostly driven by stronger vertical dispersion in summer than in winter, was very well captured in the 2-year simulation period. Short-term events, such as episodes of particularly high and low concentrations, were detected in most cases by the system, although some unrealistic pollution peaks were occasionally generated, pointing at some limitations of the steady-state approximation. The different patterns of the diurnal cycle of concentrations observed in the city were generally well captured as well. The evaluation confirmed the

  13. Targeted therapy for sarcomas

    Directory of Open Access Journals (Sweden)

    Forscher C

    2014-03-01

    Full Text Available Charles Forscher,1 Monica Mita,2 Robert Figlin3 1Sarcoma Program, Samuel Oschin Comprehensive Cancer Institute, Cedars-Sinai Medical Center, Los Angeles, CA, USA; 2Experimental Therapeutics Program, Samuel Oschin Comprehensive Cancer Institute, Cedars-Sinai Medical Center, Los Angeles, CA, USA; 3Academic Development Program, Samuel Oschin Comprehensive Cancer Institute, and Division of Hematology/Oncology, Cedars-Sinai Medical Center, Los Angeles, CA, USA Abstract: Sarcomas are tumors of mesenchymal origin that make up approximately 1% of human cancers. They may arise as primary tumors in either bone or soft tissue, with approximately 11,280 soft tissue tumors and 2,650 bone tumors diagnosed each year in the United States. There are at least 50 different subtypes of soft tissue sarcoma, with new ones described with ever-increasing frequency. One way to look at sarcomas is to divide them into categories on the basis of their genetic make-up. One group of sarcomas has an identifiable, relatively simple genetic signature, such as the X:18 translocation seen in synovial sarcoma or the 11:22 translocation seen in Ewing's sarcoma. These specific abnormalities often lead to the presence of fusion proteins, such as EWS-FLI1 in Ewing's sarcoma, which are helpful as diagnostic tools and may become therapeutic targets in the future. Another group of sarcomas is characterized by complex genetic abnormalities as seen in leiomyosarcoma, osteosarcoma, and undifferentiated sarcoma. It is important to keep these distinctions in mind when contemplating the development of targeted agents for sarcomas. Different abnormalities in sarcoma could be divided by tumor subtype or by the molecular or pathway abnormality. However, some existing drugs or drugs in development may interfere with or alter more than one of the presented pathways. Keywords: sarcoma, targeted agents, tyrosine kinase inhibitors, mTor inhibition

  14. Targeted mass spectrometry

    DEFF Research Database (Denmark)

    Osinalde, Nerea; Aloria, Kerman; Omaetxebarria, Miren J.

    2017-01-01

    Following the rapid expansion of the proteomics field, the investigation of post translational modifications (PTM) has become extremely popular changing our perspective of how proteins constantly fine tune cellular functions. Reversible protein phosphorylation plays a pivotal role in virtually all...... for becoming the method of choice to study with high precision and sensitivity already known site-specific phosphorylation events. This review summarizes the contribution of large-scale unbiased MS analyses and highlights the need of targeted MS-based approaches for follow-up investigation. Additionally...

  15. Fixed target beams

    CERN Document Server

    Kain, V; Cettour-Cave, S; Cornelis, K; Fraser, M A; Gatignon, L; Goddard, B; Velotti, F

    2017-01-01

    The CERN SPS (Super Proton Synchrotron) serves asLHC injector and provides beam for the North Area fixedtarget experiments. At low energy, the vertical acceptancebecomes critical with high intensity large emittance fixed tar-get beams. Optimizing the vertical available aperture is a keyingredient to optimize transmission and reduce activationaround the ring. During the 2016 run a tool was developed toprovide an automated local aperture scan around the entirering.The flux of particles slow extracted with the1/3inte-ger resonance from the Super Proton Synchrotron at CERNshould ideally be constant over the length of the extractionplateau, for optimum use of the beam by the fixed target ex-periments in the North Area. The extracted intensity is con-trolled in feed-forward correction of the horizontal tune viathe main SPS quadrupoles. The Mains power supply noiseat 50 Hz and harmonics is also corrected in feed-forwardby small amplitude tune modulation at the respective fre-quencies with a dedicated additional quad...

