WorldWideScience

Sample records for samarium 134

  1. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  2. Particle-Size-Induced Valence Changes in Samarium Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Mason, M. G.; Lee, S. -T.; Apai, G.; Davis, R. F.; Shirley, D. A.; Franciosi, A.; Weaver, J. H.

    1981-09-01

    Samarium clusters exhibit mixed-valence behavior which is sensitive to particle size. XPS and UPS data show samarium to be primarily divalent (4f{sup 6} ) at small particle size. The trivalent state (4f{sup 5} ) becomes progressively more abundant with increasing s1ze, becoming the dominant state for the bulk metal. These results are interpreted using a model in which band narrowing, due to reduced surface coordination, is more dominant than surface tension effects in establishing the valence of small samarium clusters.

  3. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  4. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel

    Energy Technology Data Exchange (ETDEWEB)

    Villarim Neto, Arthur; Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Rego, Amalia Cinthia Meneses [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Postgraduate Program in Health Sciences; Azevedo, Italo Medeiros; Medeiros, Aldo Cunha [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. of Surgery; Bernardo-Filho, Mario [State University of Rio de Janeiro, RJ (Brazil). Dept. of Biophysics and Biometry

    2009-01-15

    Purpose: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. Methods: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium) group received docetaxel (15 mg/kg) intraperitoneally in two cycles 11 days apart. The S (samarium/control) group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1 ml of samarium-153-EDTMP via orbital plexus (25 {mu} Ci. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI / g) was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland). Results: On the ninth day after the administration of the second chemotherapy cycle, the rats had a significant weight loss (314.50 +- 22.09 g) compared (p<0.5) to pre-treatment weight (353.66 {+-} 22.8). The % ATI/g in the samples of rats treated with samarium-153-EDTMP had a significant reduction in the right femur, left femur, kidney, liver and lungs of animals treated with docetaxel, compared to the control rats. Conclusion: The combination of docetaxel and samarium-153-EDTMP was associated with a lower response rate in the biodistribution of the radiopharmaceutical to targeted tissues. Further investigation into the impact of docetaxel on biodistribution of samarium-153-EDTMP would complement the findings of this study. (author)

  5. The Basis for Developing Samarium AMS for Fuel Cycle Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Buchholz, B A; Biegalski, S R; Whitney, S M; Tumey, S J; Weaver, C J

    2008-10-13

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of {sup 146}Sm, {sup 149}Sm, and {sup 151}Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  6. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    Optical characteristics of transparent samarium oxide thin films deposited by the radio-frequency sputtering technique. A A ATTA M M EL-NAHASS KHALED M ELSABAWY M M ABD EL-RAHEEM A M HASSANIEN A ALHUTHALI ALI BADAWI AMAR MERAZGA. Regular Volume 87 Issue 5 November 2016 Article ID 72 ...

  7. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3() ZnO(40-)V2O5(60) (where = 0.1–0.5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been calculated.

  8. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Optical properties of samarium doped zinc–tellurite glasses. B ERAIAH. Department of Physics, Karnatak University, Dharwad 580 003, India. Present address: Department of Physics, Bangalore University, Bangalore 560 056, India. MS received 20 March 2006; revised 13 June 2006. Abstract. Glasses with the composition, ...

  9. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: Syntheses, crystal structures, thermal analysis and luminescence study. MUHAMMAD IDIRIS SALEH, MIN YEE CHOO, TAI WEI CHAN and MOHD R RAZALI. ∗. School of Chemical Sciences, Universiti Sains Malaysia, Penang, ...

  10. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 127; Issue 12. Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: ... Muhammad Idiris Saleh1 Min Yee Choo1 Tai Wei Chan1 Mohd R Razali1. School of Chemical Sciences, Universiti Sains Malaysia, Penang, Malaysia ...

  11. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Mechanism of the electrochemical deposition of samarium-based coatings

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, Edgar J. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Ortega-Borges, Raul [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Godinez, Luis A. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Chapman, Thomas W. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Meas-Vong, Yunny [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico)]. E-mail: yunnymeas@cideteq.mx

    2006-11-12

    Samarium-based films have been shown to form from aqueous solutions on the surfaces of metallic substrates such as steel or aluminum, and their presence has been reported to decrease substantially the corresponding corrosion rate of the underlying metallic substrate. Based on previous reports on the deposition of oxides or hydroxides of the closely related element cerium, this work demonstrates that samarium films are formed following a similar mechanism, which involves as the fundamental step an increase in interfacial pH resulting from cathodic oxygen-reduction or hydrogen-evolution reactions. With cyclic voltammetry (CV), electrochemical quartz-crystal microbalance (EQCM) measurements, rotating-disk electrode (RDE) tests, and surface characterization techniques, namely, scanning electron microscopy (SEM) and X-ray surface microanalysis (EDX), the postulated mechanism was verified, and the surface morphology of the resulting films was correlated with the nature of the reduction reaction that triggers film formation.

  13. Samarium Monosulfide (SmS): Reviewing Properties and Applications

    OpenAIRE

    Sousanis, Andreas; Smet, Philippe; Poelman, Dirk

    2017-01-01

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducti...

  14. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  15. Synthesis of nano-pore samarium (III)-imprinted polymer for preconcentrative separation of samarium ions from other lanthanide ions via solid phase extraction

    Energy Technology Data Exchange (ETDEWEB)

    Shirvani-Arani, Simindokht [Center of Excellence in Electrochemistry, Department of Chemistry, University of Tehran, P.O.Box:14155-6455, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ahmadi, Seyed Javad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)], E-mail: sjahmadi@aeoi.org.ir; Bahrami-Samani, Ali [Nuclear Engineering and Physics Department, Amir Kabir University, P.O.Box: 15875-4413, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ghannadi-Maragheh, Mohammad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)

    2008-08-08

    A batch process was developed to separate samarium ions from some lanthanide ions by a novel solid phase which was prepared via the ion-imprinting technique. The samarium (III) ion-imprinted polymer (IIP) particles were synthesized by preparing the ternary complex of samarium ions with 5,7-dichloroquinoline-8-ol (DCQ) and 4-vinylpyridine (VP). Then, thermally copolymerization with styrene (functional monomer, STY) and divinylbenzene (cross-linking monomer, DVB) followed in the presence of 2-methoxy ethanol (porogen) and 2,2'-azobisisobutyronitrile (initiator, AIBN). The imprinted ion was removed by stirring the above particles with 50% (v/v) HCl to obtain the leached IIP particles. Moreover, control polymer (CP) particles were similarly prepared without the samarium ions. The unleached and leached IIP particles were characterized by X-ray diffraction (XRD), infra-red spectroscopy (IR), thermo gravimetric analysis (TGA) and scanning electron microscopy (SEM). Finally, preconcentration and selectivity studies for samarium and the other lanthanide ions were carried out. The preconcentration of the samarium (III) traces was studied during rebinding with the leached IIP particles as a function of pH, the weight of the polymer material, the preconcentration and the elution times, the eluent volume and the aqueous phase volume. These studies indicated that the samarium (III) amount as low as 1 {mu}g, present in 200 mL, could be preconcentrated into 25 mL of 1.0 M HCl.

  16. Ionization of Samarium by Chemical Releases in the Upper Atmosphere

    Science.gov (United States)

    Siefring, C. L.; Bernhardt, P. A.; Holmes, J. M.; Pedersen, T. R.; Caton, R.; Miller, D.; Groves, K. M.

    2014-12-01

    The release of Samarium vapor into the upper atmosphere was studied using during the Air Force Research Laboratory sponsored Metal Oxide Space Cloud (MOSC) rocket launches in May 2009. The Naval Research Laboratory supported these experiments with 3-D photochemical modeling of the artificial plasma cloud including (1) reactions with atomic oxygen, (2) photo excitation, (3) photoionization, (4) dissociative recombination, and (5) ion and neutral diffusion. NRL provided the experimental diagnostic instrument on the rocket which was a dual frequency radio beacon on the rocket to measure changes in total electron content. The AFRL provided ground based diagnostics of incoherent scatter radar and optical spectroscopy and imagery. The NRL Chemical Release Model (CRM) has over 600 excited states of atomic Samarium neutrals, atomic ions, along with Samarium Oxide Ions and electrons. Diffusive transport of neutrals in cylindrical geometry and ions along magnetic field lines is computed along with the reactive flow to predict the concentrations of Sm, Sm-Ion, Sm0, and SmO Ion. Comparison of the CRM with observations demonstrates that Sm release into the upper atmosphere initially produces enhanced electron densities and SmO-Ions. The diatomic ions recombine with electrons to yield neutral Sm and O. Only the photo ionization of Sm yields a stable atomic ion that does not substantially recombine. The MOSC releases in sunlight yielded long duration ion clouds that can be replicated with the CRM. The CRM predicts that Sm releases in darkness would not produce long duration plasma clouds because of the lack of photo excitation and photoionization.

  17. Reactive Materials for Evaporating Samarium (Pre-Print)

    Science.gov (United States)

    2016-04-15

    SUBJECT TERMS energetic materials, heat sources, pyrotechnic charges, easily ionized metals 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF...experiments.    Keywords:  energetic  materials, heat sources, pyrotechnic charges, easily ionized metals  1. Introduction Ejection of clouds of...results  were  negatively  affected  by  reduced  efficiency   of  release  and  ionization of samarium [8]. It is possible that not the entire charge of

  18. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  19. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  20. Luminescent solutions and powders of new samarium complexes with N,N',O,O'-chelating ligands

    Science.gov (United States)

    Kharcheva, Anastasia V.; Nikolskiy, Kirill S.; Borisova, Nataliya E.; Ivanov, Alexey V.; Reshetova, Marina D.; Yuzhakov, Viktor I.; Patsaeva, Svetlana V.

    2016-04-01

    Imaging techniques in biology and medicine are crucial tools to obtain information on structural and functional properties of living cells and organisms. To fulfill the requirements associated with application of these techniques it appears necessary to design markers with specific characteristics. Luminescent complexes of trivalent lanthanide ions with chelating ligands are of increasing importance in biomedical applications because of their millisecond luminescence lifetime, narrow emission band, high signal-to-noise ratio and minimal photodamage to biological samples. In order to extend the available emission wavelength range the luminescent samarium chelates are highly desirable. In this study the ligands with diamides of 2,2'-bipyridin-6,6'-dicarboxylic acid were used to improve photophysical characteristics of samarium complexes. We report the luminescence characteristics of samarium complexes with novel ligands. All complexes exhibited the characteristic emission of Sm (III) ion with the lines at 565, 597, 605, 645 and 654 nm, the intensity strongly depended on the ligand. Absorption and luminescence excitation spectra of Sm (III) complexes showed main peaks in the UV range demonstrating lanthanide coordination to the ligand. The absolute lumenescence quantum yield was measured for solutions in acetonitrile with excitation at 350 nm. The largest luminescence quantum yield was found for the samarium complex Bipy 6MePy Sm (3%) being much higher that for samarium complexes reported in the literature earlier. These results prove as well that samarium chelates are potential markers for multiparametric imaging techniques.

  1. Australian manufacture of Quadramet{sup TM} (Samarium-153 EDTMP)

    Energy Technology Data Exchange (ETDEWEB)

    Wood, N.R.; Whitwell, J. [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). Australian Radioisotopes

    1997-10-01

    Quadramet{sup T} (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200{mu}g/mL whereas the overseas formulation has a level of 20-46{mu}g/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet{sup TM} provides a further option in the management of these difficult cases

  2. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  3. Optical analysis of samarium doped sodium bismuth silicate glass.

    Science.gov (United States)

    Thomas, V; Sofin, R G S; Allen, M; Thomas, H; Biju, P R; Jose, G; Unnikrishnan, N V

    2017-01-15

    Samarium doped sodium bismuth silicate glass was synthesized using the melt quenching method. Detailed optical spectroscopic studies of the glassy material were carried out in the UV-Vis-NIR spectral range. Using the optical absorption spectra Judd-Ofelt (JO) parameters are derived. The calculated values of the JO parameters are utilized in evaluating the various radiative parameters such as electric dipole line strengths (Sed), radiative transition probabilities (Arad), radiative lifetimes (τrad), fluorescence branching ratios (β) and the integrated absorption cross- sections (σa) for stimulated emission from various excited states of Sm3+‡ ion. The principal fluorescence transitions are identified by recording the fluorescence spectrum. Our analysis revealed that the novel glassy system has the optimum values for the key parameters viz. spectroscopic quality factor, optical gain, stimulated emission cross section and quantum efficiency, which are required for a high performance optical amplifier. Calculated chromaticity co-ordinates (0.61, 0.38) also confirm its application potential in display devices. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Samarium Monosulfide (SmS): Reviewing Properties and Applications.

    Science.gov (United States)

    Sousanis, Andreas; Smet, Philippe F; Poelman, Dirk

    2017-08-16

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducting and metallic states could be exploited in several applications, such as high density optical storage and memory materials, thermovoltaic devices, infrared sensors and more. We discuss the electronic, optical and magnetic properties of SmS, its switching behavior, as well as the thin film deposition techniques which have been used, such as e-beam evaporation and sputtering. Moreover, applications and possible ideas for future work on this material are presented. Our scope is to present the properties of SmS, which were mainly measured in bulk crystals, while at the same time we describe the possible deposition methods that will push the study of SmS to nanoscale dimensions, opening an intriguing range of applications for low-dimensional, pressure-induced semiconductor-metal transition compounds.

  5. Excitation induced spectroscopic study and quenching effect in cerium samarium codoped lithium aluminoborate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Parvinder; Kaur, Simranpreet [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, Gurinder Pal [Department of Physics, Khalsa College, Amritsar 143002 (India); Arora, Deepawali; Kumar, Sunil [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, D.P., E-mail: dpsinghdr@yahoo.com [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India)

    2016-08-15

    Lithium aluminium borate host has been codoped with cerium and samarium to prepare glass by conventional melt quench technique. Their structural and spectroscopic investigation has been carried out using XRD, FTIR and density measurements. The UV‐Vis absorption spectra and fluorescence spectra (λ{sub exc}.=380 nm and 400 nm) have been studied for spectroscopic analysis. The amorphous nature of the prepared samples is shown by XRD. The density is increasing with addition of cerium at the expense of aluminium, keeping other components constant. FTIR study also shows the presence of compact and stable tetrahedral BO{sub 4} units thus supporting the density results. The UV‐ Vis absorption spectra show a shift of optical absorption edge towards longer wavelength along with an increase in intensity of peaks with rising samarium concentration. The fluorescence spectra show a blue shift and subsequent suppression of cerium peaks with addition of samarium.

  6. Effect of samarium doping on the dielectric behavior of barium zircomium titanate ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Badapanda, T., E-mail: badapanda.tanmaya@gmail.com [Department of Physics, C.V. Raman College of Engineering, Bhubaneswar, Odisha-752054 (India); Sarangi, S.; Behera, B. [School of Physics, Sambalpur University, Jyoti Vihar Sambalpur, Odisha-768019 (India); Anwar, S. [Colloids and Materials Chemistry, Institute of Minerals and Materials Technology, Bhubaneswar, Odisha-751013 (India); Sinha, T. P. [Department of Physics, Bose Institute, Kolkata-700009 (India)

    2014-04-24

    Samarium doped Barium Zirconium Titanate ceramic with general formula Ba{sub 1−x}Sm{sub 2x/3}Zr{sub 0.05}Ti{sub 0.95}O{sub 3} [x=0.0,0.01,0.02,0.03,0.04] has been prepared by high energy ball milling. The X-ray diffraction (XRD) patterns confirmed that these ceramics have a single phase with perovskite-type upto x≤0.03 and a small secondary phase exist at x=0.04. The temperature dependent dielectric study shows a ferroelectric phase transition and transition temperature decreases with an increase in the Samarium content.

  7. Lithium Bromide/Water as Additives in Dearomatizing Samarium-Ketyl (Hetero)Arene Cyclizations.

    Science.gov (United States)

    Rao, Chintada Nageswara; Bentz, Christoph; Reissig, Hans-Ulrich

    2015-11-02

    New conditions for dearomatizing samarium-ketyl (hetero)arene cyclizations are reported. In many examples of these samarium diiodide-mediated reactions, lithium bromide and water can be used as additives instead of the carcinogenic and mutagenic hexamethylphosphoramide (HMPA). The best results were obtained for the cyclizations of N-acylated indole derivatives delivering the expected indolines in good yields and excellent diastereoselectivities. A new type of cyclization delivering indolyl-substituted allene derivatives is also described. The scope and limitations of the lithium bromide/water system are discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    The samarium-doped ceria (SDC) nanospheres were prepared by the one-step hydrothermal method and characterized by transmission electron microscope, scanning electron microscope, powder X-ray diffraction, X-ray photoelectron spectroscopy, energy-dispersive spectrometer and Raman spectra. According to the ...

  9. A spectroscopic comparison of samarium-doped LiYF4 and KY3F10

    NARCIS (Netherlands)

    Wells, J. P. R.; Sugiyama, A.; Han, T. P. J.; Gallagher, H. G.

    2000-01-01

    Laser selective excitation and fluorescence has been performed on LiYF4 and KY3F10 doped with samarium ions. In LiYF4, a single, tetragonal symmetry center associated with isovalent substitution of Sm3+ with lattice yttrium ions is present. By contrast, three Sm2+ centres and a single, tetragonal

  10. The Use of a Flexible Calix[4]arene Template to Stabilize a Cyclooctatetraindiyl Samarium-Potassium Complex

    Directory of Open Access Journals (Sweden)

    Geoffroy Guillemot

    2013-01-01

    Full Text Available A sandwich compound of cyclooctatetraendiyl (COT2− samarium-potassium was synthesized and analyzed using a flexible calix[4]arene dianion. This compound, [p-tBu-calix[4]-(OMe2(O2]arenediyl-samarium-(η8-cyclooctatetraendiyl-potassium (tetrahydrofurane3, is constructed as a linear sequence L-Sm--K-, where L, , and are specific ligands with L = O,O-dimethyl-calix[4]arene2−, = cyclo-octatetraendiyl, and = tetrahydrofurane templates.

  11. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  12. Samarium(II) iodide-mediated reductive annulations of ketones bearing a distal vinyl epoxide moiety

    Energy Technology Data Exchange (ETDEWEB)

    Molander, G.A.; Shakya, S.R. [Univ. of Colorado, Boulder, CO (United States)

    1996-08-23

    It was found that samarium (II) iodide promotes the intramolecular coupling of ketones with distal epoxy olefins while in the presence of hexamethylphosphoramide (HPMA). A number of epoxide compounds (1 a-k) fragment to form carbocycles with allylic alcohol side chains with high diastereoselectivity (2 a-k). Substituting tetramethylguanidine for HPMA reduces the diastereoselectivity. Adding Pd(0) as a catalyst reverses the diastereoselective sense. 40 refs., 1 tab.

  13. A temporal three-dimensional simulation of samarium release in the ionosphere

    Science.gov (United States)

    Zhao, Hai-Sheng; Feng, Jie; Xu, Zheng-Wen; Wu, Jian; Wu, Zhen-Sen; Xu, Bin; Xue, Kun; Xu, Tong; Hu, Yan-Li

    2016-10-01

    For understanding plasma processes of the ionosphere and magnetosphere, the alkali and alkaline-earth metals are usually released in space for artificially increasing the electron density. However, it is a limitation that these releases must be in sunlight where the photoionization can take place. In recent years, the lanthanide metals, such as samarium, have been released to produce electrons in reaction with atomic oxygen in the upper space. The reaction could proceed without sunlight so that the restriction on experimental periods is broken. Unfortunately, any sophisticated models even preliminary ones are unavailable yet in the literature. A temporal three-dimensional model is presented for the samarium release in detail with respect to various altitudes and mass. Especially, the plasma diffusion equation is remarkably extended from 2-D to 3-D by importing the influence of geomagnetic declination, which could be also useful for other chemical releases. The field-aligned terms are brought so as to the presented model can describe the diffusion along the geomagnetic field subtly. On the basis of the presented model, behaviors of radio waves propagating through the release area are simulated by using ray tracing. This model could be as the theoretical support for samarium releases, and it also helpful for the research on the generation and evolution of the ionosphere irregularities.

  14. 10 CFR 110.134 - Public participation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Public participation. 110.134 Section 110.134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Rulemaking § 110.134 Public participation. (a) The Commission may hold an oral hearing on a proposed rule or permit...

  15. 13 CFR 134.210 - Intervention.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Intervention. 134.210 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.210 Intervention. (a) By... intervention to protect such interest. An interested person is any individual, business entity, or governmental...

  16. 24 CFR 13.4 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...

  17. 10 CFR 600.134 - Equipment.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Equipment. 600.134 Section 600.134 Energy DEPARTMENT OF... Nonprofit Organizations Post-Award Requirements § 600.134 Equipment. (a) Title to equipment acquired by a... recipient shall not use equipment acquired with Federal funds to provide services to non-Federal outside...

  18. 14 CFR 1260.134 - Equipment.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Equipment. 1260.134 Section 1260.134..., Hospitals, and Other Non-Profit Organizations Property Standards § 1260.134 Equipment. (a) For grants and... research to not vest title in the recipient as exempt, equipment shall vest in the recipient subject to...

  19. Liquid–liquid anion exchange extraction studies of samarium(III from salicylate media using high molecular weight amine

    Directory of Open Access Journals (Sweden)

    Aniruddha M. Mandhare

    2015-07-01

    Full Text Available Liquid–liquid extraction and separation of samarium(III were carried out by using 0.025 mol dm−3 2-octylaminopyridine(2-OAP in xylene at 298 K. The extraction behavior of samarium was studied as a function of pH, weak acid concentration, extractant concentration, diluent, and equilibration time. Samarium was quantitatively extracted at pH 7.5 to 10.0 from 0.01 mol dm−3 sodium salicylate solution with 0.025 mol dm−3 2-OAP. The possible composition of the extracted species in organic phase has been determined by using model of slope analysis method and extraction mechanism was found to proceed via an anion exchange mechanism. The stripping efficiency was found to be quantitative in HNO3, HCl and CH3COOH. The robustness of the procedure was demonstrated by the average recoveries obtained (>99.6% for samarium(III extraction in the presence of several cations and anions which are commonly associated with it. The proposed method facilitates the separation and determination of samarium(III from binary and synthetic mixtures. The various thermodynamic functions like free energy (ΔG, enthalpy (ΔH and entropy (ΔS of extraction mechanism were discussed.

  20. Samarium(II) iodide-mediated intramolecular conjugate additions of alpha,beta-unsaturated lactones.

    Science.gov (United States)

    Molander, Gary A; St Jean, David J

    2002-05-31

    Samarium(II) iodide, in the presence of catalytic amounts of nickel(II) iodide, has been used to promote intramolecular conjugate additions of alkyl halides onto alpha,beta-unsaturated lactones. This process has been shown to be applicable to a number of alpha,beta-unsaturated lactones, including tetrasubstituted olefins, and has been demonstrated to be quite general for the formation of saturated bicyclic and tricyclic lactones. The method presented herein provides a mild, efficient process to form structurally complex lactones from simple precursors.

  1. 32 CFR 935.134 - Arm signals.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Arm signals. 935.134 Section 935.134 National... WAKE ISLAND CODE Motor Vehicle Code § 935.134 Arm signals. (a) Any person operating a motor vehicle and... signal for a turn or stop is made by fully extending the left arm as follows: (1) Left turn—extend left...

  2. Dicty_cDB: SLF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF134 (Link to dictyBase) - - - Contig-U01285-1 SLF134Z (Link... to Original site) - - SLF134Z 542 - - - - Show SLF134 Library SL (Link to library) Clone ID SLF134 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLF1-B/SLF134Q.Seq.d/ Representative seq. ID SLF13...4Z (Link to Original site) Representative DNA sequence >SLF134 (SLF134Q) /CSM/SL/SLF1-B/SLF134Q.Seq.d/ XXXXX... Amino Acid sequence ---snvestqdvvkh*fyccswvaltritle*lemfntqp*llarigkr*gggdsgtf*l fqyl*MVKLWLFSLWYQLLQIMAIYN

  3. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  4. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  5. X-Band Microwave Reflection Properties of Samarium/Bismuth-Substituted Barium Lanthanum Titanate Ceramics

    Science.gov (United States)

    Bahel, Shalini; Pubby, Kunal; Narang, Sukhleen Bindra

    2017-03-01

    Samarium/bismuth-substituted barium lanthanum titanate ceramics with chemical composition Ba4 (La_{1 - y - z} Smy Biz )_{9.33} Ti_{18} O_{54} ( y = 0.5, 0.7; z = 0.05, 0.10, 0.15), intended as microwave reflecting materials, have been investigated in microwave X-band (8.2 GHz to 12.4 GHz) and the effect of substitution on their dielectric properties, i.e., dielectric constant and dielectric loss tangent, has been studied by vector network analyzer. Dielectric analysis showed that the dielectric constant increased with increasing samarium as well as bismuth content. Dielectric relaxation was observed for all samples in the scanned frequency range. Microwave reflection and transmission analysis of ceramic pellets of thickness 4 mm was carried out using two methods, i.e., open- and short-circuit approach, both indicating very high values of reflected power and very low values of transmitted power for all the doped materials in comparison with the base composition. The doped compositions are therefore potential microwave shielding materials for use in anechoic chambers, microwave laboratories, and radar equipment. Double-layer reflectors are also proposed, having better reflection properties (˜99% reflection) compared with single-layer reflectors.

  6. Microstructure and hysteresis curves of samarium-holmium-iron garnet synthesized by coprecipitation

    Directory of Open Access Journals (Sweden)

    Caffarena Valeska da Rocha

    2003-01-01

    Full Text Available An investigation was made into the synthesis and magnetic properties of Sm(3-xHo xFe5O12 (samarium-holmium-iron garnet ferrite, as yet absent from the literature. The material in question was synthesized by co-precipitation, starting from hydrated chlorides of rare-earth elements and ferrous sulfate, and the mixed hydroxide co-precipitate was calcined at 1000 °C. Using PVA as a binder, rectangular cross section-shaped compacts were produced by means of steel-die pressing, drying and sintering from 1200 to 1450 °C. The main conclusions of this study were that the coercive force decreases as the sintering temperature increases, and that the effect of substituting holmium for samarium in SmIG is entirely different from that provided by replacing yttrium by gadolinium in YIG, which is the most important result of this work. An in-depth investigation will be necessary to determine the correlation between microstructure/magnetic properties and ceramic processing variables.

  7. Bone-seeking radiopharmaceuticals as targeted agents of osteosarcoma: samarium-153-EDTMP and radium-223.

    Science.gov (United States)

    Anderson, Peter M; Subbiah, Vivek; Rohren, Eric

    2014-01-01

    Osteosarcoma is a cancer characterized by formation of bone by malignant cells. Routine bone scan imaging with Tc-99m-MDP is done at diagnosis to evaluate primary tumor uptake and check for bone metastases. At time of relapse the Tc-99m-MDP bone scan also provides a specific means to assess formation of bone by malignant osteosarcoma cells and the potential for bone-seeking radiopharmaceuticals to deliver radioactivity directly into osteoblastic osteosarcoma lesions. This chapter will review and compare a bone-seeking radiopharmaceutical that emits beta-particles, samarium-153-EDTMP, with an alpha-particle emitter, radium-223. The charged alpha particles from radium-223 have far more mass and energy than beta particles (electrons) from Sm-153-EDTMP. Because radium-223 has less marrow toxicity and more radiobiological effectiveness, especially if inside the bone forming cancer cell than samarium-153-EDTMP, radium-223 may have greater potential to become widely used against osteosarcoma as a targeted therapy. Radium-223 also has more potential to be used with chemotherapy against osteosarcoma and bone metastases. Because osteosarcoma makes bone and radium-223 acts like calcium, this radiopharmaceutical could possibly become a new targeted means to achieve safe and effective reduction of tumor burden as well as facilitate better surgery and/or radiotherapy for difficult to resect large, or metastatic tumors.

  8. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  9. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  10. 15 CFR 923.134 - Public participation.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Public participation. 923.134 Section... MANAGEMENT COASTAL ZONE MANAGEMENT PROGRAM REGULATIONS Review of Performance § 923.134 Public participation... participation, including holding public meetings in the State being evaluated and providing opportunities for...

  11. 13 CFR 134.402 - Appeal petition.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... why the determination is alleged to be arbitrary, capricious or contrary to law. This section does not...

  12. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  13. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry in the Region of Samarium, Europium, and Gadolinium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R D; Kelley, K; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of samarium, europium and gadolinium (62 {le} Z {le} 64, 82 {le} N {le} 96).

  14. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  15. Dicty_cDB: SLB134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB134 (Link to dictyBase) - - - Contig-U16455-1 SLB134E (Link to Original site) SLB...134F 638 SLB134Z 233 SLB134P 871 SLB134E 654 Show SLB134 Library SL (Link to library) Clone ID SLB...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-B/SLB134Q.Seq.d/ Representative seq. ID SLB...134E (Link to Original site) Representative DNA sequence >SLB134 (SLB134Q) /CSM/SL/SLB1-B/SLB...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLB134 (SLB134Q) /CSM/SL/SLB1-B/SLB

  16. Effects of the atomic environment on the electron binding energies in samarium

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh., E-mail: inoyatov@jinr.ru [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Institute of Applied Physics, National University, Tashkent, Republic of Uzbekistan (Uzbekistan); Kovalík, A. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Filosofov, D.V. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Ryšavý, M.; Vénos, D. [Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Yushkevich, Yu.V.; Perevoshchikov, L.L. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Zhdanov, V.S. [Nuclear Physics Institute, Almaty, Republic of Kazakhstan (Kazakhstan)

    2016-02-15

    Highlights: • Eight different matrices (evaporated and implanted at 30 keV) used. • The greatest average difference in the binding energies amounted to 3.1 ± 0.1 eV. • The presence of trivalent and divalent Sm ions found in some implanted samples. • No significant differences in Sm natural atomic level widths were observed. - Abstract: Effects of the atomic environment on the L{sub 1}, L{sub 2}, L{sub 3}, M{sub 1}, M{sub 2}, M{sub 3}, and N{sub 1} electron binding energies in samarium generated in the electron capture decay of radioactive {sup 149}Eu were investigated by means of the internal conversion electron spectroscopy using the conversion electron spectrum of the 22.5 keV M1 + E2 nuclear transition in the daughter {sup 149}Sm. In this investigation, four pairs of {sup 149}Eu sources prepared by vacuum evaporation deposition and by ion implantation at 30 keV with the use of four different source backing materials, namely polycrystalline carbon, aluminium, gadolinium and platinum foils, were employed. The greatest average difference of (3.1 ± 0.1) eV in the L{sub 1}, L{sub 2}, L{sub 3}, and M{sub 1} subshell electron binding energies was observed between the {sup 149}Eu sources prepared by ion implantation into the aluminium and platinum substrates. On the other hand, minimal differences in the electron binding energies were generally found between samarium generated in the evaporated layer and in the bulk for the individual investigated source backings with the exception of the gadolinium foil. A doublet structure of all investigated conversion electron lines with the average values of 8.1 ± 0.2 eV and 1.5 ± 0.1 for the separation energy and the intensity ratio of the low-energy to high-energy components, respectively, was observed for the {sup 149}Eu sources prepared by ion implantation into the aluminium and carbon foils. This structure was presumably caused by the presence of both the trivalent and divalent Sm ions in the sources. No

  17. Multiphoton laser wave-mixing absorption spectroscopy for samarium using a graphite furnace atomizer

    Energy Technology Data Exchange (ETDEWEB)

    Maniaci, Michael J.; Tong, William G. E-mail: william.tong@sdsu.edu

    2004-07-30

    Nonlinear laser wave-mixing optical technique is presented as a sensitive atomic spectroscopic method for the analysis of rare earth elements using an unmodified commercially available graphite furnace (GF) atomizer. A simple nonplanar backward-scattering degenerate four-wave mixing optical arrangement offers sub-picogram detection sensitivity with sub-Doppler Lorentzian-broadened resolution. Nonlinear wave mixing is an unusually sensitive absorption-based optical method that offers both excellent detection sensitivity and sub-Doppler spectral resolution. A mass detection limit of 0.7 pg and a concentration detection limit of 70 pg/ml are determined for a rare earth element, samarium, using the 429.7-nm excitation line.