  16. Microdeletion and microduplication analysis of chinese conotruncal defects patients with targeted array comparative genomic hybridization.

    Directory of Open Access Journals (Sweden)

    Xiaohui Gong

    Full Text Available OBJECTIVE: The current study aimed to develop a reliable targeted array comparative genomic hybridization (aCGH to detect microdeletions and microduplications in congenital conotruncal defects (CTDs, especially on 22q11.2 region, and for some other chromosomal aberrations, such as 5p15-5p, 7q11.23 and 4p16.3. METHODS: Twenty-seven patients with CTDs, including 12 pulmonary atresia (PA, 10 double-outlet right ventricle (DORV, 3 transposition of great arteries (TGA, 1 tetralogy of Fallot (TOF and one ventricular septal defect (VSD, were enrolled in this study and screened for pathogenic copy number variations (CNVs, using Agilent 8 x 15K targeted aCGH. Real-time quantitative polymerase chain reaction (qPCR was performed to test the molecular results of targeted aCGH. RESULTS: Four of 27 patients (14.8% had 22q11.2 CNVs, 1 microdeletion and 3 microduplications. qPCR test confirmed the microdeletion and microduplication detected by the targeted aCGH. CONCLUSION: Chromosomal abnormalities were a well-known cause of multiple congenital anomalies (MCA. This aCGH using arrays with high-density coverage in the targeted regions can detect genomic imbalances including 22q11.2 and other 10 kinds CNVs effectively and quickly. This approach has the potential to be applied to detect aneuploidy and common microdeletion/microduplication syndromes on a single microarray.

  17. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  18. Aquaporin-2 membrane targeting

    DEFF Research Database (Denmark)

    Olesen, Emma T B; Fenton, Robert A

    2017-01-01

    The targeting of the water channel aquaporin-2 (AQP2) to the apical plasma membrane of kidney collecting duct principal cells is regulated mainly by the antidiuretic peptide hormone arginine vasopressin (AVP). This process is of crucial importance for the maintenance of body water homeostasis...... of aquaporin-2 (AQP2) to the apical plasma membrane of collecting duct (CD) principal cells (10, 20). This process is mainly regulated by the actions of AVP on the type 2 AVP receptor (V2R), although the V1a receptor may also play a minor role (26). The V2R is classified within the group of 7-transmembrane....... For example, 1) stimulation with the nonspecific AC activator forskolin increases AQP2 membrane accumulation in a mouse cortical collecting duct cell line [e.g., Norregaard et al. (16)]; 2) cAMP increases CD water permeability (15); 3) the cAMP-activated protein kinase A (PKA) can phosphorylate AQP2 on its...

  19. ORION laser target diagnostics

    International Nuclear Information System (INIS)

    Bentley, C. D.; Edwards, R. D.; Andrew, J. E.; James, S. F.; Gardner, M. D.; Comley, A. J.; Vaughan, K.; Horsfield, C. J.; Rubery, M. S.; Rothman, S. D.; Daykin, S.; Masoero, S. J.; Palmer, J. B.; Meadowcroft, A. L.; Williams, B. M.; Gumbrell, E. T.; Fyrth, J. D.; Brown, C. R. D.; Hill, M. P.; Oades, K.

    2012-01-01

    The ORION laser facility is one of the UK's premier laser facilities which became operational at AWE in 2010. Its primary mission is one of stockpile stewardship, ORION will extend the UK's experimental plasma physics capability to the high temperature, high density regime relevant to Atomic Weapons Establishment's (AWE) program. The ORION laser combines ten laser beams operating in the ns regime with two sub ps short pulse chirped pulse amplification beams. This gives the UK a unique combined long pulse/short pulse laser capability which is not only available to AWE personnel but also gives access to our international partners and visiting UK academia. The ORION laser facility is equipped with a comprehensive suite of some 45 diagnostics covering optical, particle, and x-ray diagnostics all able to image the laser target interaction point. This paper focuses on a small selection of these diagnostics.

  20. ORION laser target diagnostics.

    Science.gov (United States)

    Bentley, C D; Edwards, R D; Andrew, J E; James, S F; Gardner, M D; Comley, A J; Vaughan, K; Horsfield, C J; Rubery, M S; Rothman, S D; Daykin, S; Masoero, S J; Palmer, J B; Meadowcroft, A L; Williams, B M; Gumbrell, E T; Fyrth, J D; Brown, C R D; Hill, M P; Oades, K; Wright, M J; Hood, B A; Kemshall, P

    2012-10-01

    The ORION laser facility is one of the UK's premier laser facilities which became operational at AWE in 2010. Its primary mission is one of stockpile stewardship, ORION will extend the UK's experimental plasma physics capability to the high temperature, high density regime relevant to Atomic Weapons Establishment's (AWE) program. The ORION laser combines ten laser beams operating in the ns regime with two sub ps short pulse chirped pulse amplification beams. This gives the UK a unique combined long pulse/short pulse laser capability which is not only available to AWE personnel but also gives access to our international partners and visiting UK academia. The ORION laser facility is equipped with a comprehensive suite of some 45 diagnostics covering optical, particle, and x-ray diagnostics all able to image the laser target interaction point. This paper focuses on a small selection of these diagnostics.

  1. Optimal exploration target zones

    CSIR Research Space (South Africa)

    Debba, Pravesh

    2008-09-01

    Full Text Available prospective map are the weights-of-evidence (WofE) method logistic regression canonical favorability analysis neural networks evidential belief functions Optimal Exploration Target Zones Debba, Carranza, Stein, van der Meer Introduction to Remote.... . . ): FITNESS FUNCTION φWMSD+V(Sn) = λ N(A) ∑ −→x ∈A P(−→x ) ∣ ∣ ∣ ∣−→x −QSn( −→x ) ∣ ∣ ∣ ∣ +(1− λ)s2(OSn) , (2) where QSn( −→x ) is the location vector of an optimal exploration focal point in Sn nearest to −→x , and s2(OSn) is the variance...

  2. Bradycardia During Targeted Temperature Management

    DEFF Research Database (Denmark)

    Thomsen, Jakob Hartvig; Nielsen, Niklas; Hassager, Christian

    2016-01-01

    OBJECTIVES: Bradycardia is common during targeted temperature management, likely being a physiologic response to lower body temperature, and has recently been associated with favorable outcome following out-of-hospital cardiac arrest in smaller observational studies. The present study sought...... to confirm this finding in a large multicenter cohort of patients treated with targeted temperature management at 33°C and explore the response to targeted temperature management targeting 36°C. DESIGN: Post hoc analysis of a prospective randomized study. SETTING: Thirty-six ICUs in 10 countries. PATIENTS......: We studied 447 (targeted temperature management = 33°C) and 430 (targeted temperature management = 36°C) comatose out-of-hospital cardiac arrest patients with available heart rate data, randomly assigned in the targeted temperature management trial from 2010 to 2013. INTERVENTIONS: Targeted...

  3. Designing block copolymer architectures for targeted membrane performance

    KAUST Repository

    Dorin, Rachel Mika

    2014-01-01

    Using a combination of block copolymer self-assembly and non-solvent induced phase separation, isoporous ultrafiltration membranes were fabricated from four poly(isoprene-b-styrene-b-4-vinylpyridine) triblock terpolymers with similar block volume fractions but varying in total molar mass from 43 kg/mol to 115 kg/mol to systematically study the effect of polymer size on membrane structure. Small-angle X-ray scattering was used to probe terpolymer solution structure in the dope. All four triblocks displayed solution scattering patterns consistent with a body-centered cubic morphology. After membrane formation, structures were characterized using a combination of scanning electron microscopy and filtration performance tests. Membrane pore densities that ranged from 4.53 × 1014 to 1.48 × 1015 pores/m 2 were observed, which are the highest pore densities yet reported for membranes using self-assembly and non-solvent induced phase separation. Hydraulic permeabilities ranging from 24 to 850 L m-2 h-1 bar-1 and pore diameters ranging from 7 to 36 nm were determined from permeation and rejection experiments. Both the hydraulic permeability and pore size increased with increasing molar mass of the parent terpolymer. The combination of polymer characterization and membrane transport tests described here demonstrates the ability to rationally design macromolecular structures to target specific performance characteristics in block copolymer derived ultrafiltration membranes. © 2013 Elsevier Ltd. All rights reserved.