  18. Samarium Doped Cerium Oxide Clusters: a Study on the Modulation of Electronic Structure

    Science.gov (United States)

    Topolski, Josey E.; Kafader, Jared O.; Marrero-Colon, Vicmarie; Chick Jarrold, Caroline

    2017-06-01

    Cerium oxide is known for its use in solid oxide fuel cells due to its high ionic conductivity. The doping of trivalent samarium atoms into cerium oxide is known to enhance the ionic conductivity through the generation of additional oxygen vacancies. This study probes the electronic structure of Sm_{x}Ce_{y}O_{z} (x+y=3, z=2-4) anion and neutral clusters. Anion photoelectron spectra of these mixed metal clusters exhibit additional spectral features not present in the previously studied cerium oxide clusters. Density functional theory calculations have been used to aid interpretation of collected spectra. The results of this work can be used to inform the design of materials used for solid oxide fuel cells.

  19. Chelating Ligand-Mediated Hydrothermal Synthesis of Samarium Orthovanadate with Decavanadate as Vanadium Source

    Directory of Open Access Journals (Sweden)

    Quanguo Li

    2013-01-01

    Full Text Available A new ethylenediaminetetraacetic acid- (EDTA- mediated hydrothermal route to prepare chrysanthemum-shaped samarium orthovanadate (SmVO4 nanocrystals with decavanadate (K6V10O28·9H2O as vanadium source has been developed. The present hydrothermal approach is simple and reproducible and employs a relatively mild reaction temperature. The EDTA, pH value, and temperature of the reaction systems play important roles in determining the morphologies and growth process of the SmVO4 products. The products have been characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, Fourier transform infrared spectroscopy (FT-IR, photoluminescence spectra (PL, and UV-Vis spectroscopy.

  20. The Magnetocaloric Effect and Heat Capacity of Suspensions of High-Dispersity Samarium Ferrite

    Science.gov (United States)

    Korolev, V. V.; Aref'ev, I. M.; Ramazanova, A. G.

    2008-02-01

    The magnetocaloric effect and specific heat capacity of an aqueous suspension of samarium ferrite were determined calorimetrically over the temperature range 288-343 K in magnetic fields of 0-0.7 T. The data obtained were used to calculate changes in the magnetic component of the molar heat capacity and entropy of the magnetic phase and changes in the enthalpy of the process under an applied magnetic field. The magnetocaloric effect was found to increase nonlinearly as the magnetic field induction grew. The corresponding temperature dependences contained a maximum at 313 K related to the second-order magnetic phase transition at the Curie point. The field and temperature dependences of heat capacity contained a maximum in fields of 0.4 T and a minimum at the magnetic phase transition temperature.

  1. Preparation of hollow core/shell microspheres of hematite and its adsorption ability for samarium.

    Science.gov (United States)

    Yu, Sheng-Hui; Yao, Qi-Zhi; Zhou, Gen-Tao; Fu, Sheng-Quan

    2014-07-09

    Hollow core/shell hematite microspheres with diameter of ca. 1-2 μm have been successfully achieved by calcining the precursor composite microspheres of pyrite and polyvinylpyrrolidone (PVP) in air. The synthesized products were characterized by a wide range of techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), energy-dispersive X-ray spectroscopy (EDX), transmission electron microscopy (TEM), high-resolution TEM (HRTEM), thermogravimetric analysis (TGA) and differential scanning calorimetry (DSC), and Brunauer-Emmett-Teller (BET) gas sorptometry. Temperature- and time-dependent experiments unveil that the precursor pyrite-PVP composite microspheres finally transform into hollow core/shell hematite microspheres in air through a multistep process including the oxidation and sulfation of pyrite, combustion of PVP occluded in the precursor, desulfation, aggregation, and fusion of nanosized hematite as well as mass transportation from the interior to the exterior of the microspheres. The formation of the hollow core/shell microspheres dominantly depends on the calcination temperature under current experimental conditions, and the aggregation of hematite nanocrystals and the core shrinking during the oxidation of pyrite are responsible for the formation of the hollow structures. Moreover, the adsorption ability of the hematite for Sm(III) was also tested. The results exhibit that the hematite microspheres have good adsorption activity for trivalent samarium, and that its adsorption capacity strongly depends on the pH of the solution, and the maximum adsorption capacity for Sm(III) is 14.48 mg/g at neutral pH. As samarium is a typical member of the lanthanide series, our results suggest that the hollow hematite microspheres have potential application in removal of rare earth elements (REEs) entering the water environment.

  2. The influence of the technological parameters on the ionic conductivity of samarium doped ceria thin films

    Directory of Open Access Journals (Sweden)

    Mantas Sriubas

    2015-03-01

    Full Text Available Sm0,20Ce0,80O2 powder was used for the formation of samarium doped cerium oxide (SDC thin films using e-beam. Surface area of powder was 34.9 m2/g and particle size – 0.3-0.5 μm. Thin films were deposited using physical vapor deposition system on SiO2 and Alloy 600 substrates. 2 Å/s – 16 Å/s growth rate and 20 °C – 600 °C substrate temperature were used during the deposition. Ionic conductivity investigation revealed that the maximum ionic conductivity (1.67 S/m has the thin film deposited on 300 °C temperature substrate using 4 Å/s growth rate. Minimum ionic conductivity (0.26 S/m has thin film which was deposited on 20 °C temperature substrate using 8 Å/s growth rate. Vacancy activation energies vary in 0.87 eV – 0.97 eV range. Furthermore the calculations of crystallite size revealed that crystallite size increases with increasing substrate temperature: from 7.50 nm to 46.23 nm on SiO2 substrate and from 9.30 nm to 44.62 nm on Alloy 600 substrate. Molar concentration of samarium in initial evaporated material is 19.38 mol% and varies from 11.37 mol% to 21 mol% in formed thin films depending on technological parameters.DOI: http://dx.doi.org/10.5755/j01.ms.21.1.5700

  3. Dicty_cDB: CFD134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD134 (Link to dictyBase) - - - Contig-U16241-1 CFD134P (Link to Original site) CFD...134F 615 CFD134Z 483 CFD134P 1098 - - Show CFD134 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-B/CFD134Q.Seq.d/ Representative seq. ID CFD...134P (Link to Original site) Representative DNA sequence >CFD134 (CFD134Q) /CSM/CF/CFD1-B/CFD...equences producing significant alignments: (bits) Value CFD134 (CFD134Q) /CSM/CF/CFD1-B/CFD

  4. Formation of Core-Shell Nanoparticles Composed of Magnetite and Samarium Oxide in Magnetospirillum magneticum Strain RSS-1.

    Science.gov (United States)

    Shimoshige, Hirokazu; Nakajima, Yoshikata; Kobayashi, Hideki; Yanagisawa, Keiichi; Nagaoka, Yutaka; Shimamura, Shigeru; Mizuki, Toru; Inoue, Akira; Maekawa, Toru

    2017-01-01

    Magnetotactic bacteria (MTB) synthesize magnetosomes composed of membrane-enveloped magnetite (Fe3O4) or greigite (Fe3S4) particles in the cells. Recently, several studies have shown some possibilities of controlling the biomineralization process and altering the magnetic properties of magnetosomes by adding some transition metals to the culture media under various environmental conditions. Here, we successfully grow Magnetospirillum magneticum strain RSS-1, which are isolated from a freshwater environment, and find that synthesis of magnetosomes are encouraged in RSS-1 in the presence of samarium and that each core magnetic crystal composed of magnetite is covered with a thin layer of samarium oxide (Sm2O3). The present results show some possibilities of magnetic recovery of transition metals and synthesis of some novel structures composed of magnetic particles and transition metals utilizing MTB.

  5. Co-reduction of aluminium and lanthanide ions in molten fluorides: Application to cerium and samarium extraction from nuclear wastes

    Energy Technology Data Exchange (ETDEWEB)

    Gibilaro, M. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France); Massot, L. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)], E-mail: massot@chimie.ups-tlse.fr; Chamelot, P.; Taxil, P. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)

    2009-09-01

    This work concerns the method of co-reduction process with aluminium ions in LiF-CaF{sub 2} medium (79-21 mol.%) on tungsten electrode for cerium and samarium extraction. Electrochemical techniques such as cyclic and square wave voltammetries, and potentiostatic electrolyses were used to study the co-reduction of CeF{sub 3} and SmF{sub 3} with AlF{sub 3}. For each of these elements, specific peaks of Al-Ce and Al-Sm alloys formation were observed by voltammetry as well as peaks of pure cerium and aluminium, and pure samarium and aluminium respectively. The difference of potential measured between the solvent reduction and the alloy formation suggests expecting an extraction efficiency of 99.99% of each lanthanide by the process. Different intermetallic compounds were obtained for different potentiostatic electrolysis and were characterised by Scanning Electron Microscopy with EDS probe. The validity of the process was verified by carrying out cerium and samarium extractions in the form of Al-Ln alloy; the extraction efficiency was 99.5% for Ce(III) and 99.4% for Sm(III)

  6. 19 CFR 134.34 - Certain repacked articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...

  7. Dicty_cDB: VHP134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP134 (Link to dictyBase) - - - Contig-U16260-1 VHP134P (Link to Original site) VHP...134F 617 VHP134Z 769 VHP134P 1366 - - Show VHP134 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-B/VHP134Q.Seq.d/ Representative seq. ID VHP...134P (Link to Original site) Representative DNA sequence >VHP134 (VHP134Q) /CSM/VH/VHP1-B/VHP...VNVIVGNTE--- ---liqr*skssc*lsr**prmg*k*chehlvfrsrr*rcqsprqchqrcsife*n*rff rwcfpmghqrrccl**kherypfqsl*chpph*chpqrwwsnhp

  8. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  9. Reference: 134 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 134 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15539473i Colangelo Elizabeth...loop-helix protein FIT1 is required for the iron deficiency response. 12 3400-12 15539473 2004 Dec The Plant cell Colangelo Elizabeth P|Guerinot Mary Lou

  10. 19 CFR 134.53 - Examination packages.

    Science.gov (United States)

    2010-04-01

    ... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by... the public stores. (2) Importer's premises or elsewhere. If it is impracticable to mark the articles...

  11. X-ray Induced Luminescence Spectroscopy of Samarium Doped Barium Sulfate Prepared by Sintering Method

    Science.gov (United States)

    Kumeda, T.; Maeda, K.; Shirano, Y.; Fujiwara, K.; Sakai, K.; Ikari, T.

    2015-06-01

    X-ray induced luminescence (XL) properties of phosphor materials made of samarium doped barium sulfate have been investigated. The samples were prepared by sintering method heated at 900-1250 °C for 3 hours in air from the mixture of BaSO4 and Sm2O3. The concentration of Sm were prepared from 0.01-6 at.%. In as-prepared sample, the Sm3+ was detected by photoluminescence (PL). The PL intensity is maximum about 2 at.% with Sm, and then starts decreasing. The PL intensity showed concentration quenching. The XL observed Sm2+ and Sm3+ ions. The XL was shown from the sample sintered up to 1200 °C. The XL intensity increased with Sm concentration up to 1 at.%. The intensity was almost constant larger than 1 at.% Sm. These concentration dependences is different since the X-ray energy absorbed to the host material at once, and the energy transferred to both Sm3+ and Sm2+ ions. Sm doped BaSO4 is found a host for XL phosphor materials.

  12. High-κ Samarium-Based Metal-Organic Framework for Gate Dielectric Applications.

    Science.gov (United States)

    Pathak, Abhishek; Chiou, Guan Ru; Gade, Narsinga Rao; Usman, Muhammad; Mendiratta, Shruti; Luo, Tzuoo-Tsair; Tseng, Tien Wen; Chen, Jenq-Wei; Chen, Fu-Rong; Chen, Kuei-Hsien; Chen, Li-Chyong; Lu, Kuang-Lieh

    2017-07-05

    The self-assembly of a samarium-based metal-organic framework [Sm2(bhc)(H2O)6]n (1) in good yield was achieved by reacting Sm(NO3)3·6H2O with benzenehexacarboxylic acid (bhc) in a mixture of H2O-EtOH under hydrothermal conditions. A structural analysis showed that compound 1 crystallized in a space group of Pnmn and adopted a 3D structure with (4,8) connected nets. Temperature dependent dielectric measurements showed that compound 1 behaves as a high dielectric material with a high dielectric constant (κ = 45.1) at 5 kHz and 310 K, which is comparable to the values for some of the most commonly available dielectric inorganic metal oxides such as Sm2O3, Ta2O5, HfO2, and ZrO2. In addition, electrical measurements of 1 revealed an electrical conductivity of about 2.15 × 10-7 S/cm at a frequency of 5 kHz with a low leakage current (Ileakage = 8.13 × 10-12 Amm-2). Dielectric investigations of the Sm-based MOF provide an effective path for the development of high dielectric materials in the future.

  13. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  14. Characterization of luminescent samarium doped HfO{sub 2} coatings synthesized by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Chacon-Roa, C [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Guzman-Mendoza, J [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Aguilar-Frutis, M [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Garcia-Hipolito, M [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Alvarez-Fragoso, O [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Falcony, C [Departamento de Fisica, CINVESTAV-IPN, A. P. 14-740, 07000 Mexico D.F. (Mexico)

    2008-01-07

    Trivalent samarium (Sm{sup 3+}) doped hafnium oxide (HfO{sub 2}) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO{sub 2} monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO{sub 2} : SmCl{sub 3} films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm{sup 3+} ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed.

  15. Samarium-153 EDTMP for metastatic bone pain palliation: the impact of europium impurities.

    Science.gov (United States)

    Kalef-Ezra, J A; Valakis, S T; Pallada, S

    2015-02-01

    To evaluate the impact on the radiation protection policies of the radiocontaminants in Samarium-153 ethylenediamine tetramethylene phosphonate ((153)Sm-EDTMP). The internal contamination of patients treated with (153)Sm-EDMTP for palliation of painful disseminated multiple bone metastases due to long-lived impurities was assessed by direct measurements. These measurements were coupled with dose-rate measurements close to their bodies and spectroscopic analysis of the residual activity in post-treatment radiopharmaceutical vials. Whole-body counting carried out in six patients showed a 30-81-kBq europium -152 plus europium-154 contamination. The 0.85 mean (152)Eu- to -(154)Eu activity ratio obtained by direct counting was similar to that assessed by analysis of post-treatment residual activities in twelve radiopharmaceutical vials following radiopharmaceutical injection. The long-lived radiocontaminants in the patient's bodies and the treatment wastes require modifications of the applicable radiation protection policies. Copyright © 2014 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  16. Luminescence of trivalent samarium ions in silver and tin co-doped aluminophosphate glass

    Science.gov (United States)

    Jiménez, José A.; Lysenko, Sergiy; Liu, Huimin; Sendova, Mariana

    2011-06-01

    This work presents the spectroscopic properties of trivalent samarium ions in a melt-quenched aluminophosphate glass containing silver and tin. Addition of 4 mol% of each Ag 2O and SnO into the glass system with 2 mol% Sm 2O 3 results in Sm 3+ ions luminescence under non-resonant UV excitation owing to energy transfer from single silver ions and/or twofold-coordinated Sn centers. Assessment of luminescence spectra and decay dynamics suggest the energy transfer mechanism to be essentially of the resonant radiative type. Moreover, a connection between the luminescent and structural properties of the rare-earth doped glass system was demonstrated. Raman spectroscopy characterization revealed that no significant variation in the glass matrix is induced by Sm 3+ doping at the concentration employed. A comparison was made with a structural study performed on the Eu 3+ doped system (containing 2 mol% Eu 2O 3 along with 4 mol% of each Ag 2O and SnO) where the radiative energy transfer mechanism was previously established. The data appears consistent regarding the lack of variation in glass structure upon the Eu 3+ and Sm 3+ doping in connection with the dominance of the radiative transfer in the matrix. Thermal treatment of the material leads to precipitation of Ag nanoparticles of a broad size range inside the dielectric as observed by transmission electron microspcopy. Assessment of 4G 5/2 excited state decay in Sm 3+ ions shows no influence from the silver particles.

  17. Samarium (III) adsorption on bentonite modified with N-(2-hydroxyethyl) ethylenediamine.

    Science.gov (United States)

    Li, Dandan; Chang, Xijun; Hu, Zheng; Wang, Qihui; Li, Ruijun; Chai, Xiaoli

    2011-02-15

    A new material has been synthesized using dry process to activate bentonite followed by N-(2-hydroxyethyl) ethylenediamine connecting chlorosilane coupling agent. The synthesized new material was characterized by elemental analysis, FT-IR and thermogravimetry which proved that bentonite was successfully modified. The most interesting trait of the new material was its selective adsorption for rare earth elements. A variety of conditions of the new material were investigated for adsorption. The optimal conditions were determined with respect to pH and shaking time. Samarium (Sm) was quantitatively adsorbed at pH 4 and shaking time of 2 min onto the new material. Under these conditions the maximum static adsorption capacity of Sm(III) was found to be 17.7 mg g(-1). The adsorbed Sm(III) ion were quantitatively eluted by 2.0 mL 0.1 mol L(-1) HCl and 5% CS (NH(2))(2) solution. According to IUPAC definition, the detection limit (3σ) of this method was 0.60 ng mL(-1). The relative standard deviation (RSD) under optimum conditions was less than 3% (n=8). The new material also was applied for the preconcentration of trace Sm(III) in environmental samples with satisfactory results. Copyright © 2010 Elsevier B.V. All rights reserved.

  18. Performance comparison of a refrigerator system using R134a and hydrocarbon refrigerant (HCR134a) with different expansion devices

    Science.gov (United States)

    Aziz, A.; Izzudin; Mainil, A. K.

    2017-09-01

    The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.

  19. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  20. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Science.gov (United States)

    Mandiwana, Vusani; Kalombo, Lonji; Venter, Kobus; Sathekge, Mike; Grobler, Anne; Zeevaart, Jan Rijn

    2015-09-01

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly( d, l-lactide- co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([153Sm]Sm2O3) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive 153Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The 153Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [153Sm]Sm2O3 loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [153Sm]Sm2O3-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  1. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  2. 13 CFR 134.404 - Decision by Administrative Law Judge.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...

  3. 13 CFR 134.409 - Decision on appeal.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...

  4. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 keV. This...

  5. Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a

    Science.gov (United States)

    Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul

    2012-06-01

    An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.

  6. Optical response and magnetic characteristic of samarium doped zinc phosphate glasses containing nickel nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Azmi, Siti Amlah M.; Sahar, M.R., E-mail: mrahim057@gmail.com

    2015-11-01

    A magnetic glass of composition 40ZnO–(58−x) P{sub 2}O{sub 5}–1Sm{sub 2}O{sub 3}–xNiO, with x=0.0, 1.0, 1.5 and 2.0 mol% is prepared by melt-quenching technique. The glass is characterized by X-ray diffraction, high-resolution transmission electron microscope (HRTEM), photoluminescence (PL) spectroscopy and vibrating sample magnetometer (VSM) analysis. The X-rays diffraction confirms the amorphous nature of the glass while the HRTEM analysis reveals the presence of nickel nanoparticles in the glass samples. High-resolution TEM reveals that the lattice spacing of nickel nanoparticles is 0.35 nm at (100) plane. Photoluminescence emission shows the existence of four peaks that correspond to the transition from the upper level of {sup 4}G{sub 5/2} to the lower level of {sup 6}H{sub 5/2}, {sup 6}H{sub 7/2}, {sup 6}H{sub 9/2,} and {sup 6}H{sub 11/2.} It is observed that all peaks experience significant quenching effect with the increasing concentration of nickel nanoparticles, suggesting a strong energy transfer from excited samarium ions to the nickel ions. The glass magnetization and susceptibility at 12 kOe at room temperature are found to be in the range of (3.87±0.17×10{sup −2}–7.19±0.39×10{sup −2}) emu/g and (3.24±0.16×10{sup −6}–5.99±0.29×10{sup −6}) emu/Oe g respectively. The obtained hysteresis curve indicates that the glass samples are paramagnetic materials. The studied glass can be further used towards the development of magneto-optical functional glass. - Highlights: • Sm{sup 3+} doped zinc phosphate glass embedded with Ni NPs has been prepared. • The Laue pattern and lattice spacing of Ni NPs are confirmed by HRTEM image. • The magnetic response of glasses has been studied through VSM analysis. • Enhancement factor and decay half-lifetime are investigated.

  7. Treatment of bone pain secondary to metastases using samarium-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Elba Cristina Sá de Camargo Etchebehere

    Full Text Available CONTEXT: More than 50% of patients with prostate, breast or lung cancer will develop painful bone metastases. The purpose of treating bone metastases is to relieve pain, reduce the use of steroids and to maintain motion. OBJECTIVE: To evaluate the use of samarium-153-EDTMP (153Sm-EDTMP for the treatment of bone pain secondary to metastases that is refractory to clinical management. TYPE OF STUDY: Retrospective. SETTING: Division of Nuclear Medicine, Universidade Estadual de Campinas (Unicamp. METHODS: Fifty-eight patients were studied (34 males with mean age 62 years; 31 patients had prostate cancer, 20 had breast cancer, three had lung cancer, one had lung hemangioendothelioma, one had parathyroid adenocarcinoma, one had osteosarcoma and one had an unknown primary tumor. All patients had multiple bone metastases demonstrated by bone scintigraphy using 99mTc-MDP,and were treated with 153Sm-EDTMP. Response to treatment was graded as good (pain reduction of 50-100%, intermediate (25-49% and poor (0-24%. RESULTS: All patients showed good uptake of 153Sm-EDTMP by bone metastases. Among the patients with prostate cancer, intermediate or good response to therapy occurred in 80.6% (25 patients and poor response in 19.4% (6. Among the patients with breast cancer, 85% (17 showed intermediate or good response to therapy while 15% (3 showed poor response. All three patients with lung cancer showed poor response to treatment. The lung hemangioendothelioma and unknown primary lesion patients showed intermediate response to treatment; the osteosarcoma and parathyroid adenocarcinoma patients showed good response to treatment. No significant myelotoxicity occurred. DISCUSSION: Pain control is important for improving the quality of life of patients with advanced cancers. The mechanism by which pain is relieved with the use of radionuclides is still not yet completely understood, however, the treatment is simple and provides a low risk of mielotoxicity

  8. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  9. Measurement Limits to 134Cs Concentration in Soil

    OpenAIRE

    Ahn, J K; Kim, J.S.; Lee, H. M.; Kim, T H; Park, J. N.; Kang, Y. S.; Lee, H. S.; Kim, S.J.; Park, J Y; Ryu, S.Y.; Kim, H. Ch.; Kang, W. G.; Kim, S. K.

    2009-01-01

    We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134Cs, we have used the ammonium molybdophosphase (AMP) precipitation method to get rid of the 40K existing in natural radioactivity, which reduces the MDA activity about ten times smaller than those without the AMP precipitation method. The MDA results for the 134...

  10. Effect of Current Density on Thermodynamic Properties of Nanocrystalline Palladium Capped Samarium Hydride Thin Film Switchable Mirrors

    Directory of Open Access Journals (Sweden)

    Pushpendra Kumar

    2007-01-01

    Full Text Available A 55 nm samarium film capped with a 10 nm palladium overlayer switched from a metallic reflecting to a semiconducting, transparent in visible state during ex-situ hydrogen loading via electrochemical means in 1 M KOH electrolytic aqueous solution at room temperature. The switching between metal to semiconductor was accompanied by measurement of transmittance during hydrogen loading/unloading. The effect of current density on switching and thermodynamic properties was studied between dihydride state (FCC phase and trihydride state (hexagonal phase. From the plateau of partial pressure of hydrogen at x=2.6, enthalpy of formation was calculated at different current densities. The diffusion coefficients and switching kinetics are shown to depend on applied current density.

  11. Targeted bone marrow radioablation with 153Samarium-lexidronam promotes allogeneic hematopoietic chimerism and donor-specific immunologic hyporesponsiveness.

    Science.gov (United States)

    Inverardi, Luca; Linetsky, Elina; Pileggi, Antonello; Molano, R Damaris; Serafini, Aldo; Paganelli, Giovanni; Ricordi, Camillo

    2004-03-15

    Transplantation tolerance, defined as acceptance of a graft by an otherwise fully immunocompetent host, has been an elusive goal. Although robust tolerance has been achieved by the induction of stable hematopoietic chimerism after bone marrow transplantation, lethal or sublethal radiation conditioning used to induce long-term chimerism precludes its clinical use. We studied whether targeted delivery of radiation to bone marrow could allow for bone marrow cell (BMC) engraftment, chimerism, and donor-specific tolerance in the absence of the side effects associated with external irradiation. We administered a radioactive bone-seeking compound (Samarium-Lexidronam, Quadramet, Berlex Laboratories, Wayne, NJ) together with transient T-cell costimulatory blockade to recipient mice. Allogeneic BMCs were given 7 or 14 days after preconditioning. Costimulatory blockade was obtained by the use of an anti-CD154 antibody for 4 weeks. Chimerism was assessed by flow cytometry. Mice then received donor-specific and third-party skin grafts. Graft survival was analyzed with mechanisms of donor-specific hyporesponsiveness. High levels of stable chimerism across an allogeneic barrier were achieved in mice by a single administration of Samarium-Lexidronam, transient T-cell costimulatory blockade, and BMC transplantation. A large percentage of chimeric animals retained donor-derived skin grafts for more than 120 days without requiring additional immunosuppression, suggesting that harsh cytotoxic preconditioning is not necessary to achieve stable chimerism and donor specific hyporesponsiveness. Analysis of the T-cell repertoire in chimeras indicates T-cell deletional mechanisms. These data broaden the potential use of BMC transplantation for tolerance induction and argue for its potential in treating autoimmune diseases.

  12. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  13. 19 CFR 134.54 - Articles released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54 Section 134.54 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... released from Customs custody. (a) Demand for liquidated damages. If within 30 days from the date of the...

  14. 42 CFR 84.134 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...

  15. 49 CFR 572.134 - Thorax assembly and test procedure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Thorax assembly and test procedure. 572.134... Hybrid III 5th Percentile Female Test Dummy, Alpha Version § 572.134 Thorax assembly and test procedure. (a) Thorax (Upper Torso) Assembly (refer to § 572.130(a)(1)(iii)). The thorax consists of the part of...

  16. 27 CFR 27.134 - Proprietors of qualified premises.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Proprietors of qualified premises. 27.134 Section 27.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... premises. (72 Stat. 1342, 1361, 1395; 26 U.S.C. 5114, 5207, 5555) Filing and Retention of Records and...

  17. 21 CFR 133.134 - Cream cheese with other foods.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cream cheese with other foods. 133.134 Section 133.134 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...) Enzymes of animal, plant, or microbial origin may be declared as “enzymes”; and (2) The dairy ingredients...

  18. 19 CFR 134.13 - Imported articles repacked or manipulated.

    Science.gov (United States)

    2010-04-01

    ...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.13 Imported articles... marked with the name of the country of origin at the time the article is withdrawn for consumption unless... 19 Customs Duties 1 2010-04-01 2010-04-01 false Imported articles repacked or manipulated. 134.13...

  19. 19 CFR 134.45 - Approved markings of country name.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.45 Approved markings of country name. (a) Language. (1) Except as otherwise provided in paragraph (a)(2) of... 19 Customs Duties 1 2010-04-01 2010-04-01 false Approved markings of country name. 134.45 Section...

  20. 21 CFR 145.134 - Canned preserved figs.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned preserved figs. 145.134 Section 145.134 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD... this section, to which citric acid or lemon juice or concentrated lemon juice is added, if necessary...

  1. 19 CFR 134.35 - Articles substantially changed by manufacture.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.35 Articles substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in the...

  2. 19 CFR 134.43 - Methods of marking specific articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...

  3. 21 CFR 211.134 - Drug product inspection.

    Science.gov (United States)

    2010-04-01

    ... representative sample of units shall be collected at the completion of finishing operations and shall be visually... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drug product inspection. 211.134 Section 211.134 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS...

  4. 40 CFR 417.134 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Pretreatment standards for existing sources. 417.134 Section 417.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Chlorosulfonic...

  5. 40 CFR 86.134-96 - Running loss test.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...

  6. Crystal growth of semiorganic complex- samarium chloride coordinated thiourea-L-tartaric acid and its studies on structure and optical characteristics

    Science.gov (United States)

    Slathia, Goldy; Singh, Harjinder; Ramya, E.; Rao, D. Narayana; Bamzai, K. K.

    2017-05-01

    The semi-organic complex of samarium chloride coordinated thiourea-L-tartaric acid (SCTLT) has been grown as a single crystal by slow evaporation technique at room temperature. For structural studies, the grown crystal was subjected to single crystal X-ray diffraction and Fourier transform infra-red (FTIR) spectroscopy. Low cut off wavelength and transparent characteristics were explored by UV-VIS optical characterization. Third-order nonlinear optical properties of grown crystal were investigated by Z-scan technique.