  4. Solid Polarized Targets and Applications

    International Nuclear Information System (INIS)

    Crabb, D. G.

    2008-01-01

    Examples are given of dynamically polarized targets in use today and how the subsystems have changed to meet the needs of todays experiments. Particular emphasis is placed on target materials such as ammonia and lithium deuteride. Recent polarization studies of irradiated materials such as butanol, deuterated butanol, polyethylene, and deuterated polyethylene are presented. The operation of two non-DNP target systems as well as applications of traditional DNP targets are briefly discussed

  5. Techniques for preparing isotopic targets

    International Nuclear Information System (INIS)

    Xu Guoji; Guan Shouren; Luo Xinghua; Sun Shuhua

    1987-12-01

    The techniques of making isotopic targets for nuclear physics experiments are introduced. Vacuum evaporation, electroplating, centrifugal precipitation, rolling and focused heavy-ion beam sputtering used to prepare various isotopic targets at IAE are described. Reduction-distillation with active metals and electrolytic reduction for converting isotope oxides to metals are mentioned. The stripping processes of producing self-supporting isotopic targets are summarized. The store methods of metallic targets are given

  6. Nova target diagnostics control system

    International Nuclear Information System (INIS)

    Severyn, J.R.

    1985-01-01

    During the past year the Nova target diagnostics control system was finished and put in service. The diagnostics loft constructed to the north of the target room provides the environmental conditions required to collect reliable target diagnostic data. These improvements include equipment cooling and isolation of the power source with strict control of instrumentation grounds to eliminate data corruption due to electromagnetic pulses from the laser power-conditioning system or from target implosion effects

  7. Stanford polarized atomic beam target

    International Nuclear Information System (INIS)

    Mavis, D.G.; Dunham, J.S.; Hugg, J.W.; Glavish, H.F.

    1976-01-01

    A polarized atomic beam source was used to produce an atomic hydrogen beam which was in turn used as a polarized proton target. A target density of 2 x 10'' atoms/cm 3 and a target polarization of 0.37 without the use of rf transitions were measured. These measurements indicate that a number of experiments are currently feasible with a variety of polarized target beams

  8. Targets for heavy ion fusion

    International Nuclear Information System (INIS)

    Clauser, M.J.

    1978-01-01

    This paper describes some of the basic principles of fusion target implosions, using some simple targets designed for irradiation by ion beams. Present estimates are that ion beams with 1-5 MJ, and 100-500 TW will be required to ignite high gain targets. (orig.) [de

  9. Beam heating of target foils

    International Nuclear Information System (INIS)

    Corwin, W.C.

    1975-01-01

    A target rotator, built to reduce the effects of beam spot heating, is fully adjustable, holds three targets, is chamber independent, and takes up limited space. The expected temperature rise in the target is calculated from the Stefan--Boltzmann law

  10. Hypoxia targeting copper complexes

    International Nuclear Information System (INIS)

    Dearling, J.L.