  7. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J.C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  8. Trace amounts of rare earth elements in high purity samarium oxide by sector field inductively coupled plasma mass spectrometry after separation by HPLC

    Energy Technology Data Exchange (ETDEWEB)

    Pedreira, W.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil) and Fundacao Jorge Duprat Figueiredo de Seguranca e Medicina do Trabalho (FUNDACENTRO), 05409-002 Sao Paulo, SP (Brazil)]. E-mail: walter.pedreira@fundacentro.gov.br; Queiroz, C.A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Abrao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Rocha, S.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Vasconcellos, M.E. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Boaventura, G.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil); Pimentel, M.M. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil)

    2006-07-20

    Today there is an increasing need for high purity rare earth compounds in various fields, the optical, the electronics, the ceramic, the nuclear and geochemistry. Samarium oxide has special uses in glass, phosphors, lasers and thermoelectric devices. Calcium chloride crystals treated with samarium have been employed in lasers, which produce light beams intense enough to burn metal. In general, the inductively coupled plasma mass spectrometry (ICP-MS) presents some advantages for trace element analysis, due to high sensitivity and resolution, when compared with other analytical techniques such as ICP optical emission spectrometry (ICP-OES). In this work, sector field inductively coupled plasma mass spectrometry was used. Sixteen elements (Sc, Y and 14 lanthanides) were determined selectively with the ICP-MS system using a concentration gradient method. The detection limits with the ICP-MS system were about 0.2 (La) pg mL{sup -1} to 8 (Gd) pg mL{sup -1}. The %R.S.D. of the methods varying between 0.9 and 1.5% for a set of five (n = 5) replicates was found for the IPEN's material and for the certificate reference sample. Determination of trace REEs in two high pure samarium oxides samples (IPEN and JMC) was performed. IPEN's material is highly pure (>99.99%) and was successfully analyzed without spectral interference (MO{sup +} and MOH{sup +})

  9. A frozen spin polarized target for S134

    CERN Multimedia

    1974-01-01

    The CERN-ETH, Zurich-Helsinki-Imperial College-Southampton Collaboration used a frozen spin polarized target together with the ETH spectrometer magnet to study spin effects (S134). Beam was d31 in South Hall

  10. Synthesis and antimicrobial activity of styryl/pyrrolyl/pyrazolyl sulfonylmethyl-1,3,4-oxadiazolyl amines and styryl/pyrrolyl/pyrazolyl sulfonylmethyl-1,3,4-thiadiazolyl amines.

    Science.gov (United States)

    Sravya, G; Yamini, G; Padmavathi, V; Padmaja, A

    2016-10-21

    A new class of mono and bis heterocycles - styryl sulfonylmethyl-1,3,4-oxadiazolyl/1,3,4-thiadiazolyl amines, pyrrolyl sulfonylmethyl-1,3,4-oxadiazolyl/1,3,4-thiadiazolyl amines and pyrazolyl sulfonylmethyl-1,3,4-oxadiazolyl/1,3,4-thiadiazolyl amines were prepared from the synthetic intermediate Z-styrylsulfonylacetic acid adopting simple and well versed synthetic methodologies and studied their antimicrobial activity. Amongst all the tested compounds styryl thiadiazole 5c exhibited promising antimicrobial activity against Pseudomonas aeruginosa and Penicillium chrysogenum. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  11. Effectiveness of radiation synovectomy with samarium-{sup 153} particulate hydroxyapatite in rheumatoid arthritis patients with knee synovitis: a controlled randomized double-blind trial

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Marla Francisca dos; Furtado, Rita Nely Vilar; Konai, Monique Sayuri; Natour, Jamil, E-mail: jnatour@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Reumatologia; Castiglioni, Mario Luiz Vieira; Marchetti, Renata Rosa [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Medicina Nuclear

    2009-07-01

    Objectives: the aim of the present study was to investigate the effectiveness of Samarium{sup 153}-particulate hydroxyapatite radiation synovectomy in rheumatoid arthritis patients with chronic knee synovitis. Methods: fifty-eight rheumatoid arthritis patients (60 knees) with chronic knee synovitis participated in a controlled double-blinded trial. Patients were randomized to receive either an intra-articular injection with 40 mg triamcinolone hexacetonide alone (TH group) or 40 mg triamcinolone hexacetonide combined with 15 mCi Samarium{sup 153}-particulate hydroxyapatite (Sm/TH group). Blinded examination at baseline (T0) and at 1 (T1), 4 (T4), 12 (T12), 32 (T32), and 48 (T48) weeks post-intervention were performed on all patients and included a visual analog scale for joint pain and swelling as well as data on morning stiffness, flexion, extension, knee circumference, Likert scale of improvement, percentage of improvement, SF-36 generic quality of life questionnaire, Stanford Health Assessment Questionnaire (HAQ), Lequesne index, use of non-steroidal anti-inflammatory drugs or oral corticosteroids, events and adverse effects, calls to the physician, and hospital visits. Results: the sample was homogeneous at baseline, and there were no withdrawals. Improvement was observed in both groups in relation to T0, but no statistically significant differences between groups were observed regarding all variables at the time points studied. The Sm/TH group exhibited more adverse effects at T1 (p<0.05), but these were mild and transitory. No severe adverse effects were reported during follow-up. Conclusion: intra-articular injection of Samarium{sup 153}-particulate hydroxyapatite (15 mCi) with 40 mg of triamcinolone hexacetonide is not superior to triamcinolone hexacetonide alone for the treatment of knee synovitis in patients with rheumatoid arthritis at 1 y of follow-up. (author)

  12. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  13. Neutron Activated Samarium-153 Microparticles for Transarterial Radioembolization of Liver Tumour with Post-Procedure Imaging Capabilities

    Science.gov (United States)

    Hashikin, Nurul Ab. Aziz; Yeong, Chai-Hong; Abdullah, Basri Johan Jeet; Ng, Kwan-Hoong; Chung, Lip-Yong; Dahalan, Rehir; Perkins, Alan Christopher

    2015-01-01

    Introduction Samarium-153 (153Sm) styrene divinylbenzene microparticles were developed as a surrogate for Yttrium-90 (90Y) microspheres in liver radioembolization therapy. Unlike the pure beta emitter 90Y, 153Sm possess both therapeutic beta and diagnostic gamma radiations, making it possible for post-procedure imaging following therapy. Methods The microparticles were prepared using commercially available cation exchange resin, Amberlite IR-120 H+ (620–830 μm), which were reduced to 20–40 μm via ball mill grinding and sieve separation. The microparticles were labelled with 152Sm via ion exchange process with 152SmCl3, prior to neutron activation to produce radioactive 153Sm through 152Sm(n,γ)153Sm reaction. Therapeutic activity of 3 GBq was referred based on the recommended activity used in 90Y-microspheres therapy. The samples were irradiated in 1.494 x 1012 n.cm-2.s-1 neutron flux for 6 h to achieve the nominal activity of 3.1 GBq.g-1. Physicochemical characterisation of the microparticles, gamma spectrometry, and in vitro radiolabelling studies were carried out to study the performance and stability of the microparticles. Results Fourier Transform Infrared (FTIR) spectroscopy of the Amberlite IR-120 resins showed unaffected functional groups, following size reduction of the beads. However, as shown by the electron microscope, the microparticles were irregular in shape. The radioactivity achieved after 6 h neutron activation was 3.104 ± 0.029 GBq. The specific activity per microparticle was 53.855 ± 0.503 Bq. Gamma spectrometry and elemental analysis showed no radioactive impurities in the samples. Radiolabelling efficiencies of 153Sm-Amberlite in distilled water and blood plasma over 48 h were excellent and higher than 95%. Conclusion The laboratory work revealed that the 153Sm-Amberlite microparticles demonstrated superior characteristics for potential use in hepatic radioembolization. PMID:26382059

  14. Isovector states in /sup 128-134/Ba

    Energy Technology Data Exchange (ETDEWEB)

    Harter, H.; Lipas, P.O.; Nojarov, R.; Taigel, T.; Faessler, A.

    1988-04-28

    Phenomenological IBA-2 and microscopic QRPA are applied to predict isovector, or mixed-symmetry, states in /sup 128-134/Ba. The lowest 1/sup +/ state is found at 2.6-3.2 MeV with B(M1)arrow up approx. = 0.1-0.4 ..mu../sub N//sup 2/. IBA predictions are also given for the lowest mixed 2/sup +/ state at 2.2-2.7 MeV. A very strong (up to 5 ..mu../sub N//sup 2/) 1/sup +/ doublet is predicted (QRPA) at 4.7 MeV in /sup 130-134/Ba.

  15. 25 CFR 134.5 - Payments to disbursing officer.

    Science.gov (United States)

    2010-04-01

    ... Service having jurisdiction over the irrigation system under which the land for which payment is made may... constructing irrigation systems toward which reimbursement shall have been made. ... CONSTRUCTION CHARGES ON INDIAN IRRIGATION PROJECTS § 134.5 Payments to disbursing officer. Payments under this...

  16. 19 CFR 134.32 - General exceptions to marking requirements.

    Science.gov (United States)

    2010-04-01

    ...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.32 General exceptions to marking requirements. The articles described or meeting the specified conditions set forth...): (a) Articles that are incapable of being marked; (b) Articles that cannot be marked prior to shipment...

  17. 19 CFR 134.52 - Certificate of marking.

    Science.gov (United States)

    2010-04-01

    ... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.52 Certificate of marking. (a) Applicability. Port directors may accept certificates of marking supported by samples of articles required to be... provision of § 141.20 of this chapter, to certify that marking of the country of origin on imported articles...

  18. 19 CFR 134.41 - Methods and manner of marking.

    Science.gov (United States)

    2010-04-01

    ... THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.41... example, it is suggested that the country of origin on metal articles be die sunk, molded in or etched; on... amended (19 U.S.C. 1304), requires that the marking of the country of origin be legible, indelible, and...

  19. 19 CFR 134.11 - Country of origin marking required.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.11 Country of origin... English name of the country of origin of the article, at the time of importation into the Customs... of the country of origin of the article unless the container is also excepted from marking. ...

  20. 19 CFR 134.14 - Articles usually combined.

    Science.gov (United States)

    2010-04-01

    ... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a... indicating the country of origin of the article appears in a place on the article so that the name will be.... (b) Example. Labels and similar articles so marked that the name of the country of origin of the...

  1. Measurement limits to 134Cs concentration in soil.

    Science.gov (United States)

    Ahn, J K; Kim, J S; Lee, H M; Kim, H; Kim, T H; Park, J N; Kang, Y S; Lee, H S; Kim, S J; Park, J Y; Ryu, S Y; Kim, H-Ch; Kang, W G; Kim, S K

    2011-09-01

    We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the (134)Cs. In order to lower the minimum detectable amount (MDA) of activity for the (134)Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the (40)K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the (134)Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the (134)Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. Copyright © 2011 Elsevier Ltd. All rights reserved.

  2. 134.pdf | jul252009 | currsci | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; currsci; jul252009; 134.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Associates – 2017. Posted on 30 August 2017. Click here to see the list · 28th Mid Year Meeting. Posted on ...

  3. 38 CFR 21.134 - Limitation on flight training.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Limitation on flight.... Chapter 31 Educational and Vocational Training Services § 21.134 Limitation on flight training. Flight... that include required flight training. This type of training is otherwise subject to the same...

  4. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  5. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  6. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints.

    Science.gov (United States)

    Najeeb Al Hallak, Mohammed; McCurdy, Matt; Zouain, Nicolas; Hayes, Justin

    2009-08-28

    (153)Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate) and Samarium-153 [1]. (153)Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of (153)Sm-EDTMP leads to contamination with (154)Eu (Europium-154) [2]. A previous study only alluded to the retention of (154)Eu in the bones after receiving treatment with (153)Sm-EDTMP [2]. Activation of the alarm at security checkpoints after (153)Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received (153)Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA) activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing the American-Canadian border. We assume that the (154)Eu which remained in the patients' bones activated the sensors. METHODS: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received (153)Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. RESULTS: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of (154)Eu emissions. CONCLUSION: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of (154)Eu retained in patients who received (153)Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of (153)Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with (153)Sm-EDTMP at Roger Maris Cancer

  7. Formation of a new adduct based on fullerene tris-malonate samarium salt C60-[C60(=C(COO)2)3]Sm2

    Science.gov (United States)

    Petrov, A. A.; Keskinov, V. A.; Semenov, K. N.; Charykov, N. A.; Letenko, D. G.; Nikitin, V. A.

    2017-03-01

    Gram quantities of a new adduct based on light fullerene tris-malonate samarium salt C60 [C60(=C(COO)2)3]Sm2 are obtained via the reaction of ion exchange. The obtained adduct is studied by means of electron and infrared spectroscopy, X-ray and elemental analysis, electron microscopy, and thermogravimetry. The polythermal solubility of [C60(=C(COO)2)3]Sm2 in water is determined in ampoules via saturation within 20-70°C. The composition of crystalline hydrate [C60(=C(COO)2)3]Sm2 · 36H2O, which exists in equilibrium with the saturated solution, is estimated.

  8. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  9. Marrow irradiation with high-dose 153Samarium-EDTMP followed by chemotherapy and hematopoietic stem cell infusion for acute myelogenous leukemia.

    Science.gov (United States)

    Rodriguez, Vilmarie; Anderson, Peter M; Litzow, Mark R; Erlandson, Linda; Trotz, Barbara A; Arndt, Carola A S; Khan, Shakila P; Wiseman, Gregory A

    2006-08-01

    In four patients, aged 15 - 20 years, with high-risk acute myeloid leukemia (AML), high-dose samarium 153-labelled ethylenediaminetetramethylenephosphonate (153Sm-EDTMP) was used for targeted marrow irradiation before preparative chemotherapy conditioning regimens and allogeneic (three patients) or autologous (one patient) hematopoietic stem cell transplantation. The dose of 153Sm-EDTMP was 703 MBq/kg (n = 1) or 1110 MBq/kg (n = 3). No side-effects occurred during the 30-min infusion of 153Sm-EDTMP. Samarium - melphalan regimens were given to three patients; one had 153Sm-EDTMP - busulfan + cyclophosphamide. Total body radioactivity was below the 133 MBq safe limit before infusion of stem cells (day 14 after 153Sm-EDTMP). No hemorrhagic cystitis, nephrotoxicity or serious infections occurred. Leukocyte engraftment (white blood cell count >0.5 x 10(9)/l) occurred between 12 and 23 days after stem cell infusion (mean of 17 days). Complete cytogenetic and morphologic remission of AML was evident on follow-up marrow aspirate and biopsy specimens from all patients. In two of the four study patients, the disease remains in complete remission and the patients have an excellent quality of life (Eastern Cooperative Oncology Group performance status 0; no medications) and no organ toxicity more than 2 years and more than 4 years, respectively, after their blood and bone marrow transplantations. Thus, in adolescents and adults, 153Sm-EDTMP may provide a relatively simple and effective means for using irradiation to eliminate AML within the marrow.

  10. 27 CFR 19.134 - Bonded warehouses not on premises qualified for production of spirits.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bonded warehouses not on premises qualified for production of spirits. 19.134 Section 19.134 Alcohol, Tobacco Products and Firearms... Location and Use § 19.134 Bonded warehouses not on premises qualified for production of spirits. (a...

  11. 42 CFR 137.134 - When does the 45 day review period begin?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false When does the 45 day review period begin? 137.134 Section 137.134 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137.134 When does...

  12. 13 CFR 134.714 - When must the Judge issue his or her decision?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...) Protests § 134.714 When must the Judge issue his or her decision? The Judge shall issue a decision, insofar...

  13. 40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...

  14. 19 CFR 134.24 - Containers or holders not designed for or capable of reuse.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Containers or holders not designed for or capable of reuse. 134.24 Section 134.24 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... § 134.24 Containers or holders not designed for or capable of reuse. (a) Containers ordinarily discarded...

  15. 28 CFR 13.4 - Procedures: Responsibilities of the Attorney General.

    Science.gov (United States)

    2010-07-01

    ... Attorney General. 13.4 Section 13.4 Judicial Administration DEPARTMENT OF JUSTICE ATOMIC WEAPONS AND SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.4 Procedures: Responsibilities of the Attorney General. When a submission is made to the Department of Justice for a reward under the Atomic Weapons and...

  16. Idiopathic urolithiasis in Tunisian children: A report of 134 cases

    Directory of Open Access Journals (Sweden)

    A Alaya

    2013-01-01

    Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.

  17. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  18. [Unusual localization of echinococcosis in Cukurova (134 cases)].

    Science.gov (United States)

    Hakverdi, Sibel; Sayar, Hamide; Yaldiz, Mehmet; Erdoğan, Seyda; Akansu, Bülent; Canda, M Serefettin

    2009-01-01

    Echinococcosis is a parasitic disease frequently occurring in societies where agriculture and raising animals are common. In Turkey, it is more commonly observed in eastern and middle Anatolia and in Marmara and Trakya regions. While there is a high rate of occurrence in the liver and lungs, Echinococcosis can occasionally be present in other tissues and organs. In this study which was carried out in the Cukurova region, we found 962 echinococcosis cases in a ten year period. Of these, 134 (13.9%) were located outside the liver and the lung. Our aim was to determine the rate of unusual location of echinococcosis cases in our region and draw attention to the issue.

  19. BeppoSAX observations of PKS 0528+134

    Energy Technology Data Exchange (ETDEWEB)

    Ghisellini, G.; Tagliaferri, G.; Costamante, L.; Maraschi, L.; Celotti, A.; Fossati, G.; Bassani, L.; Cappi, M.; Frontera, F.; Pian, E.; Comastri, A.; Cavallone, M.; De Francesco, G.; Lanteri, L.; Raiteri, C.M.; Sobrito, G.; Villata, M.; Giarrusso, S.; Sacco, B.; Glass, I.S.; Grandi, P.; Massaro, E.; Molendi, S.; Padovani, P.; Palumbo, G.G.C.; Perola, C.; Salvati, M.; Treves, A

    1999-01-01

    We report on the BeppoSAX observations of the {gamma}-ray blazar PKS 0528+134 performed in Feb and Mar 1997, during a multiwavelength campaign involving EGRET and ground based telescopes. The source was in a faint and hard state, with energy spectral index {alpha} = 0.48 {+-} 0.04 between 0.1 and 10 keV, and keV flux of 2.7 x 10{sup -12} erg cm{sup -2} s{sup -1}. No significant variability was observed. The source was detected in the 20-120 keV band by the PDS, with a flux lying slightly above the extrapolation from lower X-ray energies. Comparing this low state with previous higher states of the source, there is an indication that the X-ray spectrum hardens and the {gamma}-ray spectrum steepens when the source is fainter.

  20. Regioselective synthesis of 2-amino-substituted 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives via reagent-based cyclization of thiosemicarbazide intermediate.

    Science.gov (United States)

    Yang, Seung-Ju; Lee, Seok-Hyeong; Kwak, Hyun-Jung; Gong, Young-Dae

    2013-01-18

    A regioselective, reagent-based method for the cyclization reaction of 2-amino-1,3,4-oxadiazole and 2-amino-1,3,4-thiadiazole core skeletons is described. The thiosemicarbazide intermediate 3 was reacted with EDC·HCl in DMSO or p-TsCl, triethylamine in N-methyl-2-pyrrolidone to give the corresponding 2-amino-1,3,4-oxadiazoles 4 and 2-amino-1,3,4-thiadiazoles 5 through regioselcective cyclization processes. The regioselectivity was affected by both R(1) and R(2) in p-TsCl mediated cyclization. It is shown in select sets of thiosemicarbazide 3 with R(1)(benzyl) and R(2)(phenyl). 2-Amino-1,3,4-oxadiazole 4 was also shown in the reaction of p-TsCl mediated cyclization. The resulting 2-amino-1,3,4-oxadiazole and 2-amino-1,3,4-thiadiazole core skeleton are functionalized with various electrophiles such as alkyl halide, acid halides, and sulfornyl chloride in high yields.

  1. 46 CFR 134.180 - Piping for fire-main suction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Piping for fire-main suction. 134.180 Section 134.180... FOR LIFTBOATS § 134.180 Piping for fire-main suction. (a) Except as provided by paragraph (b) of this section, suction lines must comply with § 132.110 of this subchapter. (b) Suction lines that extend below...

  2. Pyrolysis result of polyethylene waste as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-02-01

    In this research, the result of pyrolysis on polyethylene was used as fuel for a solid oxide fuel cell (SOFC). The pyrolysis result is a liquid which consists of hydrocarbon chains. According to GC-MS analysis, the hydrocarbons mainly consist of C7 to C20 hydrocarbon chain. Then, the liquid was applied to a single cell of NSDC-L | NSDC | NSDC-L. NSDC is a composite SDC (samarium doped-ceria) with sodium carbonate. Meanwhile, NSDC-L is a composite of NSDC with LiNiCuO (LNC). NSDC and LNC were analyzed by X-ray diffraction to understand their crystal structure. The result shows that presence of carbonate did not change the crystal structure of SDC. SEM EDX analysis for fuel cell before and after being loaded with polyethylene oil to get information of element diffusion to the electrolyte. Meanwhile, the conductivity properties were investigated through impedance measurement. The presence of carbonate even increases the electrical conductivity. The single cell test with the pyrolysis result of polyethylene at 300 - 600 °C, found that the highest power density is at 600 °C with the maximum power density of 0.14 mW/cm2 and open circuit voltage of 0.4 Volt. Elemental analysis at three point spots of single cell NDSC-L |NSDC|NSDC-L found that a migration of ions was occurred during fuel operation at 300 - 600 °C.

  3. Effects of some rare earth and carbonate-based co-dopants on structural and electrical properties of samarium doped ceria (SDC) electrolytes for solid oxide fuel cells

    Science.gov (United States)

    Anwar, Mustafa; Khan, Zuhair S.; Mustafa, Kamal; Rana, Akmal

    2015-09-01

    In the present study, samarium doped ceria (SDC) and SDC-based composite with the addition of K2CO3 were prepared by co-precipitation route and effects of pH of the solution and calcination temperature on microstructure of SDC and SDC-K2CO3, respectively, were investigated. Furthermore, experimentation was performed to investigate into the ionic conductivity of pure SDC by co-doping with yttrium i.e., YSDC, XRD and SEM studies show that the crystallite size and particle size of SDC increases with the increase in pH. The SEM images of all the samples of SDC synthesized at different pH values showed the irregular shaped and dispersed particles. SDC-K2CO3 was calcined at 600∘C, 700∘C and 800∘C for 4 h and XRD results showed that crystallite size increases while lattice strain, decreases with the increase in calcination temperature and no peaks were detected for K2CO3 as it is present in an amorphous form. The ionic conductivity of the electrolytes increases with the increase in temperature and SDC-K2CO3 shows the highest value of ionic conductivity as compared to SDC and YSDC. Chemical compatibility tests were performed between the co-doped electrolyte and lithiated NiO cathode at high temperature. It revealed that the couple could be used up to the temperature of 700∘C.

  4. Calculation of the Dose of Samarium-153-Ethylene Diamine Tetramethylene Phosphonate (153Sm-EDTMP as a Radiopharmaceutical for Pain Relief of bone Metastasis

    Directory of Open Access Journals (Sweden)

    Fatemeh Razghandi

    2016-04-01

    Full Text Available Introduction One of the important applications of nuclear physics in medicine is the use of radioactive elements as radiopharmaceuticals. Metastatic bone disease is the most common form of malignant bone tumors. Samarium-153-ethylene diamine tetramethylene phosphonate (153Sm-EDTMP as a radiopharmaceutical is used for pain palliation. This radiopharmaceutical usually emits beta particles, which have a high uptake in bone tissues. The purpose of this study was to calculate the radiation dose distribution of 153Sm-EDTMP in bone and other tissues, using MCNPX Monte Carlo code in the particle transport model. Materials and Methods Dose delivery to the bone was simulated by seeking radiopharmaceuticals on the bone surface. The phantom model had a simple cylindrical geometry and included bone, bone marrow, and soft tissue. Results The simulation results showed that a significant amount of radiation dose was delivered to the bone by the use of this radiopharmaceutical. Conclusion Thebone acted as a fine protective shield against rays for the bone marrow. Therefore, the trivial absorbed dose by the bone marrow caused less damage to bone-making cells. Also, the high absorbed dose of the bone could destroy cancer cells and relieve the pain in the bone.

  5. Synthesis, quality control and biological evaluation of tris[(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate complex as a therapeutic agent

    Energy Technology Data Exchange (ETDEWEB)

    Naseri, Z.; Kharat, A. Nemati [Tehran Univ. (Iran, Islamic Republic of). Inorganic Chemistry Dept.; Hakimi, A. [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Dept. of Nuclear Engineering, Science and Research Branch; Jalilian, A.R.; Shirvani-Arani, S.; Bahrami-Samani, A.; Ghannadi-Maragheh, M. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (IR). Radiopharmaceutical Research and Development Lab (RRDL)

    2012-07-01

    Therapeutic radiopharmaceuticals are designed to deliver high doses of radiation to selected target organs or tissues with an aim of minimizing unwanted radiation to surrounding healthy tissue. In this work, [tris(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate ({sup 153}Sm-TPTTC) was developed for possible therapeutic properties. The cold compound, i.e. {sup nat}Sm-TPTTC was prepared and characterized by IR, UV, mass and {sup 1}H-NMR spectroscopy. {sup 153}Sm-TPTTC was prepared in two steps using [{sup 153}Sm]SmCl{sub 3}, obtained by neutron activation of an enriched {sup 152}Sm sample. Stability tests, partition coefficient determination, toxicity tests and biodistribution studies of the complex in wild-type and fibrosarcoma-bearing mice were determined. The radiolabeled complex was prepared in high radiochemical purity (> 99% precipitation method) and specific activity of 278 GBq/mmol and demonstrated significant stability at 4, 25 and 37 C (in presence of human serum). Initial complex biodistribution data showed significant liver accumulation in wild-type mice and significant tumor accumulation in fibrosarcoma-bearing mice with tumor:blood and tumor:muscle ratios of 3.55 (2 h) and 38.26 (96 h) respectively. {sup 153}Sm-TPTTC properties suggest an efficient tumor targeting agent with high tumor-avidity. Further investigation on the therapeutic properties must be conducted. (orig.)

  6. Measurement of fission cross-section for 134Te and 134I in 232Th(n,f) reaction induced by 14 MeV neutrons

    Science.gov (United States)

    Zhengwei, Zhang; Shuangtong, Liu; Qiang, Wang; Changlin, Lan; Xingcai, Guan; Caifeng, Lai; Kaihong, Fang

    2017-12-01

    The fission cross-sections of the 232Th(n,f)134Te and 232Th(n,f)134I reactions induced by neutrons around 14 MeV were measured by the neutron activation and off-line gamma ray technique. The neutron fluence was monitored on line using the accompanying α-particles from the T(d,n)α reaction, meanwhile, neutron energies were obtained from the cross-section ratio method of 90Zr(n,2 n)89(m+g)Zr to 93Nb(n,2 n)92 mNb reactions. The experimentally determined 232Th(n,f)134Te reaction cross-sections are 9.57±0.47 mb at En=14.1±0.3 MeV, 10.0±0.5 mb at En=14.5±0.3 MeV and 10.7±0.6 mb at En=14.7±0.3 MeV, respectively. Whereas, the isotope 134I of which characteristic γ-rays were detected in the γ-spectrum was concluded to be originated from 134Te decay. According to the cascade deduction formulism, the cross-section of 232Th(n,f)134I was estimated to be below a value ( 5.7×10-3 mb) refered to the Minimal Detectable Activity (MDA) with the gamma measurements.

  7. 13 CFR 134.407 - Evidence beyond the record and discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...

  8. 13 CFR 134.314 - Standard of review and burden of proof.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Standard of review and burden of proof. 134.314 Section 134.314 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... law. The appellant has the burden of proof, by a preponderance of the evidence, in both size and NAICS...

  9. 13 CFR 134.103 - Rules applicable to time periods provided in this part.

    Science.gov (United States)

    2010-01-01

    ... Rules applicable to time periods provided in this part. (a) The day from which the time period is... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Rules applicable to time periods provided in this part. 134.103 Section 134.103 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  10. 76 FR 10328 - Approval of Manufacturing Authority, Foreign-Trade Zone 134, Volkswagen Group of America...

    Science.gov (United States)

    2011-02-24

    ... Foreign-Trade Zones Board Approval of Manufacturing Authority, Foreign-Trade Zone 134, Volkswagen Group of... of FTZ 134, has requested manufacturing authority on behalf of Volkswagen Group of America... behalf of Volkswagen Group of America Chattanooga Operations, LLC, as described in the application and...

  11. Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.

    Science.gov (United States)

    Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin

    2017-01-01

    The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  12. 13 CFR 134.514 - When must the Judge issue his or her decision?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.514 Section 134.514 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... issue his or her decision? The Judge shall issue a decision, insofar as practicable, within 15 business...

  13. 19 CFR 134.44 - Location and other acceptable methods of marking.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.44 Location and other acceptable methods of marking. (a) Other acceptable methods. Except for articles described in § 134.43 of this part or the subject of a ruling by the Commissioner of...

  14. 19 CFR 134.23 - Containers or holders designed for or capable of reuse.

    Science.gov (United States)

    2010-04-01

    ... reuse. 134.23 Section 134.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... Containers or holders designed for or capable of reuse. (a) Usual and ordinary reusable containers or holders... capable of reuse after the contents have been consumed, whether imported full or empty, must be...

  15. 13 CFR 134.602 - Under what circumstances may I apply for reimbursement?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Under what circumstances may I apply for reimbursement? 134.602 Section 134.602 Business Credit and Assistance SMALL BUSINESS... proceeding that is sufficiently significant and discrete to merit treatment as a separate unit; or (c) A...

  16. 13 CFR 134.607 - How do I know which eligibility requirement applies to me?

    Science.gov (United States)

    2010-01-01

    ..., association, organization, or unit of local government (3) Business net worth may not exceed 7 million dollars... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How do I know which eligibility requirement applies to me? 134.607 Section 134.607 Business Credit and Assistance SMALL BUSINESS...

  17. DFT and TD-DFT study of isomeric 5-(pyridyl)-1,3,4-oxadiazol-2-thiones and 2-methylthio-5-(pyridyl)-1,3,4-oxadiazoles

    Science.gov (United States)

    Eshimbetov, Alisher G.; Tojiyev, Ibodulla F.; Ziyaev, Abdukhakim A.

    2017-12-01

    Internal rotations of pyridine fragment around single bond of isomeric 5-(2‧, 3‧ and 4‧-pyridyl)-1,3,4-oxadiazol-2-thiones and 2-methylthio-5-(2‧, 3‧ and 4‧-pyridyl)-1,3,4-oxadiazoles have been performed by DFT (B3LYP) and MP2 methods with RHF/6-31G(d,p) basis set. It was found that the MP2 barrier height lies a few below than DFT barrier heights for all studied compounds. In the molecule of 2-methylthio-5-(2‧-pyridyl)-1,3,4-oxadiazole an anomeric effect detected due to a lone pair-lone pair interaction of pyridine and N4 oxadiazole nitrogen atoms. But it not found in the molecule of 5-(2‧-pyridyl)-1,3,4-oxadiazol-2-thione. Furthermore, theoretical UV spectra of the compounds were studied using TD-DFT/6-31G(d,p) method. Theoretical transitions located about 10 nm in the long-wavelength region relatively to the experimental bands field. Whereas, the theoretical transitions of 2-methylthio-5-(2‧, 3‧ and 4‧-pyridyl)-1,3,4-oxadiazoles have very good agreement with the position of experimental bands. The longest wavelength band in both of experimental and theoretical spectra of the investigated compounds have been observed for 5-(4‧-pyridyl)-1,3,4-oxadiazole-2-thione and 2-methylthio-5-(2‧-pyridyl)-1,3,4-oxadiazole. Furthermore, the longest-wavelength experimental band's position are in good agreement with (r2 = 0.95) the HOMO-LUMO energetic gaps of studied compounds.