    1998-11-01

    The importance and incidence of tumour hypoxia, its measurement and current treatments available, including pharmacological and radiopharmacological methods of targeting hypoxia, are discussed. A variety of in vitro and in vivo methods for imposing hypoxia have been developed and are reviewed. Copper, its chemistry, biochemistry and radiochemistry, the potential for use of copper radionuclides and its use to date in this field is considered with particular reference to the thiosemicarbazones. Their biological activity, metal chelation, in vitro and in vivo studies of their radiocopper complexes and the potential for their use as hypoxia targeting radiopharmaceuticals is described. The reduction of the copper(II) complex to copper(l), its pivotal importance in their biological behaviour, and the potential for manipulation of this to effect hypoxia selectivity are described. An in vitro method for assessing the hypoxia selectivity of radiopharmaceuticals is reported. The rapid deoxygenation and high viability of a mammalian cell culture in this system is discussed and factors which may affect the cellular uptake of a radiopharmaceutical are described. The design, synthesis and complexation with copper and radiocopper of a range of bis(thiosemicarbazones) is reported. Synthesis of these compounds is simple giving high yields of pure products. The characteristics of the radiocopper complexes ( 64 Cu) including lipophilicity and redox activity are reported (reduction potentials in the range -0.314 - -0.590 V). High cellular uptakes of the radiocopper complexes of the ligands, in hypoxic and normoxic EMT6 and CHO320 cells, were observed. Extremes of selectivity are shown ranging from the hypoxia selective 64 Cu(II)ATSM to normoxic cell selective 64 Cu(II)GTS. The selectivities observed are compared with the physico chemical characteristics of the complexes. A good correlation exists between selectivity of the complex and its Cu(II)/Cu(I) reduction potential, with hypoxia

  11. Liquid hydrogen and deuterium targets

    International Nuclear Information System (INIS)

    Bougon, M.; Marquet, M.; Prugne, P.

    1961-01-01

    A description is given of 1) Atmospheric pressure target: liquid hydrogen, 400 mm thickness; thermal insulation: styrofoam; the hydrogen vapors are used to improve the target cooling; Mylar windows. 2) Vacuum target: 12 liter content: hydrogen or deuterium; liquid thickness 400 mm; thermal insulation is afforded by a vacuum vessel and a liquid nitrogen shield. Recovery and liquefaction of deuterium vapors are managed in the vacuum vessel which holds the target. The target emptying system is designed for operating in a few minutes. (author) [fr

  12. Isomeric Targets and Beams

    International Nuclear Information System (INIS)

    Oganesyan, Yu.Ts.; Karamyan, S.A.

    1994-01-01

    One of the main topics of modern nuclear physics is the investigation of exotic nuclei including hyper-nuclei, trans fermium elements, proton and neutron rich isotopes near drip lines as well as high-spin excited states and states with anomalous deformation. The isomerism of nuclei is closely related with such phenomena as the alignment of single-particle orbitals, the coexistence of various deformations and the manifestation of intruder-levels from neighbouring shells. The investigation of electromagnetic and nuclear interactions of isomers could give important information on their shell structure and its role in the mechanism of nuclear reactions. For such experiments one can either make isomeric targets (sufficiently long-lived) or use the methods of acceleration of isomeric nuclei. Recently, an exotic 16 + four-quasiparticle isomer of 178 Hf m 2 was produced in a micro weight quantity and the first nuclear reactions on it were successfully observed. The talk describes these experiments as well as new ideas for the continuation of the studies and some advantageous ways for the isomeric beams production by the method of direct acceleration or by the secondary beam method. 35 refs., 15 figs., 8 tabs

  13. EURISOL High Power Targets

    CERN Document Server

    Kadi, Y; Lindroos, M; Ridikas, D; Stora, T; Tecchio, L; CERN. Geneva. BE Department

    2009-01-01

    Modern Nuclear Physics requires access to higher yields of rare isotopes, that relies on further development of the In-flight and Isotope Separation On-Line (ISOL) production methods. The limits of the In-Flight method will be applied via the next generation facilities FAIR in Germany, RIKEN in Japan and RIBF in the USA. The ISOL method will be explored at facilities including ISAC-TRIUMF in Canada, SPIRAL-2 in France, SPES in Italy, ISOLDE at CERN and eventually at the very ambitious multi-MW EURISOL facility. ISOL and in-flight facilities are complementary entities. While in-flight facilities excel in the production of very short lived radioisotopes independently of their chemical nature, ISOL facilities provide high Radioisotope Beam (RIB) intensities and excellent beam quality for 70 elements. Both production schemes are opening vast and rich fields of nuclear physics research. In this article we will introduce the targets planned for the EURISOL facility and highlight some of the technical and safety cha...