  18. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  19. SU-C-201-06: Utility of Quantitative 3D SPECT/CT Imaging in Patient Specific Internal Dosimetry of 153-Samarium with GATE Monte Carlo Package

    Energy Technology Data Exchange (ETDEWEB)

    Fallahpoor, M; Abbasi, M [Tehran University of Medical Sciences, Vali-Asr Hospital, Tehran, Tehran (Iran, Islamic Republic of); Sen, A [University of Houston, Houston, TX (United States); Parach, A [Shahid Sadoughi University of Medical Sciences, Yazd, Yazd (Iran, Islamic Republic of); Kalantari, F [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: Patient-specific 3-dimensional (3D) internal dosimetry in targeted radionuclide therapy is essential for efficient treatment. Two major steps to achieve reliable results are: 1) generating quantitative 3D images of radionuclide distribution and attenuation coefficients and 2) using a reliable method for dose calculation based on activity and attenuation map. In this research, internal dosimetry for 153-Samarium (153-Sm) was done by SPECT-CT images coupled GATE Monte Carlo package for internal dosimetry. Methods: A 50 years old woman with bone metastases from breast cancer was prescribed 153-Sm treatment (Gamma: 103keV and beta: 0.81MeV). A SPECT/CT scan was performed with the Siemens Simbia-T scanner. SPECT and CT images were registered using default registration software. SPECT quantification was achieved by compensating for all image degrading factors including body attenuation, Compton scattering and collimator-detector response (CDR). Triple energy window method was used to estimate and eliminate the scattered photons. Iterative ordered-subsets expectation maximization (OSEM) with correction for attenuation and distance-dependent CDR was used for image reconstruction. Bilinear energy mapping is used to convert Hounsfield units in CT image to attenuation map. Organ borders were defined by the itk-SNAP toolkit segmentation on CT image. GATE was then used for internal dose calculation. The Specific Absorbed Fractions (SAFs) and S-values were reported as MIRD schema. Results: The results showed that the largest SAFs and S-values are in osseous organs as expected. S-value for lung is the highest after spine that can be important in 153-Sm therapy. Conclusion: We presented the utility of SPECT-CT images and Monte Carlo for patient-specific dosimetry as a reliable and accurate method. It has several advantages over template-based methods or simplified dose estimation methods. With advent of high speed computers, Monte Carlo can be used for treatment planning

  20. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO2) thin films using electron beam evaporation

    Science.gov (United States)

    Kundu, Subrata; Sutradhar, Narottam; Thangamuthu, R.; Subramanian, B.; Panda, Asit Baran; Jayachandran, M.

    2012-08-01

    Samarium (Sm)-doped cerium oxide (CeO2) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ( 300 or 500 °C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO2 nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO2 nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH4. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO2 thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.

  1. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films using electron beam evaporation

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Subrata, E-mail: skundu@cecri.res.in [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Sutradhar, Narottam [G. B. Marg, Central Salt and Marine Chemical Research Institute - CSIR (India); Thangamuthu, R.; Subramanian, B. [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Panda, Asit Baran [G. B. Marg, Central Salt and Marine Chemical Research Institute (CSIR) (India); Jayachandran, M., E-mail: mjayam54@yahoo.com [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India)

    2012-08-15

    Samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ({approx}300 or 500 Degree-Sign C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO{sub 2} nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO{sub 2} nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH{sub 4}. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO{sub 2} thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.Graphical Abstract.

  2. Strong and selective glomerular localization of CD134 ligand and TNF receptor-1 in proliferative lupus nephritis

    NARCIS (Netherlands)

    Aten, J.; Roos, A.; Claessen, N.; Schilder-Tol, E. J.; ten Berge, I. J.; Weening, J. J.

    2000-01-01

    CD134 (OX40) is a member of the tumor necrosis factor (TNF) receptor (TNFR) family that can be expressed on activated T lymphocytes. Interaction between CD134 and its ligand (CD134L) is involved in costimulation of T and B lymphocyte activation, and in T cell adhesion to endothelium. To examine the

  3. 47 CFR 25.134 - Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal...

    Science.gov (United States)

    2010-10-01

    ... Terminal (VSAT) and C-band Small Aperture Terminal (CSAT) networks. 25.134 Section 25.134 Telecommunication... Applications and Licenses Earth Stations § 25.134 Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal (CSAT) networks. (a)(1) VSAT networks operating in the 12/14 GHz...

  4. File list: ALL.Brs.20.AllAg.MDA-MB-134-VI [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Brs.20.AllAg.MDA-MB-134-VI hg19 All antigens Breast MDA-MB-134-VI SRX355612,SRX...355611,SRX355609,SRX355610 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Brs.20.AllAg.MDA-MB-134-VI.bed ...

  5. File list: InP.Brs.20.AllAg.MDA-MB-134-VI [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Brs.20.AllAg.MDA-MB-134-VI hg19 Input control Breast MDA-MB-134-VI SRX355612,SR...X355610 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.Brs.20.AllAg.MDA-MB-134-VI.bed ...

  6. File list: ALL.Brs.05.AllAg.MDA-MB-134-VI [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Brs.05.AllAg.MDA-MB-134-VI hg19 All antigens Breast MDA-MB-134-VI SRX355612,SRX...355609,SRX355610,SRX355611 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Brs.05.AllAg.MDA-MB-134-VI.bed ...

  7. File list: ALL.Brs.50.AllAg.MDA-MB-134-VI [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Brs.50.AllAg.MDA-MB-134-VI hg19 All antigens Breast MDA-MB-134-VI SRX355612,SRX...355611,SRX355609,SRX355610 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Brs.50.AllAg.MDA-MB-134-VI.bed ...

  8. Comparison of Pre and Post Road Test Ultrasonic Inspection Results on 134 Passenger Tires

    Science.gov (United States)

    1979-11-01

    A study was conducted to compare ultrasonic inspection data from 134 tires prior and subsequent to road tests in order to determine whether excessive tread wear could be related to characteristics detected by the ultrasonic inspection. Analysis of da...

  9. 19 CFR 134.55 - Compensation of Customs officers and employees.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.55... articles so as to exempt them from the application of marking duties shall be computed in accordance with...

  10. 20 CFR 702.134 - Payment of claimant's attorney's fees in disputed claims.

    Science.gov (United States)

    2010-04-01

    ... AND PROCEDURE General Provisions Representation § 702.134 Payment of claimant's attorney's fees in... person, administrative body or court before whom the service was performed, which shall be paid directly...

  11. Measurement of the effective thermal cross section of {sup 134}Cs by triple neutron capture reaction

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Shoji; Harada, Hideo; Katoh, Toshio [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro; Kobayashi, Katsutoshi; Motoishi, Shoji; Tanase, Masakazu

    1998-03-01

    The effective thermal cross section ({sigma}{sub eff}) of the {sup 134}Cs(n,{gamma}){sup 135}Cs reaction was measured by the activation method and the {gamma}-ray spectroscopic method in order to obtain fundamental data for research on the transmutation of nuclear wastes. The effective thermal cross section of the reaction {sup 134}Cs(n,{gamma}){sup 135}Cs was found to be 140.6{+-}8.5 barns. (author)

  12. Crystal structure of monoclinic samarium and cubic europium sesquioxides and bound coherent neutron scattering lengths of the isotopes {sup 154}Sm and {sup 153}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Kohlmann, Holger [Leipzig Univ. (Germany). Inst. of Inorganic Chemistry; Hein, Christina; Kautenburger, Ralf [Saarland Univ., Saarbruecken (Germany). Inorganic Solid State Chemistry; Hansen, Thomas C.; Ritter, Clemens [Institut Laue-Langevin, Grenoble (France); Doyle, Stephen [Karlsruhe Institute of Technology, Eggenstein-Leopoldshafen (Germany). Inst. for Synchrotron Radiation (ISS)

    2016-11-01

    The crystal structures of monoclinic samarium and cubic europium sesquioxide, Sm{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}, were reinvestigated by powder diffraction methods (laboratory X-ray, synchrotron, neutron). Rietveld analysis yields more precise structural parameters than previously known, especially for oxygen atoms. Interatomic distances d(Sm-O) in Sm{sub 2}O{sub 3} range from 226.3(4) to 275.9(2) pm [average 241.6(3) pm] for the monoclinic B type Sm{sub 2}O{sub 3} [space group C2/m, a = 1418.04(3) pm, b = 362.660(7) pm, c = 885.48(2) pm, β = 100.028(1) ], d(Eu-O) in Eu{sub 2}O{sub 3} from 229.9(2) to 238.8(2) pm for the cubic bixbyite (C) type [space group Ia anti 3, a = 1086.87(1) pm]. Neutron diffraction at 50 K and 2 K did not show any sign for magnetic ordering in Sm{sub 2}O{sub 3}. Isotopically enriched {sup 154}Sm{sub 2}O{sub 3} and {sup 153}Eu{sub 2}O{sub 3} were used for the neutron diffraction work because of the enormous absorption cross section of the natural isotopic mixtures for thermal neutrons. The isotopic purity was determined by inductively coupled plasma - mass spectrometry to be 98.9% for {sup 154}Sm and 99.8% for {sup 153}Eu. Advanced analysis of the neutron diffraction data suggest that the bound coherent scattering lengths of {sup 154}Sm and {sup 153}Eu need to be revised. We tentatively propose b{sub c}({sup 154}Sm) = 8.97(6) fm and b{sub c}({sup 153}Eu) = 8.85(3) fm for a neutron wavelength of 186.6 pm to be better values for these isotopes, showing up to 8% deviation from accepted literature values. It is shown that inaccurate scattering lengths may result in severe problems in crystal structure refinements causing erroneous structural details such as occupation parameters, which might be critically linked to physical properties like superconductivity in multinary oxides.

  13. Poplar MYB115 and MYB134 Transcription Factors Regulate Proanthocyanidin Synthesis and Structure.

    Science.gov (United States)

    James, Amy Midori; Ma, Dawei; Mellway, Robin; Gesell, Andreas; Yoshida, Kazuko; Walker, Vincent; Tran, Lan; Stewart, Don; Reichelt, Michael; Suvanto, Jussi; Salminen, Juha-Pekka; Gershenzon, Jonathan; Séguin, Armand; Constabel, C Peter

    2017-05-01

    The accumulation of proanthocyanidins is regulated by a complex of transcription factors composed of R2R3 MYB, basic helix-loop-helix, and WD40 proteins that activate the promoters of biosynthetic genes. In poplar (genus Populus ), MYB134 is known to regulate proanthocyanidin biosynthesis by activating key flavonoid genes. Here, we characterize a second MYB regulator of proanthocyanidins, MYB115. Transgenic poplar overexpressing MYB115 showed a high-proanthocyanidin phenotype and reduced salicinoid accumulation, similar to the effects of MYB134 overexpression. Transcriptomic analysis of MYB115- and MYB134-overexpressing poplar plants identified a set of common up-regulated genes encoding proanthocyanidin biosynthetic enzymes and several novel uncharacterized MYB transcriptional repressors. Transient expression experiments demonstrated the capacity of both MYB134 and MYB115 to activate flavonoid promoters, but only in the presence of a basic helix-loop-helix cofactor. Yeast two-hybrid experiments confirmed the direct interaction of these transcription factors. The unexpected identification of dihydromyricetin in leaf extracts of both MYB115- and MYB134-overexpressing poplar led to the discovery of enhanced flavonoid B-ring hydroxylation and an increased proportion of prodelphinidins in proanthocyanidin of the transgenics. The dramatic hydroxylation phenotype of MYB115 overexpressors is likely due to the up-regulation of both flavonoid 3',5'-hydroxylases and cytochrome b 5 Overall, this work provides new insight into the complexity of the gene regulatory network for proanthocyanidin synthesis in poplar. © 2017 American Society of Plant Biologists. All Rights Reserved.

  14. R134a Flow Boiling Analysis with Modified Thermodynamic Property File of MARS Code

    Energy Technology Data Exchange (ETDEWEB)

    Son, Gyumin; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-10-15

    Previous study showed application of RELAP5 code to solar energy facility with molten salt (60% NaNO3 and 40% KNO3) as working fluid. Based on external experimental correlations, thermodynamic properties of molten salt were evaluated as a function of pressure and temperature and those equations were used to generate tpf. To validate external tpf, experimental values were compared with RELAP5 analysis. In nuclear field, utilization of other fluid is also important since many thermal-hydraulic experiments used various fluids such as FC-72, R123, and R134a. Theses refrigerants have been used to simulate the high pressure environment of nuclear power plants due to their low boiling point, and density ratio between vapor and liquid. Thus, this study aims for tpf generation of R134a and verification by analyzing real case. R134a is selected as a fluid to be implemented and analyzed because it is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. R134a property file were generated with fitted equation using temperature and pressure as variables, originated from external data source. For validation, flow boiling experiment case were made into simplified input. Analysis with tpfr134a showed that application of Gnielinksi correlation could enhance single phase flow accuracy. Large error of HTC from two phase analysis requires parameter study. Future work aims for more specified experimental case comparison and correlation enhancement for two phase analysis.

  15. miR-134 regulates ischemia/reperfusion injury-induced neuronal cell death by regulating CREB signaling.

    Science.gov (United States)

    Huang, Weidong; Liu, Xiaobin; Cao, Jie; Meng, Facai; Li, Min; Chen, Bo; Zhang, Jie

    2015-04-01

    microRNA-134 (miR-134) has been reported to be a brain-specific miRNA and is differently expressed in brain tissues subjected to ischemic injury. However, the underlying mechanism of miR-134 in regulating cerebral ischemic injury remains poorly understood. The current study was designed to delineate the molecular basis of miR-134 in regulating cerebral ischemic injury. Using the oxygen-glucose deprivation (OGD) model of hippocampal neuron ischemia in vitro, we found that the overexpression of miR-134 mediated by recombinant adeno-associated virus (AAV) vector infection significantly promoted neuron death induced by OGD/reoxygenation, whereas the inhibition of miR-134 provided protective effects against OGD/reoxygenation-induced cell death. Moreover, cyclic AMP (cAMP) response element-binding protein (CREB) as a putative target of miR-134 was downregulated and upregulated by miR-134 overexpression or inhibition, respectively. The direct interaction between miR-134 and the 3'-untranslated region (UTR) of CREB mRNA was further confirmed by dual-luciferase reporter assay. Overexpression of miR-134 also inhibited the expression of the downstream gene of CREB, including brain-derived neurotrophic factor (BDNF) and the anti-apoptotic gene Bcl-2, whereas the inhibition of miR-134 upregulated the expression of BDNF and Bcl-2 in neurons after OGD/reoxygenation. Notably, the knockdown of CREB by CREB siRNA apparently abrogated the protective effect of anti-miR-134 on OGD/reoxygenation-induced cell death. Taken together, our study suggests that downregulation of miR-134 alleviates ischemic injury through enhancing CREB expression and downstream genes, providing a promising and potential therapeutic target for cerebral ischemic injury.

  16. Synthesis, characterization, antimicrobial, and pharmacological evaluation of some 2, 5-disubstituted sulfonyl amino 1,3,4-oxadiazole and 2-amino-disubstituted 1,3,4-thiadiazole derivatives

    Directory of Open Access Journals (Sweden)

    Dilipkumar Pal

    2014-01-01

    Full Text Available The presence of heterocyclic structures in diverse types of compounds, this is strongly indicative of the profound effect like structure exerts on physiologic activity, and recognition of this is abundantly reflected in efforts to find useful synthetic drugs. The search for better pharmacological active drug and the importance of disubstituted 1,3,4-oxadiazole and 1,3,4-thiadiazole as active pharmacophores, prompted us to design, synthesize, characterize, and evaluate a series of differently substituted sulfonyl amino 1,3,4-oxadiazole and 1,3,4-thiadiazole for their potential antimicrobial, analgesic and antiinflammatory activity, respectively. New sulfonyl amino 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives were synthesized by intramolecular cyclization of thiosemicarbazide in alkaline medium. Reactions were carried out by the reaction between aromatic carbonyl halide and thiosemicarbazide.

  17. Improvement of Reliability of Compressors for Domestics Refrigerators using HFC134a

    Science.gov (United States)

    Iizuka, Tadashi; Hata, Hiroaki

    In concerning with the trend for the phase out of CFC's,we have developed the technology for the rolling piston type rotary compressors for refrigerators using HFC134a. It is known that the reliability of compressors is less when using HFC134a for conventional compressors without any modifications than that when using CFC12. We have estimated some kinds of refrigerating oil,materials for motors,mechanical parts, and their compatibility for HFC134a. The life test using the compressors with the new oil,motor materials,and modified mechanical parts was carried out and it has been found that the reliability equivalent to that of CFC12 system can be maintained. However,this test only could estimate there liability of compressors under a certain limited condition. So we are now continuing extend examination to adapt the above-mentioned technology to various actual use.

  18. The effect of PTH(1-34) on fracture healing during different loading conditions

    DEFF Research Database (Denmark)

    Ellegaard Larsen, Maria; Kringelbach, Tina; Syberg, Susanne

    2013-01-01

    . Five days before fracture, half of the animals received Botulinum Toxin A injections in the muscles of the fractured leg to induce muscle paralysis (unloaded group), whereas the other half received saline injections (control group). For the following 8 weeks, half of the animals in each group received...... injections of hPTH(1-34) (20 µg/kg/day) and the other half received vehicle treatment. Fracture healing was assessed by radiology, dual-energy X-ray absorptiometry (DXA), histology, and bone strength analysis. We found that unloading reduced callus area significantly, whereas no effects of PTH(1...... and control animals. PTH(1-34) treatment increased ultimate force of the fracture by 63% in both control and unloaded animals and no interaction of the two interventions could be detected. PTH(1-34) was able to stimulate bone formation in normally loaded as well as unloaded intact bone. In conclusion...

  19. Highly CO2-Tolerant Cathode for Intermediate-Temperature Solid Oxide Fuel Cells: Samarium-Doped Ceria-Protected SrCo0.85Ta0.15O3-δ Hybrid.

    Science.gov (United States)

    Li, Mengran; Zhou, Wei; Zhu, Zhonghua

    2017-01-25

    Susceptibility to CO2 is one of the major challenges for the long-term stability of the alkaline-earth-containing cathodes for intermediate-temperature solid oxide fuel cells. To alleviate the adverse effects from CO2, we incorporated samarium-stabilized ceria (SDC) into a SrCo0.85Ta0.15O3-δ (SCT15) cathode by either mechanical mixing or a wet impregnation method and evaluated their cathode performance stability in the presence of a gas mixture of 10% CO2, 21% O2, and 69% N2. We observed that the CO2 tolerance of the hybrid cathode outperforms the pure SCT15 cathode by over 5 times at 550 °C. This significant enhancement is likely attributable to the low CO2 adsorption and reactivity of the SDC protective layer, which are demonstrated through thermogravimetric analysis, energy-dispersive spectroscopy, and electrical conductivity study.

  20. {sup 134}Cs and {sup 85}Sr behaviour in some fruit systems

    Energy Technology Data Exchange (ETDEWEB)

    Carini, Franca; D' alessandro, Pier Giuseppe; Brambilla, Massimo; Casali, Monica [Institute of Agricultural and Environmental Chemistry, Faculty of Agricultural Sciences, Universita Cattolica del Sacro Cuore, Via Emilia Parmense, Piacenza (Italy)

    2000-07-01

    The prediction of the radionuclide concentration in fruit is an important task in the assessment of the internal dose to man from ingestion of contaminated food. Experimental studies were carried out in different conditions, by applying an aqueous solution of {sup 134}Cs and {sup 85}Sr on grapevines, apple trees, pear trees and strawberries, in order to evaluate the relative contribution of the processes of direct deposition to fruit surface, leaf to fruit translocation and soil to fruit transfer, to fruit contamination. Leaf to fruit Translocation Factors in grapes, apples and pears were one order of magnitude higher for {sup 134}Cs than for {sup 85}Sr. The residual activity on fruit after direct deposition was also higher for {sup 134}Cs than for {sup 85}Sr, but of the same order of magnitude. The process of leaf to fruit translocation proved to be less effective than that of direct deposition to fruit surface, when the activity deposited on the leaves and on the fruits was the same. After contamination of strawberry plants at anthesis, 23% of {sup 134}Cs in fruit at ripening was due to the process of soil uptake and 77% to that of leaf to fruit translocation. {sup 85}Sr allocated to fruit was only 16% {sup 134}Cs and was ascribable for 90% to the process of leaf to fruit translocation. After contamination of strawberry plants at the beginning of ripening, the direct deposition on the fruit surface was similar for both radionuclides, but represented 46% total {sup 134}Cs and 73% {sup 85}Sr. The remaining was ascribable to the process of leaf to fruit translocation. After contamination of grapevine plants via leaves at the beginning of ripening, 48% of {sup 134}Cs at ripening was concentrated in fruits and 24% in leaves. However, regarding {sup 85}Sr, 57% remained in the leaves and 19% was translocated to stems; only 8% was allocated to fruits. After contamination of grapevine plants via soil, 33% of {sup 134}Cs was allocated to fruits and 44% to roots, while {sup

  1. Aspects Regarding the Use of R-134a in Marine Refrigeration

    Directory of Open Access Journals (Sweden)

    Feiza Memet

    2009-10-01

    Full Text Available In marine refrigeration and air conditioning, refrigerants like R-12, R-22 and R-502 are most commonly used. Due to environmetal challenges, marine refrigeration plants on board of the old vessels have to be updated and designed in new terms. Recently, the global warming problem has put new pressure on possible alternatives, as R-134a for R-12, and drawn attention to energy efficiency. Results and theoretical considerations concerning a retrofit project are discussed with respect to R-134a compared with R-12, a traditional refrigerant on board of old ships.

  2. Internal conversion coefficients in Cs134, Ba137, and La139: A precise test of theory

    Science.gov (United States)

    Nica, N.; Hardy, J. C.; Iacob, V. E.; Balonek, C.; Trzhaskovskaya, M. B.

    2008-03-01

    Recently we measured the ratio of K-shell internal conversion coefficients, αK, for the 127.5-keV E3 transition in Cs134 and the 661.7-keV M4 transition in Ba137. We here report a measurement of the 165.9-keV M1 transition in La139, based on which we convert our earlier ratio measurement into individual αK values for the transitions in Cs134 and Ba137. These results continue to confirm the Dirac-Fock calculations of internal conversion coefficients that incorporate the atomic K-shell vacancy.

  3. 42 CFR 480.134 - Verification and amendment of QIO information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Verification and amendment of QIO information. 480... QUALITY IMPROVEMENT ORGANIZATION REVIEW INFORMATION Utilization and Quality Control Quality Improvement Organizations (QIOs) Disclosure of Confidential Information § 480.134 Verification and amendment of QIO...

  4. 13 CFR 134.509 - When will a Judge dismiss an appeal?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an... Service-Disabled Veteran Owned Small Business Concern Protests § 134.509 When will a Judge dismiss an... matter in a court of competent jurisdiction will not preclude the Judge from rendering a final decision...

  5. Monitoring of intermittent PTH(1-34) treatment by serum PINP in adult ovariectomized osteopenic rats

    DEFF Research Database (Denmark)

    Halleen, Jussi; Peng, ZhiQi; Fagerlund, Katja

    Procollagen I N-terminal propeptide (PINP) is a sensitive marker of bone formation for monitoring the efficacy of treatment with recombinant human parathyroid hormone (1-34) analog [PTH(1-34)] in osteoporotic patients. Recently, a new immunoassay has been developed for serum PINP in rodents......, allowing measurement of serum PINP in preclinical rodent osteoporosis models. The purpose of this study was to evaluate the use of serum PINP for monitoring intermittent PTH(1-34) treatment in adult ovariectomized (OVX) osteopenic rats. Study groups included a sham-operated control group and an OVX......-operated control group receiving vehicle, and OVX-operated groups receiving daily subcutaneous injections of 1.2, 4.0, 12.0, 40.0 and 120.0 µg/kg human PTH(1-34). Each group contained 12 animals that were 6 months of age at the time of the operations. Dosing was started at 7 weeks after OVX and continued for 6...

  6. 40 CFR 49.134 - Rule for forestry and silvicultural burning permits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Rule for forestry and silvicultural... Provisions General Rules for Application to Indian Reservations in Epa Region 10 § 49.134 Rule for forestry... permitting program for forestry and silvicultural burning within the Indian reservation to control emissions...

  7. The International Criminal Court on Presence at Trial : the (in)validity of Rule 134quater’

    NARCIS (Netherlands)

    Knottnerus, Abel

    In November 2013, the ICC’s Assembly of States Parties adopted Rule 134quater as an amendment to the Rules of Procedure and Evidence of the Court. With the trials of Uhuru Kenyatta and William Ruto in mind, the States Parties agreed that the Trial Chamber should be able to excuse the accused from

  8. D-A conjugated polymers containing substituted thiophene, 1,3,4 ...

    Indian Academy of Sciences (India)

    s12039-016-1145-6. D-A conjugated polymers containing substituted thiophene,. 1,3,4-oxadiazole and non-conjugation linkers: Synthesis and study of optical and electrochemical properties. PRASHANTH KUMAR K Ra, UDAYAKUMAR Da,∗ ...

  9. Nucleation efficiency of R134a as a sensitive liquid for superheated ...

    Indian Academy of Sciences (India)

    investigate it in detail. Keywords. R134a; superheated emulsion; chlorafluorocarbon; nucleation efficiency; hydrogen; gamma. PACS Nos 29.00; 29.90.+r. 1. ... the sense that the physical properties are similar to R12 but it is free of chlorine ... Thermodynamic efficiency is the ratio of the critical energy of nucleation to the.

  10. 25 CFR 39.134 - How does a school identify a Limited English Proficient student?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How does a school identify a Limited English Proficient....134 How does a school identify a Limited English Proficient student? A student is identified as limited English proficient (LEP) by using a nationally recognized scientifically research-based test. ...

  11. Cavitation erosion resistance of 13/4 and 21-4-N steels

    Indian Academy of Sciences (India)

    The cavitation erosion is highly dependent on microstructure and mechanical properties. The results show that hot rolled 21-4-N steel is more cavitation erosion resistant than the 13/4 and 21-4-N steels in as cast condition. The eroded surfaces were analysed through optical microscope and scanning electron microscope ...

  12. 42 CFR 413.134 - Depreciation: Allowance for depreciation based on asset costs.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Depreciation: Allowance for depreciation based on... NURSING FACILITIES Capital-Related Costs § 413.134 Depreciation: Allowance for depreciation based on asset costs. (a) Principle. An appropriate allowance for depreciation on buildings and equipment used in the...

  13. 19 CFR 134.51 - Procedure when importation found not legally marked.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.51 Procedure when importation found not legally marked. (a) Notice to mark or redeliver. When articles or... on Customs Form 4647 to arrange with the port director's office to properly mark the article or...

  14. 19 CFR 134.12 - Foreign articles reshipped from a U.S. possession.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.12 Foreign... requirements applicable to like articles of foreign origin imported directly from a foreign country to the... 19 Customs Duties 1 2010-04-01 2010-04-01 false Foreign articles reshipped from a U.S. possession...

  15. The epigraphic tradition at Labraunda seen in the light of Labraunda inscription no. 134

    DEFF Research Database (Denmark)

    Isager, Signe

    2008-01-01

    An important new inscription was discovered in the sanctuary of Zeus Labraundos in 2002. The inscription belongs to the so-called Olympichos file, and together with I. Labraunda no. 49 it is now numbered I. Labraunda no. 134. The inscription has just been published by Lars Karlsson and Signe Isager...

  16. 124-134Xe Izotopları için Triaxiall RMF Hesaplamaları

    Directory of Open Access Journals (Sweden)

    Tuncay BAYRAM

    2016-11-01

    Full Text Available Özet. Bu çalışmada çift-çift 124-134Xe çekirdekleri için Relativistik Ortalama Alan (RMF Modeli kullanılarak taban durum nükleer özellik hesaplamaları yapılmıştır. Bu çekirdekler için RMF+DDM2 etkileşmesi ile taban durum bağlanma enerjileri için deneysel değerlere çok yakın sonuçlar elde edilmiştir. Triaxiall simetriye dayalı hesaplamalar yapılarak 124-134Xe izotop zincirinde izotopların taban durum şekilleri üzerine bir analizde sunulmaktadır. Özellikle deneysel olarak 130Xe çekirdeğinin E(5 simetrisine sahip kritik nokta çekirdeği olduğu iddia edilmektedir. Bu bağlamda Xe izotopları için RMF modeli çerçevesinde elde edilen potansiyel enerji yüzeyleri (PES kullanılarak E(5 simetrili çekirdek taraması yapılmıştır. Çift-çift 124-134Xe izotopları için izotop zinciri boyunca şekil evrimi detaylıca tartışılmıştır.Anahtar kelimeler: RMF modeli, Bağlanma enerjisi, Xe izotopları, PES, E(5 simetrisi Abstract. In this study, ground-state nuclear properties of even-even 124-134Xe nuclei have been calculated by using Relativistic Mean Field (RMF model. By using RMF+DDM2 interaction the ground-state binding energies of these nuclei have been predicted as very close to experimental values. Also, an analizing on the ground-state shape of 124-134Xe isotopes is presented by using calculations based on triaxiall symmetry. In particular, 130Xe nuclei has been pointed out as possible critical point nuclei with E(5 symmetry from experimental studies. For this reason, by using potential energy surfaces (PES of 124-134Xe nuclei obtained from RMF model, scanning for E(5 symmetry in this isotopic chain has been done. For even-even 124-134Xe nuclei, shape evolution has been discussed in detail.Keywords: RMF model, Binding energy, Xe isotopes, PES, E(5 symmetry

  17. Global emissions of refrigerants HCFC-22 and HFC-134a: Unforeseen seasonal contributions

    Science.gov (United States)

    Xiang, Bin; Montzka, Stephen A.; Miller, Scot M.; Elkins, James W.; Moore, Fred L.; Atlas, Elliot L.; Miller, Ben R.; Weiss, Ray F.; Prinn, Ronald G.; Wofsy, Steven C.

    2014-01-01

    HCFC-22 (CHClF2) and HFC-134a (CH2FCF3) are two major gases currently used worldwide in domestic and commercial refrigeration and air conditioning. HCFC-22 contributes to stratospheric ozone depletion, and both species are potent greenhouse gases. In this work, we study in situ observations of HCFC-22 and HFC-134a taken from research aircraft over the Pacific Ocean in a 3-y span [HIaper-Pole-to-Pole Observations (HIPPO) 2009–2011] and combine these data with long-term ground observations from global surface sites [National Oceanic and Atmospheric Administration (NOAA) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks]. We find the global annual emissions of HCFC-22 and HFC-134a have increased substantially over the past two decades. Emissions of HFC-134a are consistently higher compared with the United Nations Framework Convention on Climate Change (UNFCCC) inventory since 2000, by 60% more in recent years (2009–2012). Apart from these decadal emission constraints, we also quantify recent seasonal emission patterns showing that summertime emissions of HCFC-22 and HFC-134a are two to three times higher than wintertime emissions. This unforeseen large seasonal variation indicates that unaccounted mechanisms controlling refrigerant gas emissions are missing in the existing inventory estimates. Possible mechanisms enhancing refrigerant losses in summer are (i) higher vapor pressure in the sealed compartment of the system at summer high temperatures and (ii) more frequent use and service of refrigerators and air conditioners in summer months. Our results suggest that engineering (e.g., better temperature/vibration-resistant system sealing and new system design of more compact/efficient components) and regulatory (e.g., reinforcing system service regulations) steps to improve containment of these gases from working devices could effectively reduce their release to the atmosphere. PMID:25422438

  18. Parathyroid hormone (1-34) ameliorated knee osteoarthritis in rats via autophagy.

    Science.gov (United States)

    Chen, Chung-Hwan; Chang, Ling-Hua; Kang, Lin; Lin, Yi-Shan; Lin, Sung-Yen; Wu, Shun-Cheng; Chang, Je-Ken; Ho, Mei-Ling

    2018-01-04

    Anterior cruciate ligament (ACL) tear can leads to osteoarthritis (OA). However, parathyroid hormone (PTH) (1-34) was found to alleviate OA progression in a papain-induced OA model. Autophagy is a protective mechanism in normal cartilage, and its aging-related loss is linked with chondrocyte death and OA. Thus, we examined the roles of autophagy in PTH treatment on OA after ACL transection (ACLT). Thirty-six rats were randomized into three groups: control group, ACLT-induced OA (ACLT-OA) group, and OA with intra-articular PTH (1-34) treatment group. Weight-bearing and treadmill tests were evaluated. Cartilage matrix was determined by a histological evaluation of glycosaminoglycan (GAG), the OARSI score, chondrocyte apoptosis, and immunohistochemistry. Rats in the ACLT-OA group had significantly decreased weight-bearing and running endurance. The histological results indicated that GAG, collagen type II and chondrocyte autophagy had decreased, but that the OARSI score, terminal differentiation markers (collagen type X, Indian hedgehog), and chondrocyte apoptosis had increased in the OA group. Additionally, PTH (1-34) treatment significantly improved weight-bearing and treadmill endurance, preserved GAG and collagen type II, and reduced the OARSI score and terminal differentiation marker. Finally, PTH (1-34) ameliorated chondrocyte apoptosis by regulating the expressions of autophagy-related proteins, through reducing mTOR and p62, and enhancing LC3 and Beclin-1. Reconstructive surgery after ACL rupture cannot prevent OA occurrence. Intra-articular PTH (1-34) treatment can alleviate OA progression after ACLT and histological molecular changes. Possible mechanisms are reducing chondrocyte terminal differentiation and apoptosis, with increasing autophagy.

  19. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  20. T134

    Directory of Open Access Journals (Sweden)

    A. Shikeeva

    2015-11-01

    We postulate that FC size in NSCLC is at least 5 cm from tumor and includes only epigenetic but not structural (LOH/MSI alterations. The evaluation of epigenetic changes in adjacent tissue (e.g., surgical margins can potentially be used for postsurgical prognosis.

  1. 49 CFR 393.134 - What are the rules for securing roll-on/roll-off or hook lift containers?

    Science.gov (United States)

    2010-10-01

    ... or hook lift containers? 393.134 Section 393.134 Transportation Other Regulations Relating to... for securing roll-on/roll-off or hook lift containers? (a) Applicability. The rules in this section apply to the transportation of roll-on/roll-off or hook lift containers. (b) Securement of a roll-on...

  2. 13 CFR 134.614 - What deadlines apply to my application for an award and where do I send it?

    Science.gov (United States)

    2010-01-01

    ... application for an award and where do I send it? 134.614 Section 134.614 Business Credit and Assistance SMALL... and where do I send it? After you have prevailed in an administrative proceeding or in a discrete... award for fees and expenses may still be filed, but it will not be considered by the ALJ until a final...

  3. 10 CFR 431.134 - Uniform test methods for the measurement of energy consumption and water consumption of automatic...

    Science.gov (United States)

    2010-01-01

    ... consumption and water consumption of automatic commercial ice makers. 431.134 Section 431.134 Energy... of energy consumption and water consumption of automatic commercial ice makers. (a) Scope. This.../100 lbs ice). (b) Testing and Calculations. Determine the energy consumed and the condenser water use...

  4. Antagomirs Targeting MiroRNA-134 Attenuates Epilepsy in Rats through Regulation of Oxidative Stress, Mitochondrial Functions and Autophagy

    Directory of Open Access Journals (Sweden)

    Jiahang Sun

    2017-08-01

    Full Text Available The effects of the existing anti-epileptic drugs are unsatisfactory to almost one third of epileptic patients. MiR-134 antagomirs prevent pilocarpine-induced status epilepticus. In this study, a lithium chloride-pilocarpine-induced status epilepticus model was established and treated with intracerebroventricular injection of antagomirs targeting miR-134 (Ant-134. The Ant-134 treatment significantly improved the performance of rats in Morris water maze tests, inhibited mossy fiber sprouting in the dentate gyrus, and increased the survival neurons in the hippocampal CA1 region. Silencing of miR-134 remarkably decreased malonaldehyde and 4-hydroxynonenal levels and increased superoxide dismutase activity in the hippocampus. The Ant-134 treatment also significantly increased the production of ATP and the activities of mitochondrial respiratory enzyme complexes and significantly decreased the reactive oxygen species generation in the hippocampus compared with the status epilepticus rats. Finally, the Ant-134 treatment remarkably downregulated the hippocampal expressions of autophagy-associated proteins Atg5, beclin-1 and light chain 3B. In conclusion, Ant-134 attenuates epilepsy via inhibiting oxidative stress, improving mitochondrial functions and regulating autophagy in the hippocampus.

  5. 13 CFR 134.608 - What are the special rules for calculating net worth and number of employees?

    Science.gov (United States)

    2010-01-01

    ... unincorporated business, or a partnership, corporation, association, organization, or unit of local government... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the special rules for calculating net worth and number of employees? 134.608 Section 134.608 Business Credit and Assistance SMALL...

  6. All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method

    Science.gov (United States)

    Kim, Seung-Yeon; Kwak, Wooseop

    2014-12-01

    We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z( T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z( T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T 1 and the lower transition temperature T 2 of PTH(1-34) can be interpreted as the collapse temperature T θ and the folding temperature T f , respectively.

  7. Foliar and root uptake of 134Cs, 85Sr and 65Zn in processing tomato plants (Lycopersicon esculentum Mill.).

    Science.gov (United States)

    Brambilla, M; Fortunati, P; Carini, F

    2002-01-01

    The results of an experimental study on the behaviour of 134Cs, 85Sr and 65Zn in processing tomato plants grown in peat substrate are presented. Plants were contaminated by wet deposition of 134Cs, 85Sr and 65Zn, either by sprinkling the above ground part at two phenological stages or by administering 134Cs, 85Sr and 65Zn to the soil. The plants contaminated at the second phenological stage intercepted 38.3% less than those contaminated at the first stage, although leaf area increased by more than double. Transfer coefficients from peat soil to ripe fruit for 134Cs are significantly higher than those for 85Sr and 65Zn. Leaf to fruit transfer coefficients for 134Cs are one order of magnitude higher than for 65Zn and two orders higher than for 85Sr. Only when deposition affects fruits, as at the second phenological stage, are transfer coefficients to fruits similar for the three radionuclides.

  8. Searches for double beta decay of 134Xe with EXO-200

    Science.gov (United States)

    Albert, J. B.; Anton, G.; Badhrees, I.; Barbeau, P. S.; Bayerlein, R.; Beck, D.; Belov, V.; Breidenbach, M.; Brunner, T.; Cao, G. F.; Cen, W. R.; Chambers, C.; Cleveland, B.; Coon, M.; Craycraft, A.; Cree, W.; Daniels, T.; Danilov, M.; Daugherty, S. J.; Daughhetee, J.; Davis, J.; Delaquis, S.; Der Mesrobian-Kabakian, A.; DeVoe, R.; Didberidze, T.; Dilling, J.; Dolgolenko, A.; Dolinski, M. J.; Fairbank, W.; Farine, J.; Feyzbakhsh, S.; Fierlinger, P.; Fudenberg, D.; Gornea, R.; Graham, K.; Gratta, G.; Hall, C.; Hoessl, J.; Hufschmidt, P.; Hughes, M.; Jamil, A.; Jewell, M. J.; Johnson, A.; Johnston, S.; Karelin, A.; Kaufman, L. J.; Koffas, T.; Kravitz, S.; Krücken, R.; Kuchenkov, A.; Kumar, K. S.; Lan, Y.; Leonard, D. S.; Li, S.; Licciardi, C.; Lin, Y. H.; MacLellan, R.; Marino, M. G.; Michel, T.; Mong, B.; Moore, D.; Murray, K.; Nelson, R.; Njoya, O.; Odian, A.; Ostrovskiy, I.; Piepke, A.; Pocar, A.; Retière, F.; Rowson, P. C.; Russell, J. J.; Schubert, A.; Sinclair, D.; Smith, E.; Stekhanov, V.; Tarka, M.; Tolba, T.; Tsang, R.; Vogel, P.; Vuilleumier, J.-L.; Wagenpfeil, M.; Waite, A.; Walton, J.; Walton, T.; Weber, M.; Wen, L. J.; Wichoski, U.; Yang, L.; Yen, Y.-R.; Zeldovich, O. Ya.; Zettlemoyer, J.; Ziegler, T.; EXO-200 Collaboration

    2017-11-01

    Searches for double beta decay of 134Xe were performed with EXO-200, a single-phase liquid xenon detector designed to search for neutrinoless double beta decay of 136Xe. Using an exposure of 29.6 kg .yr , the lower limits of T1/2 2 ν β β>8.7 ×1020 yr and T1/2 0 ν β β>1.1 ×1023 yr at 90% confidence level were derived, with corresponding half-life sensitivities of 1.2 ×1021 yr and 1.9 ×1023 yr . These limits exceed those in the literature for 134Xe, improving by factors of nearly 1 05 and 2 for the two antineutrino and neutrinoless modes, respectively.

  9. N-(5-Benzylsulfanyl-1,3,4-thiadiazol-2-yl-2-(piperidin-1-ylacetamide

    Directory of Open Access Journals (Sweden)

    D. S. Ismailova

    2014-03-01

    Full Text Available The title compound, C16H20N4OS2, was synthesized by the reaction of 2-benzylsulfanyl-5-chloroacetamido-1,3,4-thiadiazole and piperidine in a 1:2 ratio. The planes of the acetamide and 1,3,4-thiadiazole units are twisted by 10.8 (4°. The thiadiazole S atom and the acetamide O atom are syn-oriented due to a hypervalent S...O interaction of 2.628 (4 Å. In the crystal, molecules form centrosymmetric dimers via N—H...N hydrogen bonds. These dimers are further connected by C—H...O interactions into (100 layers.

  10. New 1,3,4-Oxadiazole Based Photosensitizers for Dye Sensitized Solar Cells (DSSCs

    Directory of Open Access Journals (Sweden)

    Umer Mehmood

    2015-01-01

    Full Text Available 1,3,4-Oxadiazole based photosensitizers with biphenyl, naphthalene, anthracene, and triphenylamine as the electron-donating moiety were synthesized for solar cell applications. In these photosensitizers, cyano groups were introduced as the electron acceptor and the anchor group because of their high electron-withdrawing ability and strong bonding to the semiconductor. Oxadiazole isomers were used as the π-conjugation system, which bridges the donor-acceptor systems. The electrochemical and optical properties of the sensitizers were investigated both in their native form and upon incorporation into dye sensitized solar cells. The results of UV-visible absorption spectroscopy, electrochemical impedance spectroscopic measurements, and photocurrent voltage characteristics indicate that 1,3,4-oxadiazole pi-spacer with the anthracene moiety has the highest efficiency of 2.58%. Density functional theory was employed to optimize the structures of the sensitizers and the TiO2 cluster.

  11. The complete multipartite genome sequence of Cupriavidus necator JMP134, a versatile pollutant degrader.

    Directory of Open Access Journals (Sweden)

    Athanasios Lykidis

    Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.

  12. [Lens luxation in dogs: a retrospective study of 134 dogs (2000-2011)].

    Science.gov (United States)

    Betschart; Hässig; Spiess

    2014-03-01

    This retrospective study evaluated cases of lens luxation in dogs that were documented at the University of Zurich Veterinary Teaching Hospital between 2000 and 2011. A total 134 dogs were included in the study. This population of dogs with lens luxation represents 0.41 % of all dogs presented to the Zurich Veterinary Teaching Hospital (32'523) and 3.02 % of all dogs presented to the ophthalmology service during the same time period. The 134 dogs represented over 40 different breeds, including mixed breeds. 63 of the dogs were male, 71 were female. The 134 dogs were divided in primary lens luxation (86 of the 134 dogs, 64 %) and secondary lens luxation (48 dogs, 36 %). The most frequent causes for secondary lens luxation were glaucoma (58 %), cataract (19 %) and trauma (17 %). This study shows the predisposition for primary lens luxations in terrier breeds, Chinese Crested dogs, Pinscher and Spitz. In contrast, Siberian Huskies, Basset Hounds, Bearded Collies, Cairn Terriers, mixed breed dogs, Bolonka Zwetna, Boston Terriers, Borzoi, Doberman, Eurasian, Leonberg, Luzerner Niederlaufhund and Weimaraner suffered significantly more often from secondary lens luxation. There was no sex predilection for primary or secondary lens luxation. Dogs with primary lens luxation were on average 7.39 ± 3.02 years old, which is significantly younger than the dogs with secondary lens luxation (9.12 ± 3.38 years). Dogs with primary lens luxation showed a significantly higher rate of a bilateral development than those with secondary lens luxation (85.5 % of the dogs with primary lens luxation and only 14.5 % of the dogs with secondary lens luxation showed it in both their eyes).

  13. 124-134Xe Izotopları için Triaxiall RMF Hesaplamaları

    National Research Council Canada - National Science Library

    Tuncay BAYRAM; Serkan AKKOYUN; Şevki ŞENTÜRK

    2016-01-01

    Özet. Bu çalışmada çift-çift 124-134Xe çekirdekleri için Relativistik Ortalama Alan (RMF) Modeli kullanılarak taban durum nükleer özellik hesaplamaları yapılmıştır. Bu çekirdekler için RMF+DDM2...

  14. Effect of Glucose and Fructose on Production Polyhydroxyalkanoates by Ralstonia Eutropha Jmp 134 as Batch Fermentation

    OpenAIRE

    Aznury, Martha

    2013-01-01

    Polyhydroxyalknoate (PHA) is a bioplastic from the group of polyester with physicochemical properties similar to polypropylene plastic from petroleum. This research aims to study the effect of glucose and fructose on PHA fermentation process performed by using Ralstonia eutropha JMP 134 in a batch bioreactor. Dynamics of PHA production from carbon sources glucose or fructose, as well as the influence of volatile fatty acids as a prekursor were studied in this research. Fermentation operatin...

  15. MicroRNA-134 as a potential plasma biomarker for the diagnosis of acute pulmonary embolism

    Directory of Open Access Journals (Sweden)

    Liu Yi

    2011-09-01

    Full Text Available Abstract Background Acute pulmonary embolism (APE remains a diagnostic challenge due to a variable clinical presentation and the lack of a reliable screening tool. MicroRNAs (miRNAs regulate gene expression in a wide range of pathophysiologic processes. Circulating miRNAs are emerging biomarkers in heart failure, type 2 diabetes and other disease states; however, using plasma miRNAs as biomarkers for the diagnosis of APE is still unknown. Methods Thirty-two APE patients, 32 healthy controls, and 22 non-APE patients (reported dyspnea, chest pain, or cough were enrolled in this study. The TaqMan miRNA microarray was used to identify dysregulated miRNAs in the plasma of APE patients. The TaqMan-based miRNA quantitative real-time reverse transcription polymerase chain reactions were used to validate the dysregulated miRNAs. The receiver-operator characteristic (ROC curve analysis was conducted to evaluate the diagnostic accuracy of the miRNA identified as the candidate biomarker. Results Plasma miRNA-134 (miR-134 level was significantly higher in the APE patients than in the healthy controls or non-APE patients. The ROC curve showed that plasma miR-134 was a specific diagnostic predictor of APE with an area under the curve of 0.833 (95% confidence interval, 0.737 to 0.929; P Conclusions Our findings indicated that plasma miR-134 could be an important biomarker for the diagnosis of APE. Because of this finding, large-scale investigations are urgently needed to pave the way from basic research to clinical utilization.

  16. Targeted pancreatic cancer therapy with the small molecule drug conjugate SW IV-134.

    Science.gov (United States)

    Hashim, Yassar M; Spitzer, Dirk; Vangveravong, Suwanna; Hornick, Mary C; Garg, Gunjal; Hornick, John R; Goedegebuure, Peter; Mach, Robert H; Hawkins, William G

    2014-07-01

    Pancreatic adenocarcinoma is highly resistant to conventional therapeutics and has been shown to evade apoptosis by deregulation of the X-linked and cellular inhibitors of apoptosis proteins (XIAP and cIAP). Second mitochondria-derived activator of caspases (Smac) induces and amplifies cell death by reversing the anti-apoptotic activity of IAPs. Thus, Smac-derived peptide analogues (peptidomimetics) have been developed and shown to represent promising cancer therapeutics. Sigma-2 receptors are overexpressed in many proliferating tumor cells including pancreatic cancer. Selected ligands to this receptor are rapidly internalized by cancer cells. These characteristics have made the sigma-2 receptor an attractive target for drug delivery because selective delivery to cancer cells has the potential to increase therapeutic efficacy while minimizing toxicity to normal tissues. Here, we describe the initial characterization of SW IV-134, a chemically linked drug conjugate between the sigma-2 ligand SW43 and the Smac mimetic SW IV-52 as a novel treatment option for pancreatic adenocarcinoma. The tumor killing characteristics of our dual-domain therapeutic SW IV-134 was far greater than either component in isolation or in an equimolar mix and suggests enhanced cellular delivery when chemically linked to the sigma-2 ligand. One of the key findings was that SW IV-134 retained target selectivity of the Smac cargo with the involvement of the NF-κB/TNFα signaling pathway. Importantly, SW IV-134 slowed tumor growth and improved survival in murine models of pancreatic cancer. Our data support further study of this novel therapeutic and this drug delivery strategy because it may eventually benefit patients with pancreatic cancer. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  17. Nucleation efficiency of R134a as a sensitive liquid for superheated ...

    Indian Academy of Sciences (India)

    Superheated emulsion detector is known to detect neutrons, γ-rays and other charged particles. The present work includes the study of nucleation efficiency of super-heated drops of one of the CFC-free liquids, R134a (C2H2F4), to fast neutrons, its response to -rays from 241Am and 137Cs and compare its nucleation ...

  18. Trophic transfer of 134Cs in the Manila clam Ruditapes philippinarum.

    Science.gov (United States)

    Belivermiş, Murat; Kılıç, Önder; Sezer, Narin; Kalaycı, Gülşah; Metian, Marc

    2017-10-01

    Bioaccumulation of radiocaesium in many marine organisms occurs through complex trophic transfer mechanisms. The present study addresses the trophic transfer of 134Cs in the widely distributed marine bivalve, the Manila clam Ruditapes philippinarum, by experimentally determining the assimilation efficiency (AE) and the specific role of food quality or diet on the AE in this marine invertebrate. Pulse-chase feeding experiments were carried out on this clam using the phytoplankton species Tetraselmis chuii, Phaeodactylum tricornutum and Isochrysis galbana. Depuration kinetics of 134Cs over 21 days were analysed using a two-component exponential model. Observed assimilation efficiencies were consistently less than 10% but slightly varied among individuals fed on the three different phytoplankton species diets (T. chuii: AE = 8.4 ± 0.6%; P. tricornutum: AE = 9.8 ± 0.5%; I. galbana: AE = 5.3 ± 0.6%), although no statistical differences were observed. Comparing results from these experiments with existing data from the literature on the same species exposed to caesium through seawater, it appears that trophic transfer processes are the main accumulation pathway, contributing up to 96% of the global 134Cs bioaccumulation in this bivalve species. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Munc13-4 functions as a Ca2+ sensor for homotypic secretory granule fusion to generate endosomal exocytic vacuoles

    Science.gov (United States)

    Woo, Sang Su; James, Declan J.; Martin, Thomas F. J.

    2017-01-01

    Munc13-4 is a Ca2+-dependent SNARE (soluble N-ethylmaleimide–sensitive factor attachment protein receptor)- and phospholipid-binding protein that localizes to and primes secretory granules (SGs) for Ca2+-evoked secretion in various secretory cells. Studies in mast cell–like RBL-2H3 cells provide direct evidence that Munc13–4 with its two Ca2+-binding C2 domains functions as a Ca2+ sensor for SG exocytosis. Unexpectedly, Ca2+ stimulation also generated large (>2.4 μm in diameter) Munc13-4+/Rab7+/Rab11+ endosomal vacuoles. Vacuole generation involved the homotypic fusion of Munc13-4+/Rab7+ SGs, followed by a merge with Rab11+ endosomes, and depended on Ca2+ binding to Munc13-4. Munc13-4 promoted the Ca2+-stimulated fusion of VAMP8-containing liposomes with liposomes containing exocytic or endosomal Q-SNAREs and directly interacted with late endosomal SNARE complexes. Thus Munc13-4 is a tethering/priming factor and Ca2+ sensor for both heterotypic SG-plasma membrane and homotypic SG-SG fusion. Total internal reflection fluorescence microscopy imaging revealed that vacuoles were exocytic and mediated secretion of β-hexosaminidase and cytokines accompanied by Munc13-4 diffusion onto the plasma membrane. The results provide new molecular insights into the mechanism of multigranular compound exocytosis commonly observed in various secretory cells. PMID:28100639

  20. Effects of chronic gap junction conduction-enhancing antiarrhythmic peptide GAP-134 administration on experimental atrial fibrillation in dogs.

    Science.gov (United States)

    Laurent, Gabriel; Leong-Poi, Howard; Mangat, Iqwal; Moe, Gordon W; Hu, Xudong; So, Petsy Pui-Sze; Tarulli, Emidio; Ramadeen, Andrew; Rossman, Eric I; Hennan, James K; Dorian, Paul

    2009-04-01

    Abnormal intercellular communication caused by connexin dysfunction may contribute to atrial fibrillation (AF). The present study assessed the effect of the gap junction conduction-enhancing antiarrhythmic peptide GAP-134 on AF inducibility and maintenance in a dog model of atrial cardiomyopathy. Twenty-four dogs subject to simultaneous atrioventricular pacing (220 bpm for 14 days) were randomly assigned to placebo treatment (PACED-CTRL; 12 dogs) or oral GAP-134 (2.9 mg/kg BID; PACED-GAP-134; 12 dogs) starting on day 0. UNPACED-CTRL (4 dogs) and UNPACED-GAP-134 (4 dogs) served as additional control groups. Change in left atrial (LA) systolic area from baseline to 14 days was calculated using transoesophageal echocardiography. At 14 days, animals underwent an open-chest electrophysiological study. PACED-CTRL dogs (versus UNPACED-CTRL) had a shorter estimated LA wavelength (8.0+/-1.4 versus 24.4+/-2.5 cm, P<0.05) and a greater AF vulnerability (mean AF duration, 1588+/-329 versus 25+/-34 seconds, P<0.05). Oral GAP-134 had no effect on AF vulnerability in UNPACED dogs. Compared with PACED-CTRL dogs, PACED-GAP-134 dogs had a longer estimated LA wavelength (10.2+/-2.8 versus 8.0+/-1.4 cm, respectively, P<0.05). Oral GAP-134 did not significantly reduce AF inducibility or maintenance in the entire group of 24 PACED dogs; in a subgroup of dogs (n=11) with less than 100% increase in LA systolic area, oral GAP-134 reduced AF induction from 100% to 40% and mean AF duration from 1737+/-120 to 615+/-280 seconds (P<0.05). Oral GAP-134 reduces pacing-induced decrease in LA wavelength and appears to attenuate AF vulnerability in dogs with less atrial mechanical remodeling. Gap junction modulation may affect AF in some circumstances.

  1. Consequences of substituting freon R12 by freon R134a in a petroleum gas refrigeration plant; Etude de la substitution du freon R12 par le freon R134a dans une installation de refroidissement des gaz de petrole

    Energy Technology Data Exchange (ETDEWEB)

    Hajji, N.; Rekik, A.; Jeday, M.R. [Ecole Nationale d' ingenieurs de Gabes, Laboratoire d' Energetique et d' Ingenierie, ENIG, Gabes (Tunisia)

    2001-07-01

    In this work, a preliminary investigation was conducted to study the consequences of substituting R12 by R134a in an installation used to refrigerate petroleum gases. This study shows that the same refrigeration power can be provided with a smaller mass flowrate of R134a. Furthermore, the size of the key equipments is sufficient for normal operation with the new refrigeration fluid. Technical problems associated with the compressor are not covered in this study. (authors)

  2. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  3. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS); Die Dynamik des laserinduzierten Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS)

    Energy Technology Data Exchange (ETDEWEB)

    Kaempfer, Tino

    2009-12-15

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [German] Die vorliegende Arbeit ist der experimentellen Untersuchung des Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS) gewidmet. Es werden temperatur- und zeitaufgeloeste Experimente zur Charakterisierung des Phasenuebergangs gemischt-valenter SmS Proben (M-SmS) vorgestellt. Die Messung der Dynamik des laserinduzierten Phasenuebergangs erfolgt ueber zeitaufgeloeste Ultrakurzzeit-Mikroskopie und durch Roentgenbeugung mit subpikosekunden Zeitaufloesung. Die elektronischen und strukturellen Prozesse, welche einer Anregung von M-SmS mit infraroten Femtosekunden-Laserpulsen folgen, werden auf der Basis der in dieser Arbeit gewonnenen Ergebnisse und Modellvorstellungen physikalisch interpretiert. (orig.)

  4. Study on the Materials for Compressor and Reliability of Refrigeration Circuit in Refrigerator with R134a Refrigerant

    Science.gov (United States)

    Komatsubara, Takeo; Sunaga, Takasi; Takahasi, Yasuki

    R134a was selected as the alternative refrigerant for R12 because of the similar thermodynamic properties with R12. But refrigeration oil for R12 couldn't be used for R134a because of the immiscibility with R134a. To solve this problem we researched miscible oil with R134a and selected polyol ester oil (POE) as refrigeration oil. But we found sludge deposition into capillary tube after life test of refrigerator with POE and detected metal soap, decomposed oil and alkaline ions by analysis of sludge. This results was proof of phenomena like oil degradation, precipitation of process materials and wear of compressor. Therefore we improved stability and lubricity of POE, reevaluated process materials and contaminations in refrigerating circuit. In this paper we discuss newly developed these technologies and evaluation results of it by life test of refrigerator.

  5. Viscosity Measurements and Correlations for 1,1,1,2-tetrafluoroethane (HFC-134a) up to 140 MPa

    DEFF Research Database (Denmark)

    Comuñas, M.J.P.; Baylaucq, A.; Cisneros, Sergio

    2003-01-01

    In spite of being one of the most studied refrigerants, large discrepancies in the experimental determination of the dynamic viscosity of 1, 1, 1,2-tetrafluoroethane (HFC-134a) prevail. Additionally, there is a need for supplementary high-pressure measurements that can help to derive sound general...... correlations for the viscosity of this compound. Hence, in this work new dynamic viscosity measurements for HFC-134a using a falling-body viscometer in the temperature range of 293.15-373.15 K and pressures up to 140 MPa are presented. This work high-pressure data in combination with already published data...... provide dynamic viscosity information for the HFC-134a on wide ranges of temperature and pressure. Thus, based on selected HFC-134a viscosity measurements, a representative viscosity model has been correlated using the friction theory (f-theory) in combination with a BWR type of equation of state (Eo...

  6. Recombinant human parathyroid hormone related protein 1-34 and 1-84 and their roles in osteoporosis treatment.

    Directory of Open Access Journals (Sweden)

    Hua Wang

    Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.

  7. SYNTHESIS AND ANTIINFLAMMATORY ACTIVITY OF SOME IMIDAZO[2,1-b][1,3,4]THIADIAZOLE DERIVATIVES.

    Science.gov (United States)

    Karki, Subhas S; Rana, Vivek; Sivan, Ramjith U; Kumar, Sujeet; Renuka, Vinayakumar; Ramareddy, Sureshbabu A; Subbarao, Prasanna G; Si, Sudam C

    2015-01-01

    A number of imidazo[2,1-b][1,3,4]thiadiazole derivatives having alkyl and aryl moieties attached to positions 2 and 6 of imidazo[2,1-b][1,3,4]thiadiazole nucleus, respectively, were prepared and characterized by IR, NMR and mass spectroscopy. Antiinflammatory activity was evaluated by carrageenan-induced rat paw edema assay. By 5th hours, all compounds demonstrated anti-inflammatory activity similar or higher than that of standard NSAID, ibuprofen.

  8. Inventory and mitigation opportunities for HFC-134a emissions from nonprofessional automotive service

    Science.gov (United States)

    Zhan, Tao; Potts, Winston; Collins, John F.; Austin, Jeff

    2014-12-01

    Many vehicle owners in the United States recharge their vehicles' air conditioning systems with small containers of hydrofluorocarbon-134a (HFC-134a, CH2FCF3), at a frequency estimated to be once every year on average. Such nonprofessional service produces immediate emissions of this potent greenhouse gas during service and from the residual heel in partially used containers. The nonprofessional operations are also associated with increased delayed refrigerant emissions that occur because owners are less likely to repair leaks than professional technicians. In California, an estimated 1.3 million nonprofessional service operations performed each year generate 0.27 ± 0.07 million metric ton CO2 equivalent (MMTCO2e) of immediate emissions and 0.54 ± 0.08 MMTCO2e of delayed emissions, using a Global Warming Potential of 1300 for HFC-134a. The immediate emissions can be largely mitigated by a regulation that requires self-sealing valves and improved labeling instructions on the containers, a deposit-return-recycling program for the containers, and a consumer education program. If 95% of the used containers were to be returned by consumers for recycling of the container heel, the annual immediate emissions would be reduced by 0.26 ± 0.07 MMTCO2e. In the United States, an estimated 24 million nonprofessional service operations are performed each year, generating 5.1 ± 1.4 MMTCO2e of immediate emissions and 10.4 ± 1.5 MMTCO2e of delayed emissions. Mitigation measures equivalent to the California regulation would reduce nationwide immediate emissions by 4.9 ± 1.4 MMTCO2e, if 95% of the used cans were returned for recycling. These business-as-usual emissions and mitigation potentials are projected to stay approximately constant until around 2022, and remain at significant levels into the 2030s.