  14. Molecularly targeted therapeutic radiopharmaceuticals

    International Nuclear Information System (INIS)

    Saw, M.M.

    2007-01-01

    Full text: It is generally agreed that current focus of nuclear medicine development should be on molecular imaging and therapy. Though, the widespread use of the terminology 'molecular imaging' is quite recent, nuclear medicine has used molecular imaging techniques for more than 20 years ago. A variety of radiopharmaceuticals have been introduced for the internal therapy of malignant and inflammatory lesions in nuclear medicine. In the field of bio/medical imaging, nuclear medicine is one of the disciplines which has the privilege of organized and well developed chemistry/ pharmacy section; radio-chemistry/radiopharmacy. Fundamental principles have been developed more than 40 years ago and advanced research is going well into postgenomic era. The genomic revolution and dramatically increased insight in the molecular mechanisms underlying pathology have led to paradigm shift in drug development. Likewise does in the nuclear medicine. Here, the author will present current clinical and pre-clinical therapeutic radiopharmaceuticals based on molecular targets such as membrane-bound receptors, enzymes, nucleic acids, sodium iodide symporter, etc, in correlation with fundamentals of radiopharmacy. (author)

  15. New type of metal targets

    International Nuclear Information System (INIS)

    Bukharov, A.V.; Ankudinov, V.B.; Ogorodnikov, V.P.; Marukhin, Y.A.

    2014-01-01

    Now the technologies based on interaction of high-intensity beams with substance of a target are being intensively developed. As a target it is possible to use the new type of monodisperse metal targets. The principal advantages of new targets type are: target cooling isn't required; there is no induced activity: the target can be used many times; small dispersion on the speed, the size and interaction points with a beam. The basis of a target is the jet of molten metal, following in the vacuum chamber .Under the influence of the special disturbance superimposed on the liquid jet, the jet disintegrated into identical drops. In the vacuum chamber the drops freeze and form into the solid granules. It is possible to receive monodisperse targets from different metals, alloys and salts (diameter of targets is from 30 .m to 1.5 mm). Dispersion by the sizes and speed is less than 1%. The technique allows to receive not only continuous targets, but also hollow targets with dispersion on thickness of wall within 1...2%.

  16. Using the Nova target chamber for high-yield targets

    International Nuclear Information System (INIS)

    Pitts, J.H.

    1987-01-01

    The existing 2.2-m-radius Nova aluminum target chamber, coated and lined with boron-seeded carbon shields, is proposed for use with 1000-MJ-yield targets in the next laser facility. The laser beam and diagnostic holes in the target chamber are left open and the desired 10 -2 Torr vacuum is maintained both inside and outside the target chamber; a larger target chamber room is the vacuum barrier to the atmosphere. The hole area available is three times that necessary to maintain a maximum fluence below 12 J/cm 2 on optics placed at a radius of 10 m. Maximum stress in the target chamber wall is 73 MPa, which complies with the intent of the ASME Pressure Vessel Code. However, shock waves passing through the inner carbon shield could cause it to comminute. We propose tests and analyses to ensure that the inner carbon shield survives the environment. 13 refs

  17. The target effect: visual memory for unnamed search targets.

    Science.gov (United States)

    Thomas, Mark D; Williams, Carrick C

    2014-01-01

    Search targets are typically remembered much better than other objects even when they are viewed for less time. However, targets have two advantages that other objects in search displays do not have: They are identified categorically before the search, and finding them represents the goal of the search task. The current research investigated the contributions of both of these types of information to the long-term visual memory representations of search targets. Participants completed either a predefined search or a unique-object search in which targets were not defined with specific categorical labels before searching. Subsequent memory results indicated that search target memory was better than distractor memory even following ambiguously defined searches and when the distractors were viewed significantly longer. Superior target memory appears to result from a qualitatively different representation from those of distractor objects, indicating that decision processes influence visual memory.