  9. The synthesis and optical properties of novel triphenylamine containing 1,3,4-oxadiazole derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Majumdar, K.C., E-mail: kcm@klyuniv.ac.in; Shyam, Pranab K.; Biswas, Avijit; De, Swati, E-mail: swati_de1@rediffmail.com

    2013-11-15

    Symmetrical 4,4′,4″-trisubstituted triphenylamine derivatives containing 1,3,4-oxadiazole moiety bearing long aliphatic chains have been synthesized by employing convenient and simple synthetic protocols. The structures of these target molecules were established by their analytical and spectral data. They exhibit good fluorescence properties with high quantum yield and show very efficient fluorescence quenching in presence of p-nitrotoluene. -- Highlights: • The Triphenylamine based compounds exhibit strong fluorescence. • They show preferential J-aggregation at high concentrations. • They are quenched by p-nitrotoluene, may be used in detection of nitro compounds.

  10. Synthesis and Bioassay of a New Class of Furanyl-1,3,4-Oxadiazole Derivatives

    Directory of Open Access Journals (Sweden)

    Galila A. Yacout

    2013-07-01

    Full Text Available Tyrosinase enzyme is a monophenol monoxygenase enzyme, which plays an important role in human as a rate limiting step enzyme for different specific metabolic pathways, as well as its useful application in industry and agriculture. So this study was carried out to test the effect of newly prepared compounds containing 1,3,4-oxadiazoles with different substituted groups on tyrosinase enzyme activity, hoping to use them in the treatment of some diseases arising from tyrosinase activity disorders such as Parkinson’s disease, schizophrenia, autism, attention deficit, hyperactivity disorder, and cancer.

  11. Coulomb excitation of neutron-rich $^{134-136}$Sn isotopes

    CERN Multimedia

    We propose to study excited states in the isotopes $^{134,136}$Sn by $\\gamma$-ray spectroscopy following "safe" Coulomb excitation. The experiment aims to investigate the evolution of quadrupole collectivity beyond the magic shell closure at N = 82 by the determination of B(E2) values and electric quadrupole moments $\\mathcal{Q}_2$. Recent shell-model calculations using realistic interactions predict possible enhanced collectivity in neutron-rich regions. Evidence for this could be obtained by this experiment. Furthermore, the currently unknown excitation energies of the 2$^+_{1}$ and 4$^+_{1}$ states in $^{136}$Sn will be measured for the first time.

  12. Convenient synthesis of azolopyrimidine, azolotriazine, azinobenzimidazole and 1,3,4-thiadiazole derivatives

    Directory of Open Access Journals (Sweden)

    Kamal M. Dawood

    2017-05-01

    Full Text Available Several pyrazolo[1,5-a]pyrimidine, triazolo[1,5-a]pyrimidine, pyrido[1,2-a]-benzimidazole, pyrimido[1,2-a]benzimidazole, pyrazolo[5,1-c]triazine, triazolo[5,1-c]-triazine, triazino[4,3-a]benzimidazole and 1,3,4-thiadiazole derivatives were synthesized via the reactions of (E-3-oxo-5-phenylpent-4-enenitrile and the versatile, hitherto unreported (E-2-(N,N-dimethylaminomethylene-3-oxo-5-phenyl-4-pentenenitrile with the appropriate nitrogen and sulfur nucleophiles.

  13. Purification and characterization of maleylacetate reductase from Alcaligenes eutrophus JMP134(pJP4).

    OpenAIRE

    Seibert, V; Stadler-Fritzsche, K; Schlömann, M

    1993-01-01

    Maleylacetate reductase (EC 1.3.1.32) plays a major role in the degradation of chloroaromatic compounds by channeling maleylacetate and some of its substituted derivatives into the 3-oxoadipate pathway. The enzyme was purified to apparent homogeneity from an extract of 2,4-dichlorophenoxyacetate (2,4-D)-grown cells of Alcaligenes eutrophus JMP134. Maleylacetate reductase appears to be a dimer of two identical subunits of 35 kDa. The pI was determined to be at pH 5.4. There was no indication o...

  14. Synthesis and antimicrobial properties of 1,3,4-oxadiazole analogs containing dibenzosuberone moiety

    Energy Technology Data Exchange (ETDEWEB)

    Moger, Manjunath [Mangalore University, Karnataka (India). Department of Chemistry; Satam, Vijay; Paniraj, A.S.; Gopinath, Vadiraj S.; Hindupur, Rama Mohan; Pati, Hari N., E-mail: hari.pati@advinus.com [Advinus Therapeutics Ltd., 21 and 22, Phase II, Peenya Industrial Area, Karnataka (India); Govindaraju, Darshan Raj C. [Department of Bio-Medicinal Research, Vidya Herbs Pvt. Ltd., Karnataka (India)

    2014-01-15

    A series of ten novel 1,3,4-oxadiazole analogs containing dibenzosuberone moiety were synthesized using linear as well as convergent synthesis approach. All the compounds were characterized by mass spectrometry, infrared (IR), {sup 1}H and {sup 13}C nuclear magnetic resonance ({sup 1}H NMR and {sup 13}C NMR) spectroscopies and elemental analysis. These compounds were evaluated for antibacterial and antifungal activities. Among ten analogs, four compounds, namely, 8a, 8d, 8e and 8j were found to be highly active antibacterial and antifungal agents (author)

  15. Cesium-134 and strontium-85 turnover rates in the centipede Scolopocryptops nigridia McNeill

    Energy Technology Data Exchange (ETDEWEB)

    Yates, L R; Crossley, Jr, D A

    1979-07-01

    Radioactive tracers are providing significant information about the ecology of food chains, including such phenomena as accumulation of radioactive fission products, movement of materials along food chains, assimilation and ingestion rates, and nutrient accumulation and turnover. In this study the ingestion, assimilation and turnover to two radioactive tracers were investigated for Scolopocryptops nigridia, an abundant species in forests of the southeastern United States. The two tracers utilized, cesium-134 and strontium-85, are metabolic analogs of potassium and calcium, respectively. The research was performed as part of a larger investigation on the population ecology of the centipede species, emphasizing its relations to nutrient cycling and energy flow in a forest floor system.

  16. Investigation into the conditions under which HFC134a may become flammable.

    CSIR Research Space (South Africa)

    Kramers, AP

    2002-01-01

    Full Text Available (massive leakage of refrigerant) can be considered dangerous. Section 6.12 of the standard sets guidelines for machinery areas and plant rooms, and suggests (in point 6.12.1.3) that each plant room must have tight fitting doors that open outwards... of an underground refrigeration plant using HFC134a. The failure may be because of massive leakage of refrigerant, compressor mechanical failure or plant room fires. 26 5.2 Guidelines 1. Preferably ventilate refrigeration plants to return air. Where...

  17. Expeditious synthesis of 1,3,4-oxadiazole derivatives via sydnones

    Directory of Open Access Journals (Sweden)

    D. G. BHADREGOWDA

    2008-02-01

    Full Text Available The clean cyclization of chalcones (1a–c/2a–c with hydrazine hydrate under microwave irradiation afforded pyrazolines derivatised with sydnone (3d–i/4d–i, which underwent 1,3-dipolar cyclo-addition with acetic anhydride to form pyrazolines appended with 1,3,4-oxadiazoles (5g–l/6g–l. The newly synthesized compounds were confirmed by spectral and elemental analyses. In comparison to classical heating, the results indicate that microwave irradiation affords higher yields, shorter reaction times (4–12 min and cleaner reactions.

  18. Antimicrobial activities of pyridinium-tailored pyrazoles bearing 1,3,4-oxadiazole scaffolds

    Directory of Open Access Journals (Sweden)

    Lei Zhou

    2017-11-01

    Full Text Available Herein, a series of pyridinium-tailored 5-trifluoromethylpyrazoles containing 1,3,4-oxadiazole moieties were constructed through coupling key pharmaceutical fragments of pyridinium, pyrazole, and 1,3,4-oxadiazole scaffolds in single molecular architecture. Antimicrobial results suggested that this kind of compounds exhibited significant activities against three types of pathogenic bacteria and six fungal strains in vitro. The minimal EC50 values of designed compounds against Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, and Xanthomonas axonopodis pv. citri could reach to 0.467, 1.04, and 0.600 μg/mL, respectively, through tuning and optimizing N-substituents, bridging atom, and alkyl length of the tailor. Antifungal assays revealed that all title molecules possessed considerable activity against Botrytis cinerea with the minimal EC50 value up to 2.71 μg/mL; and compounds I-8, I-10, I-12, II-12, and IV-12 showed the strongest growth suppression toward Rhizoctonia solani with EC50 values ranging from 10.2 to 24.0 μg/mL. Given the above results, this kind of compounds could serve as new lead compounds in the research of antimicrobial chemotherapy.

  19. Level lifetimes and the nuclear structure of 134,136Xe from inelastic neutron scattering

    Science.gov (United States)

    Peters, E. E.; Chakraborty, A.; Crider, B. P.; Ross, T. J.; Ashley, S. F.; Elhami, E.; Kumar, A.; Liu, S. H.; McEllistrem, M. T.; Mukhopadhyay, S.; Orce, J. N.; Prados-Estévez, F. M.; Yates, S. W.; Hicks, S. F.

    2017-09-01

    The level structures of 134,136Xe were studied with the inelastic neutron scattering reaction followed by γ-ray detection. Highly enriched solid XeF2 samples were used in the measurements. A number of level lifetimes were determined for the first time with the Doppler-shift attenuation method, and the low-lying excited states were characterized from this new spectroscopic information. In 134Xe, the third excited state, a tentative 0+ level, was verified. The 3- octupole phonon has been confirmed, and the complete negative-parity multiplet resulting from the ν (1h11 / 2 2d3 / 2) configuration has been tentatively identified for the first time in the N = 80 isotones. In 136Xe, a nucleus with a closed N = 82 neutron shell, several spins and parities of the states below 3 MeV in excitation energy have been firmly assigned for the first time, or have been re-assigned. New insights into the structures of these nuclei will be discussed. This material is based upon work supported by the U.S. National Science Foundation under Grant No. PHY-1606890.

  20. Imidazole clubbed 1,3,4-oxadiazole derivatives as potential antifungal agents.

    Science.gov (United States)

    Wani, Mohmmad Younus; Ahmad, Aijaz; Shiekh, Rayees Ahmad; Al-Ghamdi, Khalaf J; Sobral, Abilio J F N

    2015-08-01

    A series of compounds in which 2-(4-ethyl-2-pyridyl)-1H-imidazole was clubbed with substituted 1,3,4-oxadiazole was synthesized and subjected to antifungal activity evaluation. In vitro assays indicated that several clubbed derivatives had excellent antifungal activity against different strains of laboratory and clinically isolated Candida species. Structural Activity Relationship (SAR) studies revealed that the presence and position of substituents on the phenyl ring of the 1,3,4-oxadiazole unit, guides the antifungal potential of the compounds, where compound 4b, 4c and 4g were found to be active against all the tested fungal strains. Impairment of ergosterol biosynthesis upon the concomitant treatment of 4b, 4c and 4g, revealed the possible mechanisms of antifungal action of these compounds. Inhibitors snugly fitting the active site of the target enzyme, as revealed by molecular docking studies, may well explain their excellent inhibitory activity. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Synthesis and antitubercular evaluation of imidazo[2,1-b][1,3,4]thiadiazole derivatives

    Directory of Open Access Journals (Sweden)

    Harun M. Patel

    2017-02-01

    Full Text Available In the present study, a series of imidazo[2,1-b][1,3,4]thiadiazole derivatives 5(a–j were synthesized and characterized by IR, 1H NMR, 13C NMR and mass spectral technique. The compounds were evaluated for their in vitro antitubercular activity against Mycobacterium tuberculosis H37Rv strain by using Alamar Blue susceptibility test as part of the TAACF TB screening program under direction of the US National Institutes of Health, the NIAID division. Among the tested compounds, 2-(1-methyl-1H-imidazol-2-yl-6-(4-nitrophenylimidazo[2,1-b][1,3,4]thiadiazole (5f has shown the highest (98% inhibitory activity with MIC of 3.14 μg/ml as compared to other tested compounds. Further, some potent compounds were also assessed for their cytotoxic activity against a mammalian Vero cell line using MTT assay. The results reveal that these compounds exhibit anti-tubercular activity at non-cytotoxic concentrations.

  2. 134Ba diffusion in polycrystalline BaMO3 (M = Ti, Zr, Ce)

    Science.gov (United States)

    Sažinas, Rokas; Sakaguchi, Isao; Einarsrud, Mari-Ann; Grande, Tor

    2017-11-01

    Cation diffusion in functional oxide materials is of fundamental interest, particularly in relation to interdiffusion of cations in thin film heterostructures and chemical stability of materials in high temperature electrochemical devices. Here we report on 134Ba tracer diffusion in polycrystalline BaMO3 (M = Ti, Zr, Ce) materials. The dense BaMO3 ceramics were prepared by solid state sintering, and thin films of 134BaO were deposited on the polished pellets by drop casting of an aqueous solution containing the Ba-tracer. The samples were subjected to thermal annealing and the resulting isotope distribution profiles were recorded by secondary ion mass spectrometry. The depth profiles exhibited two distinct regions reflecting lattice and grain boundary diffusion. The grain boundary diffusion was found to be 4-5 orders of magnitude faster than the lattice diffusion for all three materials. The temperature dependence of the lattice and grain boundary diffusion coefficients followed an Arrhenius type behaviour, and the activation energy and pre-exponential factor demonstrated a clear correlation with the size of the primitive unit cell of the three perovskites. Diffusion of Ba via Ba-vacancies was proposed as the most likely diffusion mechanism.

  3. Purification and Characterization of an Alkali-Thermostable Lipase from Thermophilic Anoxybacillus flavithermus HBB 134.

    Science.gov (United States)

    Bakir, Zehra Burcu; Metin, Kubilay

    2016-06-28

    An intracellular lipase from Anoxybacillus flavithermus HBB 134 was purified to 7.4-fold. The molecular mass of the enzyme was found to be about 64 kDa. The maximum activity of the enzyme was at pH 9.0 and 50°C. The enzyme was stable between pH 6.0 and 11.0 at 25°C, 40°C, and 50°C for 24 h. The Km and Vmax of the enzyme for pNPL substrate were determined as 0.084 mM and 500 U/mg, respectively. Glycerol, sorbitol, and mannitol enhanced the enzyme thermostability. The enzyme was found to be highly stable against acetone, ethyl acetate, and diethyl ether. The presence of PMSF, NBS, DTT and β-mercaptoethanol inhibited the enzyme activity. Hg(2+), Fe(3+), Pb(2+), Al(3+), and Zn(2+) strongly inhibited the enzyme whereas Li(+), Na(+), K(+), and NH4(+) slightly activated it. At least 60% of the enzyme activity and stability were retained against sodium deoxycholate, sodium taurocholate, n-octyl-β-D-glucopyranoside, and CHAPS. The presence of 1% Triton X-100 caused about 34% increase in the enzyme activity. The enzyme is thought to be a true lipase since it has preferred the long-chain triacylglycerols. The lipase of HBB 134 cleaved triolein at the 1- or 3-position.

  4. Decomposition of SF{sub 6}-R134a effluents by RF plasma

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Avinash V., E-mail: alpha_pneumatics@hotmail.com [Alpha Pneumatics, 11-Krishna Kutir, Madanlal Dhigra Road, Panch Pakhadi, Thane 400602 (India)

    2012-01-01

    The efficiency of recovery achieved by open or closed loop extraction of RPC exhaust gases is in the range of 90-95% under optimum conditions. For a large detector setup operating on one volume change per day basis, a 5% loss amounts to discharging 50 kg of R134a and 0.5 kg of SF{sub 6} into atmosphere every day. The emissions are equivalent to create nearly 50 000 m{sup 3} of carbon dioxide daily. The gas emissions need to be completely converted to safer compounds. The gases such as R134a and SF{sub 6} are stable compounds. In order to decompose these, the mixture is first activated by adding of 50% oxygen and 2% argon and under typical RF plasma conditions of 13.56 MHz, 1 Torr pressure and 0.2 W/cm{sup 2} power density. The chemical reaction takes place on the surface of a silicon electrode. The product of the reaction is mainly SiF{sub 4} (gas), which is further hydrolyzed to form HF solution and silicon hydroxide sludge. More than 90% of the effluent gas mixture can be effectively removed by this method.

  5. Cupriavidus necator JMP134 rapidly reduces furfural with a Zn-dependent alcohol dehydrogenase.

    Science.gov (United States)

    Li, Qunrui; Metthew Lam, L K; Xun, Luying

    2011-11-01

    Ethanol is a renewable biofuel, and it can be produced from lignocellulosic biomass. The biomass is usually converted to hydrolysates that consist of sugar and sugar derivatives, such as furfural. Yeast ferments sugar to ethanol, but furfural higher than 3 mM is inhibitory. It can take several days for yeast cells to reduce furfural to non-inhibitory furfuryl alcohol before producing ethanol. Bioreduction of furfural to furfuryl alcohol before fermentation may relieve yeast from furfural toxicity. We observed that Cupriavidus necator JMP134, a strict aerobe, rapidly reduced 17 mM furfural to less than 3 mM within 14 min with cell turbidity of 1.0 at 600 nm at 50°C. The rapid reduction consumed ethanol. The "furfural reductase" (FurX) was purified, and it oxidized ethanol to acetaldehyde and reduced furfural to furfuryl alcohol with NAD(+) as the cofactor. The protein was identified with mass spectrometry fingerprinting to be a hypothetical protein belonging to Zn-dependent alcohol dehydrogenase family. The furX-inactivation mutant of C. necator JMP134 lost the ability to rapidly reduce furfural, and Escherichia coli producing recombinant FurX gained the ability. Thus, an alcohol dehydrogenase enabled bacteria to rapidly reduce furfural with ethanol as the reducing power.

  6. Uptake of cesium-134 by the earthworm species Eisenia foetida and Lumbricus rubellus

    Energy Technology Data Exchange (ETDEWEB)

    Janssen, M.P.M.; Glastra, P.; Lembrechts, J.F.M.M. [National Inst. of Public Health and Environmental Protection, Bilthoven (Netherlands). Lab. of Radiation Research

    1996-06-01

    The uptake processes of {sup 134}Cs in two earthworm species were investigated as well as the effect of temperature on these processes. The results show that equilibrium concentrations in the two species differ by 1.5- to fivefold. Equilibrium concentrations range from 367 to 963 Bq g{sup {minus}1} in Lumbricus rubellus and from 920 to 1,893 g{sup {minus}1} in Eisenia foetida; biological half-lives range from 56 to 119 h and 52 to 64 h, respectively. Assimilation was two to four times higher in E. foetida and elimination rate one to two times higher in E. foetida than in L. rubellus. Further, the results show that temperature may affect the {sup 134}Cs concentration in these earthworms by a factor of 1.4 to 2.1 between 10 and 20 C, depending on the species. The maximum difference found within one species was a factor of 2.6. Their results show no clear effect of temperature on the assimilation, but a small negative effect on elimination, resulting in an increasing biological half-life and concentration factor with higher temperatures.

  7. MicroRNA-134 regulates lung cancer cell H69 growth and apoptosis by targeting WWOX gene and suppressing the ERK1/2 signaling pathway

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Tianjun [Respiratory Department, The First Affiliated Hospital, Xi' an Jiaotong University, No. 277, Yanta West Road, Xi' an, Shaanxi (China); Gao, Fei [Ultrasound Department, Hua-shan Central Hospital of Xi' an, No. 8, Wanshou Middle Road, Xi' an, Shaanxi (China); Feng, Sifang; Yang, Tian [Respiratory Department, The First Affiliated Hospital, Xi' an Jiaotong University, No. 277, Yanta West Road, Xi' an, Shaanxi (China); Chen, Mingwei, E-mail: mingweichenxian@163.com [Respiratory Department, The First Affiliated Hospital, Xi' an Jiaotong University, No. 277, Yanta West Road, Xi' an, Shaanxi (China)

    2015-08-28

    MicroRNAs have been shown to act as crucial modulators during carcinogenesis. Recent studies have implied that miR-134 expression associated with epithelial-to-mesenchymal transition phenotype and invasive potential of NSCLC cells. Our study investigated the pathogenic implications of miR-134 in small cell lung cancer (SCLC). Overexpression or inhibition MiR-134 expression by miR-134 mimics or miR-134 inhibitors (anti-miR-134) in SCLC cell lines was detected using qRT-PCR. Lactate dehydrogenase (LDH) assay, MTT assays and flow cytometry were performed in order to clarify the growth and apoptosis of SCLC cells which had been transfected with miR-134 mimics or anti-miR-134. WWOX expression in H69 cells was detected by qRT-PCR and western blot, respectively. The results showed that overexpression miR-134 was significantly promoting SCLC cells growth and inhibit its apoptosis. In addition, reduced miR-134 expression was significantly correlated with cell growth inhibition and apoptosis promotion. Furthermore, transfection of miR-134 mimics into the SCLC cells markedly down-regulated the level of WWOX, whereas, anti-miR-134 up-regulated WWOX expression. We also found that overexpression WWOX attenuate miR-134 induced H69 cells growth, and promote cell apoptosis. Moreover, miR-134 promoted cell proliferation and inhibit apoptosis via the activation of ERK1/2 pathway. These findings suggest that miR-134 may be an ideal diagnostic and prognostic marker, and may be attributed to the molecular therapy of SCLC. - Highlights: • MiR-134 play roles in small cell lung cancer cell growth and apoptosis. • MiR-134 negative regulated the level of WWOX in H69 cells. • WWOX overexpression attenuate miR-134 induced H69 cells growth. • MiR-134 promotes cell growth via the activation of ERK1/2 pathway.

  8. The effects of soil chemical characteristics on the {sup 134}Cs concentrations in earthworms. Uptake from liquid medium

    Energy Technology Data Exchange (ETDEWEB)

    Janssen, M.P.M.; Glastra, P.; Lembrechts, J.F.M.M. [National Institute of Public Health and the Environment Laboratory of Radiation Research, Bilthoven (Netherlands)

    1997-07-01

    The concentrations of potassium, stable cesium, calcium and ammonium in soil, and of the pH are known to affect the uptake of {sup 134}Cs by plants and soil organisms. It is uncertain as to which extent this is a direct effect on the uptake of {sup 134}Cs (e.g. through competition for binding sites) or an indirect effect through a changing distribution of the {sup 134}Cs between the solid and liquid phase of the soil. Studying the effect of both varying concentrations of potassium, stable cesium, calcium and ammonium and the pH on the uptake of {sup 134}Cs by the earthworms Eisenia foetida and Lumbricus rubellus from solution was, therefore, a means to investigate this effect. The concentrations of {sup 134}Cs in the earthworms were found to differ by a factor of three between the species. Highest and lowest {sup 134}Cs concentration differed by a factor of five within each species. Potassium affected the {sup 134}Cs concentration in the earthworms significantly in contrast to stable cesium. However, the effects expressed per millimole added, were comparable for both elements. The non-significance of stable cesium might have been caused by the small concentration range used. Considering the natural concentrations of potassium and stable cesium in soil solution, addition of potassium was shown to be a more realistic countermeasure. No significant effects from varying pH or calcium and ammonium concentrations were observed. The internal calcium concentration increased with increasing calcium concentration in solution, whereas the internal potassium concentration was independent of the potassium concentration in the solution. (author).

  9. Synthesis of novel sulfonamide-1,2,4-triazoles, 1,3,4-thiadiazoles and 1,3,4-oxadiazoles, as potential antibacterial and antifungal agents. Biological evaluation and conformational analysis studies.

    Science.gov (United States)

    Zoumpoulakis, P; Camoutsis, Ch; Pairas, G; Soković, M; Glamočlija, J; Potamitis, C; Pitsas, A

    2012-02-15

    The significant antifungal activity of a series of sulfonamide-1,2,4-triazole and 1,3,4-thiazole derivatives against a series of micromycetes, compared to the commercial fungicide bifonazole has been reported. These compounds have also shown a comparable bactericidal effect to that of streptomycin and better activity than chloramphenicol against various bacteria. In view of the potential biological activity of members of the 1,2,4-triazole, 1,3,4-thiadiazole and 1,3,4-oxadiazole ring systems and in continuation of our search for bioactive molecules, we designed the synthesis of a series of novel sulfonamide-1,2,4-triazoles, -1,3,4-thiadiazoles and -1,3,4-oxadiazoles emphasizing, in particular, on the strategy of combining two chemically different but pharmacologically compatible molecules (the sulfomamide nucleus and the five member) heterocycles in one frame. Synthesized compounds were tested in vitro for antibacterial and antifungal activity and some analogues exhibited very promising results especially as antifungal agents. In order to explain structure-activity relationships, conformational analysis was performed for active and less active analogues using NMR spectroscopy and molecular modeling techniques. Furthermore, molecular properties which can be further used as descriptors for SAR studies, were predicted for the synthesized analogues. In general, antifungal activity seems to depend more on the triazol-3-thione moiety rather than the different length of the alkyl chain substitutions. Copyright © 2011 Elsevier Ltd. All rights reserved.

  10. Potentially acceptable substitutes for the chlorofluorocarbons: properties and performance features of HFC-134a, HCFC-123, and HCFC-141b

    Science.gov (United States)

    Sukornick, B.

    1989-05-01

    Potentially acceptable substitutes are known for CFC-11 and CFC-12-the most important Chlorofluorocarbons. HFC-134a could replace CFC-12 in airconditioning and refrigeration and both HCFC-123 and HCFC-141b show promise as CFC-11 substitutes. The replacement molecules all have significantly reduced greenhouse and ozone depletion potentials compared to their fully halogenated counterparts. HCFC-123 is theoretically a less efficient blowing agent than CFC-11, but 141b is more efficient. Results from experimental foaming tests confirm these relationships and show that initial insulating values are slightly lower for 141b and 123 than 11. Both substitutes are nonflammable liquids. Based on its physical properties, HFC-134a is an excellent replacement candidate for CFC-12. In addition, it is more thermally stable than CFC-12. A new family of HFC-134a compatible lubricant oils will be required. The estimated coefficient of performance (COP) of 134a is 96 98% that of CFC-12. Subacute toxicity tests show HFC-134a to have a low order of toxicity. HCFC-123 reveals no serious side effects at a concentration of 0.1% in subchronic tests and the inhalation toxicity of 141b is lower than that of CFC-11 based on a 6-h exposure. Chronic tests on all the new candidates will have to be completed for large-scale commercial use. Allied-Signal is conducting process development at a highly accelerated pace, and we plan to begin commercialization of substitutes within 5 years.

  11. All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)

    2014-12-15

    We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.

  12. Altering Residue 134 Confers an Increased Substrate Range of Alkylated Nucleosides to the E. coli OGT Protein

    Directory of Open Access Journals (Sweden)

    Nadia M. Schoonhoven

    2017-11-01

    Full Text Available O6-Alkylguanine-DNA alkyltransferases (AGTs are proteins responsible for the removal of mutagenic alkyl adducts at the O6-atom of guanine and O4-atom of thymine. In the current study we set out to understand the role of the Ser134 residue in the Escherichia coli AGT variant OGT on substrate discrimination. The S134P mutation in OGT increased the ability of the protein to repair both O6-adducts of guanine and O4-adducts of thymine. However, the S134P variant was unable, like wild-type OGT, to repair an interstrand cross-link (ICL bridging two O6-atoms of guanine in a DNA duplex. When compared to the human AGT protein (hAGT, the S134P OGT variant displayed reduced activity towards O6-alkylation but a much broader substrate range for O4-alkylation damage reversal. The role of residue 134 in OGT is similar to its function in the human homolog, where Pro140 is crucial in conferring on hAGT the capability to repair large adducts at the O6-position of guanine. Finally, a method to generate a covalent conjugate between hAGT and a model nucleoside using a single-stranded oligonucleotide substrate is demonstrated.

  13. Altering Residue 134 Confers an Increased Substrate Range of Alkylated Nucleosides to the E. coli OGT Protein.

    Science.gov (United States)

    Schoonhoven, Nadia M; O'Flaherty, Derek K; McManus, Francis P; Sacre, Lauralicia; Noronha, Anne M; Kornblatt, M Judith; Wilds, Christopher J

    2017-11-11

    O⁶-Alkylguanine-DNA alkyltransferases (AGTs) are proteins responsible for the removal of mutagenic alkyl adducts at the O⁶-atom of guanine and O⁴-atom of thymine. In the current study we set out to understand the role of the Ser134 residue in the Escherichia coli AGT variant OGT on substrate discrimination. The S134P mutation in OGT increased the ability of the protein to repair both O⁶-adducts of guanine and O⁴-adducts of thymine. However, the S134P variant was unable, like wild-type OGT, to repair an interstrand cross-link (ICL) bridging two O⁶-atoms of guanine in a DNA duplex. When compared to the human AGT protein (hAGT), the S134P OGT variant displayed reduced activity towards O⁶-alkylation but a much broader substrate range for O⁴-alkylation damage reversal. The role of residue 134 in OGT is similar to its function in the human homolog, where Pro140 is crucial in conferring on hAGT the capability to repair large adducts at the O⁶-position of guanine. Finally, a method to generate a covalent conjugate between hAGT and a model nucleoside using a single-stranded oligonucleotide substrate is demonstrated.

  14. Complete genome sequence of plant growth-promoting bacterium Leifsonia xyli SE134, a possible gibberellin and auxin producer.

    Science.gov (United States)

    Kang, Sang-Mo; Asaf, Sajjad; Kim, Sang-Jun; Yun, Byung-Wook; Lee, In-Jung

    2016-12-10

    Leifsonia xyli SE134 is a potential plant growth-promoting bacterium isolated from a soil in Daegu, Republic of Korea, which produces large amounts of gibberellin (GA) and indole acetic acid (IAA). In this study, we sequenced the complete genome of L. xyli SE134 by the Pacific Biosciences RSII (PacBio) Single Molecule Real Time (SMRT) sequencing technology. The genome of L. xyli SE134 contains a single chromosome that is 3,596,761bp in length, with 70.2% G+C content. The genome contains 3466 protein-coding genes (CDSs) and 51 rRNA- and 46 tRNA-coding genes. By genomic analysis, we identified genes that are potentially involved in plant growth promotion such as genes participating in indole-3-acetic acid (IAA) biosynthesis, siderophore, and trehalose production. L. xyli SE134 also harbours genes for central carbohydrate metabolism, indicating that it can utilise the root exudates with other organic materials as an energy source. Furthermore, the SE134 genome is equipped with various kinds of genes for adaptation to plant surfaces, e.g. defence against desiccation, nutrient deficiencies, and oxidative stress, and a large proportion of genes related to secretion mechanisms and signalling. The genetic information provided here may help to expand this bacterium's biotechnological potential and to further improve its plant growth-promoting characteristics. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Study of integration issues to realize OTEC market potential. First quarterly report. [134 references

    Energy Technology Data Exchange (ETDEWEB)

    None

    1978-12-01

    The specific objective of this study is to examine the commercialization of OTEC technology in the electric utility industry in the Gulf region of the United States. To accomplish this, the project staff is identifying the major issues that will arise in the integration of OTEC units into the power delivery systems in the Gulf Region. Among these issues are problems that must be resolved and barriers to be overcome. These are being identified and alternative approaches to resolving or overcoming them will be explored. Their relative importance in the integration will be assessed as well. The alternative approaches to resolving problems and overcoming barriers will be evaluated to determine their relative effectiveness, and the problems and barriers will be conceptually resolved. This evaluation will permit the recommendation of preferred approaches to integration and the preferred approaches will be assembled into a structured strategy for OTEC commercialization. A list of 134 references relevant to OTEC electric power plant integration issues is included.

  16. Multiwavelength Observations of the Gamma-Ray Blazar PKS 0528+134 in Quiescence

    Science.gov (United States)

    Palma, N. I.; Böttcher, M.; de la Calle, I.; Agudo, I.; Aller, M.; Aller, H.; Bach, U.; Benítez, E.; Buemi, C. S.; Escande, L.; Gómez, J. L.; Gurwell, M. A.; Heidt, J.; Hiriart, D.; Jorstad, S. G.; Joshi, M.; Lähteenmäki, A.; Larionov, V. M.; Leto, P.; Li, Y.; López, J. M.; Lott, B.; Madejski, G.; Marscher, A. P.; Morozova, D. A.; Raiteri, C. M.; Roberts, V.; Tornikoski, M.; Trigilio, C.; Umana, G.; Villata, M.; Wylezalek, D.

    2011-07-01

    We present multiwavelength observations of the ultraluminous blazar-type radio loud quasar PKS 0528+134 in quiescence during the period 2009 July-December. Four Target-of-Opportunity observations with the XMM-Newton satellite in the 0.2-10 keV range were supplemented with optical observations at the MDM Observatory, radio and optical data from the GLAST-AGILE Support Program of the Whole Earth Blazar Telescope and the Very Long Baseline Array, additional X-ray data from the Rossi X-ray Timing Explorer (2-10 keV) and from Suzaku (0.5-10 keV) as well as γ-ray data from the Fermi Large Area Telescope in the 100 MeV-200 GeV range. In addition, publicly available data from the SMARTS blazar monitoring program and the University of Arizona/Steward Observatory Fermi Support program were included in our analysis. We found no evidence of significant flux or spectral variability in γ-rays and most radio bands. However, significant flux variability on a timescale of several hours was found in the optical regime, accompanied by a weak trend of spectral softening with increasing flux. We suggest that this might be the signature of a contribution of unbeamed emission, possibly from the accretion disk, at the blue end of the optical spectrum. The optical flux is weakly polarized with rapid variations of the degree and direction of polarization, while the polarization of the 43 GHz radio core remains steady, perpendicular to the jet direction. Optical spectropolarimetry of the object in the quiescent state suggests a trend of increasing degree of polarization with increasing wavelength, providing additional evidence for an unpolarized emission component, possibly thermal emission from the accretion disk, contributing toward the blue end of the optical spectrum. Over an extended period of several months, PKS 0528+134 shows moderate (amplitude constructed four spectral energy distributions (SEDs) corresponding to the times of the XMM-Newton observations. We find that even in the

  17. HFC-134A and HCFC-22 supermarket refrigeration demonstration and laboratory testing. Phase I. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Aspen Systems and a team of nineteen agencies and industry participants conducted a series of tests to determine the performance of HFC-134a, HCFC-22, and CFC-502 for supermarket application. This effort constitutes the first phase of a larger project aimed at carrying out both laboratory and demonstration tests of the most viable HFC refrigerants and the refrigerants they replace. The results of the Phase I effort are presented in the present report. The second phase of the project has also been completed. It centered on testing all viable HFC replacement refrigerants for CFC-502. These were HFC-507, HFC-404A, and HFC-407A. The latter results are published in the Phase II report for this project. As part of Phase I, a refrigeration rack utilizing a horizontal open drive screw compressor was constructed in our laboratory. This refrigeration rack is a duplicate of one we have installed in a supermarket in Clifton Park, NY.

  18. Experiment on Flow Boiling of HFC134a in a Multi-port Extruded Tube

    Science.gov (United States)

    Kuwahara, Ken; Koyama, Shigeru; Kazari, Kengo; Nakahita, Kouichi

    In the present study, the local heat transfer and pressure drop characteristics are investigated experimentally for the flow boiling of refrigerant HFC134a in a multi-port extruded tube of 1.06mm in hydraulic diameter. The test tube is 865mm in total length made of aluminum. The pressure drop was measured at an interval of 191mm, the local heat transfer coefficient was measured in every subsection of 75mm in effective heating length. The measured pressure drop was compared with a few correlations. Those data agree with the correlation of Koyama et al., proposed for condensation process, and of Friedel. The local heat transfer coefficients were also compared with correlation of Yu et al. It is pointed out that multiplier of the convection term in a rectangular channel is different from that of circular tube.

  19. Experimental investigation of flow and heat transfer characteristics of R-134a in microchannels

    Science.gov (United States)

    Hegab, Hisham E.; Bari, Abdullahel; Ameel, Timothy A.

    2001-09-01

    Fluid flow and heat transfer characteristics of single-phase flows in microchannels for refrigerant R-134a were experimentally investigated. Experiments were conducted using rectangular channels micro-milled in aluminum with hydraulic diameters ranging from approximately 112-mm to 210-mm and aspect ratios that varied from 1.0 to 1.5. Using overall temperature, flow rate, and pressure drop measurements, friction factors and convective heat transfer coefficients were experimentally determined for steady flow conditions. Reynolds number, relative roughness, and channel aspect ratio were the parameters examined in predicting friction factor and Nusselt number for the experiments. Experiment results indicated transition from laminar to turbulent flow occurred between a Reynolds number of 2,000-4,000. Friction factor results were consistently lower than values predicted by macroscale correlations. Nusselt number results indicated channel size may suppress turbulent convective heat transfer. Results also indicate that surface roughness may affect heat transfer characteristics in the turbulent regime.

  20. Semidecoupled band structure in odd-odd sup 134 La and sup 136 Pr

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, J.R.B.; Emediato, L.G.R.; Cybulska, E.W.; Ribas, R.V.; Seale, W.A.; Rao, M.N.; Medina, N.H.; Rizzutto, M.A.; Botelho, S.; Lima, C.L. (Laboratorio Pelletron, Departamento de Fisica Nuclear, Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo (Brazil))

    1992-06-01

    The level schemes of the isotones {sup 134}La and {sup 136}Pr were obtained with in-beam gamma spectroscopy techniques using fusion evaporation reactions with {sup 10}B, {sup 14}N, and {sup 16}O beams and enriched targets of {sup 126,128}Te and {sup 123}Sb. Rotational bands assigned to the {pi}{ital h}{sub 11/2}{direct product}{nu}{ital h}{sub 11/2} configuration were seen in both nuclei. Another band seen in {sup 136}Pr was tentatively assigned to the {pi}(413)5/2{direct product}{nu}{ital h}{sub 11/2} configuration. A beginning of a backbend seems to show up in this band.

  1. The Complete Multipartite Genome Sequence of Cupriavidus necator JMP134, a Versatile Pollutant Degrader

    Energy Technology Data Exchange (ETDEWEB)

    Lykidis, Athanasios; Perez-Pantoja, Danilo; Ledger, Thomas; Mavromatis, Kostantinos; Anderson, Iain J.; Ivanova, Natalia N.; Hooper, Sean D.; Lapidus, Alla; Lucas, Susan; Gonzalez, Bernardo; Kyrpides, Nikos C.

    2010-02-01

    Cupriavidus necator JMP134 (formerly Ralstonia eutropha JMP134) is a Gram-negative {beta}-proteobacterium able to degrade a variety of chloroaromatic compounds and chemically-related pollutants. It was originally isolated based on its ability to use 2,4 dichlorophenoxyacetic acid (2,4-D) as a sole carbon and energy source [1]. In addition to 2,4-D, this strain can also grow on a variety of aromatic substrates, such as 4-chloro-2-methylphenoxyacetate (MCPA), 3-chlorobenzoic acid (3-CB) [2], 2,4,6-trichlorophenol [3], and 4-fluorobenzoate [4]. The genes necessary for 2,4-D utilization have been identified. They are located in two clusters on plasmid pPJ4: tfd{sub I} and tfd{sub II} [5,6,7,8]. The sequence and analysis of plasmid pJP4 was reported and a congruent model for bacterial adaptation to chloroaromatic pollutants was proposed [9]. According to this model, catabolic gene clusters assemble in a modular manner into broad-host-range plasmid backbones by means of repeated chromosomal capture events. Cupriavidus and related Burkholderia genomes are typically multipartite, composed of two large replicons (chromosomes) accompanied by classical plasmids. Previous work with Burkholderia xenovorans LB400 revealed a differential gene distribution with core functions preferentially encoded by the larger chromosome and secondary functions by the smaller [10]. It has been proposed that the secondary chromosomes in many bacteria originated from ancestral plasmids which, in turn, had been the recipient of genes transferred earlier from ancestral primary chromosomes [11]. The existence of multiple Cupriavidus and Burkholderia genomes provides the opportunity for comparative studies that will lead to a better understanding of the evolutionary mechanisms for the formation of multipartite genomes and the relation with biodegradation abilities.

  2. A Theoretical investigation on HC Mixtures as Possible Alternatives to R134a in Vapor Compression Refrigeration

    Directory of Open Access Journals (Sweden)

    Feiza Memet

    2014-07-01

    Full Text Available This paper provides a theoretical comparison of the performance of refrigerants in use in a vapor comparison cycle. It is about the phase-out of R134a from actual refrigeration system, comparison being performed for this chemical and two more ecological mixtures: R290/R600a described as (30/70 and (40/60. Were investigated effects of condensation temperatures and evaporation temperatures on performance measures as COP (Coefficient of Performance and VCC (volumetric cooling capacity. COP is a measure of the performance of the refrigeration cycle, while VCC is an indicator of compressor size. Results of this study will reveal that R290/R600a (30/70 is a good option when it is about substitution of R134a, from energy efficiency point of view, in terms of COP. R290/R600a (40/60 has VCC values bellow the ones of R134a, but comparable.

  3. Development of atmospheric characteristics of chlorine-free alternative fluorocarbons. Report on R-134a and E-143a

    Energy Technology Data Exchange (ETDEWEB)

    Orkin, V.L.; Khamaganov, V.G.; Guschin, A.G.; Kasimovskaya, E.E.; Larin, I.K. [Institut Energeticheskiskh Problem Khimicheskoi Fiziki, Moscow (Russian Federation)

    1993-04-01

    Rate constants have been measured for the gas phase reaction of OH radicals with 1,1,1,2-tetrafluoroethane R-134a (CH{sub 2}F-CF{sub 3}) and methyl trifluoromethyl ether E-143a (CH{sub 3}-O-CF{sub 3}) over the temperature range 298--460 K. Arrhenius expressions were derived for atmospheric modeling. The infrared absorption cross-sections for R-134a and E-143a have been measured in the region from 400 to 1600 cm{sup {minus}1} and the integrated band strengths have been calculated. The atmospheric lifetimes R-134a and E-143a have been estimated to be 11.6 years and 4.1 years respectively. Global warming potentials have been estimated over time horizons of 20, 50, 100, 200, and 500 years.

  4. MicroRNA hsa-miR-134 is a circulating biomarker for mesial temporal lobe epilepsy.

    Directory of Open Access Journals (Sweden)

    Simoni H Avansini

    Full Text Available Epilepsy is misdiagnosed in up to 25% of patients, leading to serious and long-lasting consequences. Recently, circulating microRNAs have emerged as potential biomarkers in a number of clinical scenarios. The purpose of this study was to identify and to validate circulating microRNAs that could be used as biomarkers in the diagnosis of epilepsy. Quantitative real-time PCR was used to measure plasma levels of three candidate microRNAs in two phases of study: an initial discovery phase with 14 patients with mesial temporal lobe epilepsy (MTLE, 13 with focal cortical dysplasia (FCD and 16 controls; and a validation cohort constituted of an independent cohort of 65 patients with MTLE and 83 controls. We found hsa-miR-134 downregulated in patients with MTLE (p = 0.018 but not in patients with FCD, when compared to controls. Furthermore, hsa-miR-134 expression could be used to discriminate MTLE patients with an area under the curve (AUC of 0.75. To further assess the robustness of hsa-miR-134 as a biomarker for MTLE, we studied an independent cohort of 65 patients with MTLE, 27 of whom MTLE patients were responsive to pharmacotherapy, and 38 patients were pharmacoresistant and 83 controls. We confirmed that hsa-miR-134 was significantly downregulated in the plasma of patients with MTLE when compared with controls (p < 0.001. In addition, hsa-miR-134 identified patients with MTLE regardless of their response to pharmacotherapy or the presence of MRI signs of hippocampal sclerosis. We revealed that decreased expression of hsa-miR-134 could be a potential non-invasive biomarker to support the diagnosis of patients with MTLE.

  5. 2-Amino-5-ethyl-1,3,4-thiadiazole as inhibitor of brass corrosion in 3% NaCl

    Directory of Open Access Journals (Sweden)

    Milan Radovanović

    2016-03-01

    Full Text Available The electrochemical behaviour of brass and anticorrosion effect of 2-amino-5- ethyl-1,3,4-thiadiazole (AETD in chloride solution was investigated using electrochemical techniques. Results show that inhibition efficiency depended on inhibitor concentration and immersion time of brass electrode in inhibitor solution. Mechanism of brass corrosion inhibition by 2-amino-5-ethyl-1,3,4-thiadiazole includes adsorption of inhibitor on active sites on electrode surface. Adsorption of AETD in 3% NaCl solution obeys Langmuir adsorption isotherm.

  6. Synthesis, Characterization, and Biological Activity of 5-Phenyl-1,3,4-thiadiazole-2-amine Incorporated Azo Dye Derivatives

    Directory of Open Access Journals (Sweden)

    Chinnagiri T. Keerthi Kumar

    2013-01-01

    Full Text Available 5-Phenyl-1,3,4-thiadiazole-2-amine has been synthesized by single step reaction. A series of heterocyclic azodyes were synthesized by diazotisation of 5-phenyl-1,3,4-thiadiazole-2-amine by nitrosyl sulphuric acid followed by coupling with different coupling compounds such as 8-hydroxyquinoline, 2,6-diaminopyridine, 2-naphthol, N,N-dimethyl aniline, resorcinol, and 4,6-dihydroxypyrimidine. The dyes were characterized by UV-Vis, IR, 1H-NMR, 13C NMR, and elemental analysis. The synthesized compounds were also screened for biological activity.

  7. Synthesis, Characterization, and Biological Activity of 5-Phenyl-1,3,4-thiadiazole-2-amine Incorporated Azo Dye Derivatives

    OpenAIRE

    Chinnagiri T. Keerthi Kumar; Jathi Keshavayya; Tantry N. Rajesh; Sanehalli K. Peethambar; Angadi R. Shoukat Ali

    2013-01-01

    5-Phenyl-1,3,4-thiadiazole-2-amine has been synthesized by single step reaction. A series of heterocyclic azodyes were synthesized by diazotisation of 5-phenyl-1,3,4-thiadiazole-2-amine by nitrosyl sulphuric acid followed by coupling with different coupling compounds such as 8-hydroxyquinoline, 2,6-diaminopyridine, 2-naphthol, N,N-dimethyl aniline, resorcinol, and 4,6-dihydroxypyrimidine. The dyes were characterized by UV-Vis, IR, 1H-NMR, 13C NMR, and elemental analysis. The synthesized compo...

  8. 2-{[5-(Diphenylmethyl-1,3,4-oxadiazol-2-yl]sulfanyl}-N-(pyrazin-2-ylacetamide

    Directory of Open Access Journals (Sweden)

    Balladka Kunhanna Sarojini

    2013-05-01

    Full Text Available S-Alkylation of 5-(diphenylmethyl-1,3,4-oxadiazole-2(3H-thione (3 by 2-chloro-N-(pyrazin-2-ylacetamide (2 affords the title compound, 2-{[5-(diphenylmethyl-1,3,4-oxadiazol-2-yl]sulfanyl}-N-(pyrazin-2-ylacetamide (4. The intermediate (2, in turn, was prepared by the acetylation of 2-aminopyrazine (1 with chloroacetyl chloride. The structure of the newly synthesized compound is characterized by IR, NMR and mass spectral data.

  9. Synthesis and Antiviral Activity of 5‑(4‑Chlorophenyl-1,3,4-Thiadiazole Sulfonamides

    Directory of Open Access Journals (Sweden)

    Yuping Zhang

    2010-12-01

    Full Text Available Starting from 4-chlorobenzoic acid, 10 new 5-(4-chlorophenyl-N-substituted-N-1,3,4-thiadiazole-2-sulfonamide derivatives were synthesized in six-steps. Esterification of 4-chlorobenzoic acid with methanol and subsequent hydrazination, salt formation and cyclization afforded 5-(4-chlorophen-yl-1,3,4-thiadiazole-2-thiol (5. Conversion of this intermediate into sulfonyl chloride 6, followed by nucleophilic attack of the amines gave the title sulfonamides 7a-7j whose structures were confirmed by NMR, IR and elemental analysis. The bioassay tests showed that compounds 7b and 7i possessed certain anti-tobacco mosaic virus activity.

  10. Cellular effects and delivery propensity of penetratin is influenced by conjugation to parathyroid hormone fragment 1-34 in synergy with pH

    DEFF Research Database (Denmark)

    Kristensen, Mie; Nielsen, Line Hagner; Zor, Kinga

    2017-01-01

    the conjugation approach, the PTH(1-34) permeation was significantly enhanced by lowering the pH from 7.4 to 5, but also associated with a compromised barrier and a lowering of the cellular viability. The negative effects on the cellular viability following cellular incubation with the PTH(1-34)-penetratin......The cell-penetrating peptide (CPP) penetratin, has demonstrated potential as a carrier for transepithelial delivery of cargo peptides, such as the therapeutically relevant part of parathyroid hormone, i.e. PTH(1-34). The purpose of the present study was to elucidate the relevance of modifying the pH...... for PTH(1-34)-penetratin conjugates and for co-administered penetratin with PTH(1-34) in terms of transepithelial permeation of PTH(1-34) and cellular effects. Transepithelial permeation was assessed using monolayers of the Caco-2 cell culture model, and effects on Caco-2 cellular viability kinetics were...

  11. Epilepsia tardia: estudo clínico-eletrencefalográfico de 134 casos Late epilepsy: clinical and electroencephalographical study of 134 cases

    Directory of Open Access Journals (Sweden)

    Luís Marques-Assis

    1972-06-01

    Full Text Available De um total de 1.217 pacientes epilépticos foram estudados 134 casos (11% com doença iniciada após os 30 anos. Todos os pacientes eram normais do ponto de vista neurológico, sem sinais ou sintomas de hipertensão intracraniana. Foi feita investigação no que se refere aos antecedentes. Todos os pacientes foram submetidos ao EEG e, 129 casos, ao exame do LCR. Os casos de epilepsia tardia foram estudados, comparativamente com os 1.217 de epilepsia em geral, do ponto de vista eletrencefalográfico, do tempo de doença, da freqüência das crises e da evolução com tratamento medicamentoso. A análise dos resultados obtidos permite as seguintes conclusões: 1 predominaram nos antecedentes o caráter familiar e o traumatismo craniano, em nenhum caso havendo referência a problemas de parto; 2 as crises convulsivas predominaram entre as manifestações (87% dos casos; 3 o tempo de doença foi menor no grupo com epilepsia tardia; 4 houve menor incidência das formas mais severas nas epilepsias tardias, o que traduz maior benignidade da doença quando iniciada após os 30 anos; 5 o exame do LCR foi normal em maior número de casos no grupo das epilepsias tardias em relação às epilepsias em geral; 6 houve maior número de casos com EEG normal e menor número com EEG difuso nas epilepsias tardias em relação às epilepsias em geral; 7 o início tardio da epilepsia não constitui fator que atue negativamente no prognóstico.One hundred thirty four patients with epilepsy begining at the age of 30 years or more, from a group of 1.217 epileptics were studied. All the patients have normal neurologic examination and no signs of intracranial hypertension. The cases were studied regarding the antecedents and were submited to EEG (all cases and CSF examination (129 cases. The group with late epilepsy was studied in relation to the epilepsies in general, regarding the EEG, the disease duration, the frequency of seizures and the evolution with drug

  12. S-Alkylated/aralkylated 2-(1H-indol-3-yl-methyl)-1,3,4- oxadiazole-5 ...

    African Journals Online (AJOL)

    S-Alkylated/aralkylated 2-(1H-indol-3-yl-methyl)-1,3,4- oxadiazole-5-thiol derivatives. 2. Anti-bacterial, enzymeinhibitory and hemolytic activities. Kaniz Rubab, Muhammad A Abbasi, Aziz-ur- Rehman, Sabahat Z Siddiqui, Muhammad Ashraf, Ayesha Shaukat, Irshad Ahmad, Sidra Hassan, Muhammad A Lodhi, Mehreen ...

  13. Tyrosinase Inhibitory Activity, 3D QSAR, and Molecular Docking Study of 2,5-Disubstituted-1,3,4-Oxadiazoles

    Directory of Open Access Journals (Sweden)

    Ramesh L. Sawant

    2013-01-01

    Full Text Available In continuation with our research program, in search of potent enzyme tyrosinase inhibitor, a series of synthesized 2,5-disubstituted 1,3,4-oxadiazoles have been evaluated for enzyme tyrosinase inhibitory activity. Subsequently, 3D QSAR and docking studies were performed to find optimum structural requirements for potent enzyme tyrosinase inhibitor from this series. The synthesized 20 compounds of 2,5-disubstituted-1,3,4-oxadiazole series were screened for mushroom tyrosinase inhibitory activity at various concentrations by enzyme inhibition assay. The percentage enzyme inhibition was calculated by recording absorbance at 492 nm with microplate reader. 3D QSAR and docking studies were performed using VLife MDS 3.5 software. In the series 2,5-disubstituted-1,3,4-oxadiazoles enzyme tyrosinase inhibitory activity was found to be dose dependent with maximum activity for compounds 4c, 4h, 4m, and 4r. 3D QSAR and docking studies revealed that more electropositive and less bulky substituents if placed on 1,3,4-oxadiazole nucleus may result in better tyrosinase inhibitory activity in the series.

  14. 19 CFR 134.46 - Marking when name of country or locality other than country of origin appears.

    Science.gov (United States)

    2010-04-01

    ... Marking Imported Articles § 134.46 Marking when name of country or locality other than country of origin... any foreign country or locality other than the country or locality in which the article was... mislead or deceive the ultimate purchaser as to the actual country of origin of the article, there shall...

  15. Separation of {sup 134}Cs and {sup 137}Cs from {sup 125}I solution for medical applications

    Energy Technology Data Exchange (ETDEWEB)

    Ram, Ramu; Dash, Ashutosh [Bhabha Atomic Research Centre, Trombay, Mumbai (India). Isotope Production and Applications Div.; Banerjee, Dayamoy [Bhabha Atomic Research Centre, Trombay, Mumbai (India). Process Development Div.

    2015-06-01

    While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production {sup 125}I, the concomitant production of {sup 134}Cs and {sup 137}Cs emerged as the primary impediment which necessitates purification of {sup 125}I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify {sup 125}I solution from {sup 134}Cs and {sup 137}Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of {sup 134}Cs and {sup 137}Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in {sup 134}Cs and {sup 137}Cs impurities gets adsorbed leaving behind {sup 125}I to appear in the effluent. The overall recovery of {sup 125}I was >90% with acceptable purity amenable for clinical applications.

  16. Superoxide dismutase/catalase mimetic EUK-134 prevents diaphragm muscle weakness in monocrotalin-induced pulmonary hypertension.

    Science.gov (United States)

    Himori, Koichi; Abe, Masami; Tatebayashi, Daisuke; Lee, Jaesik; Westerblad, Håkan; Lanner, Johanna T; Yamada, Takashi

    2017-01-01

    Patients with pulmonary hypertension (PH) suffer from inspiratory insufficiency, which has been associated with intrinsic contractile dysfunction in diaphragm muscle. Here, we examined the role of redox stress in PH-induced diaphragm weakness by using the novel antioxidant, EUK-134. Male Wistar rats were randomly divided into control (CNT), CNT + EUK-134 (CNT + EUK), monocrotaline-induced PH (PH), and PH + EUK groups. PH was induced by a single intraperitoneal injection of monocrotaline (60 mg/kg body weight). EUK-134 (3 mg/kg body weight/day), a cell permeable mimetic of superoxide dismutase (SOD) and catalase, was daily intraperitoneally administered starting one day after induction of PH. After four weeks, diaphragm muscles were excised for mechanical and biochemical analyses. There was a decrease in specific tetanic force in diaphragm bundles from the PH group, which was accompanied by increases in: protein expression of NADPH oxidase 2/gp91phox, SOD2, and catalase; 3-nitrotyrosine content and aggregation of actin; glutathione oxidation. Treatment with EUK-134 prevented the force decrease and the actin modifications in PH diaphragm bundles. These data show that redox stress plays a pivotal role in PH-induced diaphragm weakness. Thus, antioxidant treatment can be a promising strategy for PH patients with inspiratory failure.

  17. Mechanical strength of 17,134 model proteins and cysteine slipknots.

    Directory of Open Access Journals (Sweden)

    Mateusz Sikora

    2009-10-01

    Full Text Available A new theoretical survey of proteins' resistance to constant speed stretching is performed for a set of 17,134 proteins as described by a structure-based model. The proteins selected have no gaps in their structure determination and consist of no more than 250 amino acids. Our previous studies have dealt with 7510 proteins of no more than 150 amino acids. The proteins are ranked according to the strength of the resistance. Most of the predicted top-strength proteins have not yet been studied experimentally. Architectures and folds which are likely to yield large forces are identified. New types of potent force clamps are discovered. They involve disulphide bridges and, in particular, cysteine slipknots. An effective energy parameter of the model is estimated by comparing the theoretical data on characteristic forces to the corresponding experimental values combined with an extrapolation of the theoretical data to the experimental pulling speeds. These studies provide guidance for future experiments on single molecule manipulation and should lead to selection of proteins for applications. A new class of proteins, involving cysteine slipknots, is identified as one that is expected to lead to the strongest force clamps known. This class is characterized through molecular dynamics simulations.

  18. Masses and pseudomasses of the hand and wrist: MR findings in 134 cases

    Energy Technology Data Exchange (ETDEWEB)

    Capelastegui, A. [Magnetic Resonance OSATEK, Hospital de Galdacano, Vizcaya (Spain); Astigarraga, E.; Merino, A. [Magnetic Resonance OSATEK, Unit of Galdacano, Basque Country (Spain); Fernandez-Canton, G.; Saralegui, I.; Larena, J.A. [Magnetic Resonance OSATEK, Unit of Vitoria, Basque Country (Spain)

    1999-09-01

    Objective. To assess the utility of magnetic resonance imaging (MRI) in the investigation of palpable masses in the hand or wrist.< rate at head-abs-p1.lf>Design and patients. We retrospectively reviewed the MRI examinations and case records of 134 patients referred because of a palpable mass in the hand or wrist. MRI was performed on a 1.0 T magnet using an extremity coil. Intravenous gadolinium-DTPA was injected when considered appropriate.< rate at head-abs-p1.lf>Results and conclusions. MRI demonstrated the cause of the palpable mass in 126 cases (94.02%). Soft tissue neoplasms were found in 34 cases (25.37%). The majority were benign and included giant cell tumours of tendon sheath, lipomas and hemangiomas and had a characteristic appearance. There were three malignant tumours (myxoid liposarcoma, malignant fibroushistiocytoma and rhabdomyosarcoma). Ganglia were found in 36 cases (26.86%) and non-tumour tendon pathology in 31 cases (23.13%). Less common causes included articular diseases (5.97%) and anatomical variants (4.47%). No focal lesion was present in 8 cases (5.97%). In conclusion, MRI is an accurate diagnostic technique in patients who present with a palpable mass of the hand and wrist. (orig.)

  19. Theoretical study on molecular packing and electronic structure of bi-1,3,4-oxadiazole derivatives

    KAUST Repository

    Wang, Haitao

    2014-01-01

    The molecular aggregation structure of 5,5′-bis(naphthalen-2-yl)-2,2′-bi(1,3,4-oxadiazole) (BOXD-NP) was studied by computing the intermolecular interaction potential energy surface (PES) at density functional theory level based on a dimer model. All B3LYP, CAM-B3LYP and M062x functionals can yield a reliable isolated molecular geometry. The conformation of BOXD-NP obtained with all methods is perfectly planar, indicating good conjugation ability between oxadiazole and naphthalene rings. The vibrational frequencies of BOXD-NP were also calculated using the B3LYP/6-311+G∗∗ method, which showed great consistency with the experimental observations and makes the assignments of the IR spectra more solid. It was revealed that the lowest excited state of BOXD-NP should be assigned as a highly allowed π-π∗ state by TD-DFT calculation. Considering the non-covalent interactions in molecular aggregates, the M062x functional was applied in the construction of the PES. Besides the packing structure found in the crystals, PES also predicted several stable structures, indicating that PES has great ability in guiding molecular self-assembly. Symmetry Adapted Perturbation Theory (SAPT) analysis on these energy-minimum molecular stacking structures revealed that London dispersion forces are the strongest attractive component in the binding. This journal is

  20. Association between vision impairment and health among a national cohort of 87,134 Thai adults.

    Science.gov (United States)

    Yiengprugsawan, Vasoontara; Seubsman, Sam-ang; Sleigh, Adrian C

    2015-03-01

    To date, more than 300 million people worldwide live with low vision and blindness, imposing social and economic burdens on individuals and families. This study analyzes a cohort of 87 134 Thai adults, reporting odds ratios (ORs) and calculating population attributable fractions (PAFs). PAF estimates the proportion of the disease or condition that would not occur if no one in the population had the risk factor. Approximately 28% and 8% reported having refractive errors and vision impairment not correctable by visual aids. Both types of vision impairment were positively associated with poor self-assessed health (adjusted ORs = 1.23 to 2.03) and poor psychological health (adjusted ORs = 1.13 to 1.63). PAFs show that refractive errors explain 6.1% of poor self-assessed health, 3.5% of poor psychological health, and 2.2% of falls in the last year. PAFs for vision impairment not correctable by visual aids explain 7.5%, 4.7%, and 3.1%, respectively. Incorporating early detection and prevention of vision impairment at the primary health care level will contribute to promoting the health of Thais. © 2012 APJPH.