  18. Immunotherapy Targets in Pediatric Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Orentas, Rimas J.; Lee, Daniel W.; Mackall, Crystal, E-mail: rimas.orentas@nih.gov, E-mail: mackallc@mail.nih.gov [Pediatric Oncology Branch, National Cancer Institute, National Institutes of Health, Bethesda, MD (United States)

    2012-01-30

    Immunotherapy for cancer has shown increasing success and there is ample evidence to expect that progress gleaned in immune targeting of adult cancers can be translated to pediatric oncology. This manuscript reviews principles that guide selection of targets for immunotherapy of cancer, emphasizing the similarities and distinctions between oncogene-inhibition targets and immune targets. It follows with a detailed review of molecules expressed by pediatric tumors that are already under study as immune targets or are good candidates for future studies of immune targeting. Distinctions are made between cell surface antigens that can be targeted in an MHC independent manner using antibodies, antibody derivatives, or chimeric antigen receptors versus intracellular antigens which must be targeted with MHC restricted T cell therapies. Among the most advanced immune targets for childhood cancer are CD19 and CD22 on hematologic malignancies, GD2 on solid tumors, and NY-ESO-1 expressed by a majority of synovial sarcomas, but several other molecules reviewed here also have properties which suggest that they too could serve as effective targets for immunotherapy of childhood cancer.

  19. Immunotherapy Targets in Pediatric Cancer

    International Nuclear Information System (INIS)

    Orentas, Rimas J.; Lee, Daniel W.; Mackall, Crystal

    2012-01-01

    Immunotherapy for cancer has shown increasing success and there is ample evidence to expect that progress gleaned in immune targeting of adult cancers can be translated to pediatric oncology. This manuscript reviews principles that guide selection of targets for immunotherapy of cancer, emphasizing the similarities and distinctions between oncogene-inhibition targets and immune targets. It follows with a detailed review of molecules expressed by pediatric tumors that are already under study as immune targets or are good candidates for future studies of immune targeting. Distinctions are made between cell surface antigens that can be targeted in an MHC independent manner using antibodies, antibody derivatives, or chimeric antigen receptors versus intracellular antigens which must be targeted with MHC restricted T cell therapies. Among the most advanced immune targets for childhood cancer are CD19 and CD22 on hematologic malignancies, GD2 on solid tumors, and NY-ESO-1 expressed by a majority of synovial sarcomas, but several other molecules reviewed here also have properties which suggest that they too could serve as effective targets for immunotherapy of childhood cancer.

  20. [Target volume margins for lung cancer: internal target volume/clinical target volume].

    Science.gov (United States)

    Jouin, A; Pourel, N

    2013-10-01

    The aim of this study was to carry out a review of margins that should be used for the delineation of target volumes in lung cancer, with a focus on margins from gross tumour volume (GTV) to clinical target volume (CTV) and internal target volume (ITV) delineation. Our review was based on a PubMed literature search with, as a cornerstone, the 2010 European Organisation for Research and Treatment of Cancer (EORTC) recommandations by De Ruysscher et al. The keywords used for the search were: radiotherapy, lung cancer, clinical target volume, internal target volume. The relevant information was categorized under the following headings: gross tumour volume definition (GTV), CTV-GTV margin (first tumoural CTV then nodal CTV definition), in field versus elective nodal irradiation, metabolic imaging role through the input of the PET scanner for tumour target volume and limitations of PET-CT imaging for nodal target volume definition, postoperative radiotherapy target volume definition, delineation of target volumes after induction chemotherapy; then the internal target volume is specified as well as tumoural mobility for lung cancer and respiratory gating techniques. Finally, a chapter is dedicated to planning target volume definition and another to small cell lung cancer. For each heading, the most relevant and recent clinical trials and publications are mentioned. Copyright © 2013. Published by Elsevier SAS.