  1. New 1,3,4-thiadiazole compounds including pyrazine moiety: Synthesis, structural properties and antimicrobial features

    Science.gov (United States)

    Gür, Mahmut; Şener, Nesrin; Muğlu, Halit; Çavuş, M. Serdar; Özkan, Osman Emre; Kandemirli, Fatma; Şener, İzzet

    2017-07-01

    In the study, some new 1,3,4-thiadiazole compounds were synthesized and we have reported identification of the structures by using UV-Vis, FT-IR, 1H NMR, 13C NMR and Mass spectroscopic methods. Antimicrobial activities of the compounds against three microorganisms, namely, Candida albicans ATCC 26555, Staphylococcus aureus ATCC 9144, and Escherichia coli ATCC 25922 were investigated by using disk diffusion method. These thiadiazoles exhibited an antimicrobial activity against Staphylococcus aureus and Candida albicans. The experimental data was supported by the quantum chemical calculations. Density functional theory (DFT) calculations were carried out to obtain the ground state optimized geometries of the molecules using the B3LYP, M06 and PBE1PBE methods with 3-21 g, 4-31 g, 6-311++g(2d,2p), cc-pvtz and cc-pvqz basis sets in the different combinations. Frontier molecular orbitals (FMOs) energies, band gap energies and some chemical reactivity parameters were calculated by using the aforementioned methods and basis sets, and the results were also compared with the experimental UV-Vis data.

  2. IR assessment of R134a temperature in circular micro-channels

    Science.gov (United States)

    Mihai, Ioan; Suciu, Cornel; Patuleanu, Liliana; Sprinceana, Silviu

    2015-02-01

    Miniature cooling systems performances are increasing, as they permit dissipation of heat fluxes on increasing surfaces. Such cooling systems frequently use micro and nano circular tubes, with rectangular or other various shaped crosssections, as they allow obtaining higher performance micro heat exchangers. The present paper illustrates the differences between temperature variations, experimentally measured inside and outside circular micro-channels by aid of thermo vision, and compared to values experimentally measured outside the micro-channels by aid of heat sensors and to theoretically evaluated temperatures inside. The experimental measurements were performed on a setup conceived for the cooling of electronic components or small bio-surfaces in the order of magnitude of a few square centimeters. The set-up allows reaching minimum negative temperatures of -22 °C. The experimental setup uses a rotary compressor with variable speed and working pressures implicitly, which allows obtaining different temperatures at the setup's evaporator. The present work correlates experimentally measured temperatures with ones determined theoretically for the flow of R134a refrigerant through cylindrical micro-channels made of copper.

  3. Production and characterization of L-fucose dehydrogenase from newly isolated Acinetobacter sp. strain SA-134.

    Science.gov (United States)

    Ohshiro, Takashi; Morita, Noriyuki

    2014-01-01

    Microorganisms producing L-fucose dehydrogenase were screened from soil samples, and one of the isolated bacterial strains SA-134 was identified as Acinetobacter sp. by 16S rDNA gene analysis. The strain grew well utilizing L-fucose as a sole source of carbon, but all other monosaccharides tested such as D-glucose and D-arabinose did not support the growth of the strain in the absence of L-fucose. D-Arabinose inhibited the growth even in the culture medium containing L-fucose. Although the strain grew on some organic acids and amino acids such as citric acid and L-alanine as sole sources of carbon, the enzyme was produced only in the presence of L-fucose. The fucose dehydrogenase was purified to apparently homogeneity from the strain, and the native enzyme was a monomer of 25 kD. L-Fucose and D-arabinose were good substrates for the enzyme, but L-galactose was a poor substrate. The enzyme acted on both NAD(+) and NADP(+) in the similar manner.

  4. 1,3,4-Tri-O-acetyl-2-N-(trifluoroacetyl-β-l-fucose

    Directory of Open Access Journals (Sweden)

    David C. McCutcheon

    2014-02-01

    Full Text Available The title compound, C14H18F3NO8, was produced through conjugation of 1,3,4-tri-O-acetyl-2-azidodeoxy-α,β-l-fucose with trifluoroacetyl chloride in the presence of bis(diphenylphosphinoethane in tetrahydrofuran at room temperature. The X-ray crystal structure reveals that the β-anomer of the product mixture crystallizes from ethyl acetate/hexanes. The compound exists in a typical chair conformation with the maximum possible number of substituents, four out of five, located in the sterically preferred equatorial positions. The major directional force facilitating packing of the molecules are N—H...O hydrogen bonds involving the amide moieties of neighboring molecules, which connect molecules stacked along the a-axis direction into infinite strands with a C11(4 graph-set motif. Formation of the strands is assisted by a number of weaker C—H...O interactions involving the methine and methyl H atoms. These strands are connected through further C—H...O and C—H...F interactions into a three dimensional network

  5. BETA DECAY HALF-LIVES AND RATES OF 134-136SN NUCLEI

    Directory of Open Access Journals (Sweden)

    M KHITER

    2015-12-01

    Full Text Available In astrophysical environment, allowed Gamow-Teller (GT transitions and space phase factors play an important role in determination of transition rates and half-lives, particularly for β-decay in presupernova evolution of massive stars. The estimation of these half-lives in neutron rich nuclei is needed in astrophysics for the understanding of supernovae explosions and the processes of nucleosynthesis, principally the r-process, and in the experimental exploration of the nuclear landscape. Their determination in agreement with experimental results is a challenging problem for nuclear theorists. In this work, the total β-decay half-lives and rates of 134-136Sn nuclei at different temperatures are calculated using various interactions developed in the light of recently available information on experimental binding energies and low-lying spectra of Sn, Sb and Te isotopes in 132Sn mass region. The calculation has been realized using Oxbash code in the frame work of the nuclear shell model. With these interactions, one can observe that the effective half-lives increase and the total decay rates decrease with increasing temperature. A deviation of half-lives starts at around 0.2 MeV and satures above 10 MeV, but the half-lives limit values are slightly different for all interactions.

  6. Design of refrigeration system using refrigerant R134a for macro compartment

    Science.gov (United States)

    Rani, M. F. H.; Razlan, Z. M.; Shahriman, A. B.; Yong, C. K.; Harun, A.; Hashim, M. S. M.; Faizi, M. K.; Ibrahim, I.; Kamarrudin, N. S.; Saad, M. A. M.; Zunaidi, I.; Wan, W. K.; Desa, H.

    2017-10-01

    The main objective of this study is to analyse and design an optimum cooling system for macro compartment. Current product of the refrigerator is not specified for single function and not compact in size. Hence, a refrigeration system using refrigerant R134a is aimed to provide instant cooling in a macro compartment with sizing about 150 × 150 × 250 mm. The macro compartment is purposely designed to fit a bottle or drink can, which is then cooled to a desired drinking temperature of about 8°C within a period of 1 minute. The study is not only concerned with analysing of heat load of the macro compartment containing drink can, but also focused on determining suitable heat exchanger volume for both evaporator and condenser, calculating compressor displacement value and computing suitable resistance value of the expansion valve. Method of optimization is used to obtain the best solution of the problem. Mollier diagram is necessary in the process of developing the refrigeration system. Selection of blower is made properly to allow air circulation and to increase the flow rate for higher heat transfer rate. Property data are taken precisely from thermodynamic property tables. As the main four components, namely condenser, compressor, evaporator and expansion valve are fully developed, the refrigeration system is complete.

  7. Novel pyrazole integrated 1,3,4-oxadiazoles: synthesis, characterization and antimicrobial evaluation.

    Science.gov (United States)

    Ningaiah, Srikantamurthy; Bhadraiah, Umesha K; Doddaramappa, Shridevi D; Keshavamurthy, Shubakara; Javarasetty, Chethan

    2014-01-01

    A novel series of 2-(5-methyl-1,3-diphenyl-1H-pyrazol-4-yl)-5-phenyl-1,3,4-oxadiazoles 7(a-m) were synthesized either by cyclization of N'-benzoyl-5-methyl-1,3-diphenyl-1H-pyrazole-4-carbohydrazide 4a using POCl3 at 120°C or by oxidative cyclization of hydrazones derived from various arylaldehyde and (E)-N'-benzylidene-5-methyl-1,3-diphenyl-1H-pyrazole-4-carbohydrazide 5(a-d) using chloramine-T as oxidant. Newly synthesized compounds were characterized by analytical and spectral (IR, (1)H NMR, (13)C NMR and LC-MS) methods. The synthesized compounds were evaluated for their antimicrobial activity and were compared with standard drugs. The compounds demonstrated potent to weak antimicrobial activity. Among the synthesized compounds, compound 7m emerged as an effective antimicrobial agent, while compounds 7d, 7f, 7i and 7l showed good to moderate activity. The minimum inhibitory concentration of the compounds was in the range of 20-50μgmL(-1) against bacteria and 25-55μgmL(-1) against fungi. The title compounds represent a novel class of potent antimicrobial agents. Copyright © 2013 Elsevier Ltd. All rights reserved.

  8. Potent Anti-seizure Effects of Locked Nucleic Acid Antagomirs Targeting miR-134 in Multiple Mouse and Rat Models of Epilepsy

    Directory of Open Access Journals (Sweden)

    Cristina R. Reschke

    2017-03-01

    Full Text Available Current anti-epileptic drugs (AEDs act on a limited set of neuronal targets, are ineffective in a third of patients with epilepsy, and do not show disease-modifying properties. MicroRNAs are small noncoding RNAs that regulate levels of proteins by post-transcriptional control of mRNA stability and translation. MicroRNA-134 is involved in controlling neuronal microstructure and brain excitability and previous studies showed that intracerebroventricular injections of locked nucleic acid (LNA, cholesterol-tagged antagomirs targeting microRNA-134 (Ant-134 reduced evoked and spontaneous seizures in mouse models of status epilepticus. Translation of these findings would benefit from evidence of efficacy in non-status epilepticus models and validation in another species. Here, we report that electrographic seizures and convulsive behavior are strongly reduced in adult mice pre-treated with Ant-134 in the pentylenetetrazol model. Pre-treatment with Ant-134 did not affect the severity of status epilepticus induced by perforant pathway stimulation in adult rats, a toxin-free model of acquired epilepsy. Nevertheless, Ant-134 post-treatment reduced the number of rats developing spontaneous seizures by 86% in the perforant pathway stimulation model and Ant-134 delayed epileptiform activity in a rat ex vivo hippocampal slice model. The potent anticonvulsant effects of Ant-134 in multiple models may encourage pre-clinical development of this approach to epilepsy therapy.

  9. 42 CFR 435.134 - Individuals who would be eligible except for the increase in OASDI benefits under Pub. L. 92-336...

    Science.gov (United States)

    2010-10-01

    ... increase in OASDI benefits under Pub. L. 92-336 (July 1, 1972). 435.134 Section 435.134 Public Health.... 92-336 (July 1, 1972). The agency must provide Medicaid to individuals who meet the following... except that the increase in OASDI under Pub. L. 92-336 raised his income over the limit allowed under SSI...

  10. Recombinant Adeno-Associated Virus-Mediated microRNA Delivery into the Postnatal Mouse Brain Reveals a Role for miR-134 in Dendritogenesis in Vivo

    DEFF Research Database (Denmark)

    Christensen, Mette; Larsen, Lars A; Kauppinen, Sakari

    2010-01-01

    delivery of microRNAs in vivo by use of recombinant adeno-associated virus (rAAV). rAAV-mediated overexpression of miR-134 in neurons of the postnatal mouse brain provided evidence for a negative role of miR-134 in dendritic arborization of cortical layer V pyramidal neurons in vivo, thereby confirming...

  11. Synthesis of 1,3,4-oxadiazoles from 1,2-diacylhydrazines using [Et2NSF2]BF4 as a practical cyclodehydration agent.

    Science.gov (United States)

    Pouliot, Marie-France; Angers, Laetitia; Hamel, Jean-Denys; Paquin, Jean-François

    2012-02-07

    The preparation of 1,3,4-oxadiazoles from 1,2-diacylhydrazines using XtalFluor-E ([Et(2)NSF(2)]BF(4)) as cyclodehydration reagent is described. Various functionalized 1,3,4-oxadiazoles were synthesized and it was found that the use of acetic acid as an additive generally improved the yields.

  12. Epidemiology of complex regional pain syndrome: a retrospective chart review of 134 patients.

    Science.gov (United States)

    Allen, G; Galer, B S; Schwartz, L

    1999-04-01

    Complex regional pain syndrome (CRPS) remains a poorly understood chronic pain disorder. Little data has been published assessing the epidemiology of CRPS (and reflex sympathetic dystrophy, RSD). This study assessed epidemiological variables in 134 CRPS patients evaluated at a tertiary chronic pain clinic in the US, including demographic, health care utilization and legal/workman's compensation measures. In addition, the frequency of physician-imposed immobilization of the CRPS limb was assessed, as was physical examination evidence of myofascial dysfunction. This study found that these patients had seen on average 4.8 different physicians before referral to the pain center and had received an average of five different kinds of treatments both prior to and during pain clinic treatment. The mean duration of CRPS symptoms prior to pain center evaluation was 30 months. Seventeen percent had a lawsuit and 54% had a worker compensation claim related to the CRPS. Fifty-one patients received a bone scan, but only 53% of which were interpreted as consistent with the diagnosis of RSD/CRPS. Forty-seven percent had a history of physician-imposed immobilization, and 56% had a myofascial component present at evaluation. The duration of CRPS symptoms and the involvement of the upper extremity was significantly associated with the presence of myofascial dysfunction. Thus, this study found that most CRPS patients are referred to a pain specialty clinic after several years of symptoms and many failed therapies. The data also suggest the lack of utility of a diagnostic bone scan and highlight the prominence of myofascial dysfunction in a majority of CRPS patients.

  13. Controllable molecular aggregation and fluorescence properties of 1,3,4-oxadiazole derivative

    KAUST Repository

    Li, Min

    2015-10-14

    The molecular self-assembly behaviour of 2,2’-Bis-(4-hexyloxyphenyl)-bi-1,3,4-oxadiazole (BOXD-6) in solution, on surfaces and in bulk crystals, and its photo-physical properties were studied via a combination of experimental techniques and theoretical calculations. It is found that BOXD-6 molecules self-assemble into both H- and J-aggregates at moderate concentration (~10-4 M) and then transit to exclusive J-aggregates at higher concentration (~10-3 M) in tetrahydrofuran. In H-aggregation (α polymorph), BOXD-6 adopts a linear conformation and forms a one- dimensional layered structure; in J-aggregation (β polymorph), it adopts a Z-shaped conformation and form a more ordered two-dimensional layered structure. A π-stacking structure is observed in both cases, and adjacent molecules in the J-aggregation show larger displacement along the molecular long axis direction than that in H-aggregation. Although J-aggregates are almost the only component in concentrated solutions (10-3 M), both H- and J-aggregates can be obtained if concentrated solution is transformed onto substrates through a simple drop-casting method. Such a phase transition during film formation can be easily avoided by adding water as precipitator; a film with pure J-aggregates is then obtained. In order to get more information on molecular self-assembly, intermolecular interaction potential energy surfaces (PES) were evaluated via theoretical calculations at the DFT level (M062x/6-31G**). The PES not only confirm the molecular stacking structures found in crystals but also predict some other likely structures, which will be the target of future experiments.

  14. Effect of waste mica on transfer factors of {sup 134}Cs to spinach and lettuce; Effet de dechets de mica sur les facteurs de transfert du {sup 134}Cs a l'epinard et la laitue

    Energy Technology Data Exchange (ETDEWEB)

    Sreenivasa Chari, M.; Manjaiah, K.M. [Indian Agricultural Research Institute, Division of Soil Science and Agricultural Chemistry, New Delhi - 110012 (India); Sachdev, P.; Sachdev, M.S. [Indian Agricultural Research Institute, Nuclear Research Laboratory, New Delhi - 110012 (India)

    2011-07-15

    A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg{sup -1}) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in {sup 134}Cs-contaminated (at 37 k Bq kg{sup -1} soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average {sup 134}Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg{sup -1} soil. There exists an inverse relationship between the {sup 134}Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)

  15. 1-[2-(4-Chlorophenyl-5-phenyl-2,3-dihydro-1,3,4-oxadiazol-3-yl]ethanone

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2012-06-01

    Full Text Available In the title compound, C16H14ClN3O2, the 2,3-dihydro-1,3,4-oxadiazole ring [maximum deviation = 0.030 (1 Å] and the pyridine ring [maximum deviation = 0.012 (1 Å] are inclined slightly to one another, making a dihedral angle of 11.91 (5°. The chloro-substituted phenyl ring is almost perpendicular to the 2,3-dihydro-1,3,4-oxadiazole and pyridine rings at dihedral angles of 86.86 (5 and 75.26 (5°, respectively. In the crystal, π–π [centroid–centroid distance = 3.7311 (6 Å] and C—H...π interactions are observed.

  16. Eosin Y Catalyzed Visible-light-promoted One –Pot Facile Synthesis of 1,3,4- Thiadiazole

    Directory of Open Access Journals (Sweden)

    Vishal Srivastava

    2015-03-01

    Full Text Available A novel one-pot visible light irradiated synthesis of 1,3,4-thiadiazole from aldehydes and thioacyl hydrazides have been reported in presence of eosin Y as an organophotoredox catalyst at room temperature under aerobic condition. This synthesis includes application of air and visible light as inexpensive, readily available, non-toxic and sustainable regents, which fulfils the basic principle of green chemistry.

  17. Endogenous PTH deficiency impairs fracture healing and impedes the fracture-healing efficacy of exogenous PTH(1-34.

    Directory of Open Access Journals (Sweden)

    Yongxin Ren

    Full Text Available Although the capacity of exogenous PTH1-34 to enhance the rate of bone repair is well established in animal models, our understanding of the mechanism(s whereby PTH induces an anabolic response during skeletal repair remains limited. Furthermore it is unknown whether endogenous PTH is required for fracture healing and how the absence of endogenous PTH would influence the fracture-healing capacity of exogenous PTH.Closed mid-diaphyseal femur fractures were created and stabilized with an intramedullary pin in 8-week-old wild-type and Pth null (Pth(-/- mice. Mice received daily injections of vehicle or of PTH1-34 (80 µg/kg for 1-4 weeks post-fracture, and callus tissue properties were analyzed at 1, 2 and 4 weeks post-fracture. Cartilaginous callus areas were reduced at 1 week post-fracture, but were increased at 2 weeks post-fracture in vehicle-treated and PTH-treated Pth(-/- mice compared to vehicle-treated and PTH-treated wild-type mice respectively. The mineralized callus areas, bony callus areas, osteoblast number and activity, osteoclast number and surface in callus tissues were all reduced in vehicle-treated and PTH-treated Pth(-/- mice compared to vehicle-treated and PTH-treated wild-type mice, but were increased in PTH-treated wild-type and Pth(-/- mice compared to vehicle-treated wild-type and Pth(-/- mice.Absence of endogenous PTH1-84 impedes bone fracture healing. Exogenous PTH1-34 can act in the absence of endogenous PTH but callus formation, including accelerated endochondral bone formation and callus remodeling as well as mechanical strength of the bone are greater when endogenous PTH is present. Results of this study suggest a complementary role for endogenous PTH1-84 and exogenous PTH1-34 in accelerating fracture healing.

  18. Novel bisthioether derivatives containing a 1,3,4-oxadiazole moiety: Design, synthesis, antibacterial and nematocidal activities.

    Science.gov (United States)

    Li, Pei; Tian, Pingyi; Chen, Yongzhong; Song, Xianpeng; Xue, Wei; Jin, Linhong; Hu, Deyu; Yang, Song; Song, Baoan

    2017-10-12

    Literature revealed that bisthioether and 1,3,4-oxadiazole derivatives exhibited a wide variety of biological activities. In this study, a series of novel bisthioether derivatives containing a 1,3,4-oxadiazole moiety were synthesized and their antibacterial and nematocidal activities were investigated. Among the title compounds evaluated, compound 4f demonstrated the best antibacterial activities against rice bacterial leaf blight, rice bacterial leaf streak and citrus canker caused by Xanthomonas oryzae pv. oryzae (Xoo), Xanthomonas oryzae pv. oryzicola (Xoc), and Xanthomonas axonopodis pv. citri (Xac), respectively, with the EC50 values of 4.82, 11.15, and 16.57 μg mL(-1) , respectively, which were even better than those of thiodiazole copper and bismerthiazol. Meanwhile, compound 4f revealed better in vitro nematocidal activity against Caenorhabditis elegans (C. elegans) at 48 h, with a LC50 value of 2.89 μg mL(-1) , which was superior to those of ethoprophos and fosthiazate. In addition, the greenhouse trials indicated that compound 4f was effective in reducing rice bacterial leaf blight relative to those of thiodiazole copper and bismerthiazol. A series of novel bisthioether derivatives containing a 1,3,4-oxadiazole moiety were synthesized and bioassay results showed that compound 4f exhibited the best antibacterial and nematocidal activities. This article is protected by copyright. All rights reserved.

  19. Performance characteristics of low global warming potential R134a alternative refrigerants in ejector-expansion refrigeration system

    Directory of Open Access Journals (Sweden)

    Mishra Shubham

    2016-12-01

    Full Text Available Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%, which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle. Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.

  20. Synthesis, Evaluation and Characterization of Some 1,3,4-Triazole-2-one Derivatives as Antimicrobial Agents

    Directory of Open Access Journals (Sweden)

    Mahabaleshwaraiah Neelgundmath

    2012-01-01

    Full Text Available A series of novel compounds like 3[(phenyl substituted-5-methyl-1(Benzosulphonylamine]-1,3,4-triazole-2-ones II(a-f were synthesized by treating 4-amino-1-phenyl-3-methyl-5-oxo-1,2,4-triazoles with benzene sulphonyl chloride using pyridine as solvent. Similarly by using 4-amino-1-aryl-3-methyl-5-oxo-1,2,4-triazoles and acetic anhydride as starting material 3[(phenyl substituted-5-methyl-1(acetylamino]-1,3,4-triazole-2-ones III(a-f were synthesized and also 3[(phenyl substituted-5-methyl-1(chloroacetyl]-1,3,4-triazole-2-ones I(a-f were synthesized by treating 4-amino-1-aryl-3-methyl-5-oxo-1,2,4-triazoles with chloroacetyl chloride in presence of a non-polar solvent like benzene. Elemental analysis, GCMS, IR, and 1H NMR confirmed the structures of the newly synthesised compounds. The newly synthesized compounds are also screened for their antibacterial, antifungal and anti-inflammatory activities.

  1. Synthesis, characterization and pharmacological evaluation of different 1,3,4-oxadiazole and acetamide derivatives of ethyl nipecotate

    Directory of Open Access Journals (Sweden)

    Khadija Nafeesa

    2017-12-01

    Full Text Available A new series of N-substituted derivatives of 2-[(5-{1-[(4-chlorophenylsulfonyl]-3-piperidinyl}-1,3,4-oxadiazol-2-ylsulfanyl]acetamide (6a-w has been designed and synthesized with multifunctional moieties. The synthesized compounds were evaluated for their antibacterial and anti-enzymatic potential supported by % hemolytic activity. The synthesized compound 5-(1-(4-chlorophenylsulfonyl-3-piperidinyl-1,3,4-oxadiazole-2-thiol (3 was stirred with synthesized electrophiles as N-aryl/alkyl/aralkyl-2-bromoacetamide (5a-w in an aprotic solvent under basic conditions to acquire the target molecules, 6a-w. The spectral analytical techniques of IR, EI-MS, 1H NMR and 13C-NMR were utilized for structural elucidation of synthesized molecules. The antibacterial screening against certain bacterial strains of gram-negative and gram-positive bacteria rendered compound 6i as good inhibitor of gram-negative bacterial strains. The enzyme inhibition revealed low potential against lipoxygenase (LOX enzyme. The hemolytic study provided valuable information about cytotoxic behavior of synthesized molecules. Keywords: 1,3,4-Oxadiazole, Acetamide, Antibacterial activity, Hemolytic activity, Lipoxygenase inhibition

  2. Evaporation flow pattern and heat transfer of R-22 and R-134a in small diameter tubes

    Science.gov (United States)

    Oh, Hoo-Kyu; Son, Chang-Hyo

    2011-06-01

    The flow patterns and heat transfer coefficients of R-22 and R-134a during evaporation in small diameter tubes were investigated experimentally. The evaporation flow patterns of R-22 and R-134a were observed in Pyrex sight glass tubes with 2 and 8 mm diameter tube, and heat transfer coefficients were measured in smooth and horizontal copper tubes with 1.77, 3.36 and 5.35 mm diameter tube, respectively. In the flow patterns during evaporation process, the annular flows in 2 mm glass tube occurred at a relatively lower vapor quality compared to 8 mm glass tube. The flow patterns in 2 mm glass tube did not agree with the Mandhane's flow pattern maps. The evaporation heat transfer coefficients in the small diameter tubes ( d i heat transfer coefficients of 1.77 mm tube were higher than those of 3.36 mm and 5.35 mm tube. Most of the existing correlations failed to predict the evaporation heat transfer coefficient in small diameter tubes. Therefore, based on the experimental data, the new correlation is proposed to predict the evaporation heat transfer coefficients of R-22 and R-134a in small diameter tubes.

  3. Teriparatide (PTH 1-34) treatment increases peripheral hematopoietic stem cells in postmenopausal women.

    Science.gov (United States)

    Yu, Elaine W; Kumbhani, Ruchit; Siwila-Sackman, Erica; DeLelys, Michelle; Preffer, Frederic I; Leder, Benjamin Z; Wu, Joy Y

    2014-06-01

    Cells of the osteoblast lineage play an important role in regulating the hematopoietic stem cell (HSC) niche and early B-cell development in animal models, perhaps via parathyroid hormone (PTH)-dependent mechanisms. There are few human clinical studies investigating this phenomenon. We studied the impact of long-term daily teriparatide (PTH 1-34) treatment on cells of the hematopoietic lineage in postmenopausal women. Twenty-three postmenopausal women at high risk of fracture received teriparatide 20 mcg sc daily for 24 months as part of a prospective longitudinal trial. Whole blood measurements were obtained at baseline, 3, 6, 12, and 18 months. Flow cytometry was performed to identify hematopoietic subpopulations, including HSCs (CD34+/CD45(moderate); ISHAGE protocol) and early transitional B cells (CD19+, CD27-, IgD+, CD24[hi], CD38[hi]). Serial measurements of spine and hip bone mineral density (BMD) as well as serum P1NP, osteocalcin, and CTX were also performed. The average age of study subjects was 64 ± 5 years. We found that teriparatide treatment led to an early increase in circulating HSC number of 40% ± 14% (p = 0.004) by month 3, which persisted to month 18 before returning to near baseline by 24 months. There were no significant changes in transitional B cells or total B cells over the course of the study period. In addition, there were no differences in complete blood count profiles as quantified by standard automated flow cytometry. Interestingly, the peak increase in HSC number was inversely associated with increases in bone markers and spine BMD. Daily teriparatide treatment for osteoporosis increases circulating HSCs by 3 to 6 months in postmenopausal women. This may represent a proliferation of marrow HSCs or increased peripheral HSC mobilization. This clinical study establishes the importance of PTH in the regulation of the HSC niche within humans. © 2014 American Society for Bone and Mineral Research. © 2014 American Society for

  4. Different NK cell-activating receptors preferentially recruit Rab27a or Munc13-4 to perforin-containing granules for cytotoxicity

    DEFF Research Database (Denmark)

    Wood, Stephanie M; Meeths, Marie; Chiang, Samuel C C

    2009-01-01

    of perforin-containing lytic granules induced by signals for natural and antibody-dependent cellular cytotoxicity. We demonstrate here that these signals fail to induce degranulation in resting NK cells from Rab27a-deficient patients. In resting NK cells from healthy subjects, endogenous Rab27a and Munc13...... functional antigen-1, NKG2D, or 2B4 induced colocalization of Rab27a, but not Munc13-4, with perforin. Conversely, engagement of antibody-dependent cellular cytotoxicity receptor CD16 induced colocalization of Munc13-4, but not Rab27a, with perforin. Furthermore, colocalization of Munc13-4 with perforin...

  5. Emissions of CO2, CO, NOx, HC, PM, HFC-134a, N2O and CH4 from the global light duty vehicle fleet

    Directory of Open Access Journals (Sweden)

    Timothy J. Wallington

    2008-04-01

    Full Text Available Vehicles emit carbon dioxide (CO2, carbon monoxide (CO, nitrogen oxides (NOx, hydrocarbons (HC, particulate matter (PM, hydrofluorocarbon 134a (HFC-134a, methane (CH4, and nitrous oxide (N2O. An understanding of these emissions is needed in discussions of climate change and local air pollution issues. To facilitate such discussions an overview of past, present, and likely future emissions from light duty vehicles is presented. Emission control technologies have reduced the emissions of CO, VOCs, PM, HFC-134a, CH4, and N2O from modern vehicles to very low levels.

  6. Synthesis, characterization and RHF/ab initio simulations of 2-amino-1,3,4-thiadiazole and its annulated ring junction pyrimidine derivatives.

    Science.gov (United States)

    Hamama, Wafaa S; Gouda, Moustafa A; Soliman, Mamdouh S; Badr, Marwa H; Zoorob, Hanafi H

    2013-01-01

    Michael addition reaction of the 2-amino-1,3,4-thiadiazole to chalcone as biselectrophile afforded 5,7-diphenyl-6-[1,3-diphenylpropan-1-on-3-yl][1,3,4]thiadiazolo[3,2-a]pyrimidine (3) instead of 5,7-diphenyl-5H-[1,3,4]thiadiazolo[3,2-a]pyrimidine (5) via further Michael addition at C5 in pyrimidine moiety. The structure 3 was established through the aspect of ab initio calculations, elemental analysis and spectral data.

  7. Synthesis, characterization and RHF/ab initio simulations of 2-amino-1,3,4-thiadiazole and its annulated ring junction pyrimidine derivatives

    Directory of Open Access Journals (Sweden)

    Wafaa S. Hamama

    2013-01-01

    Full Text Available Michael addition reaction of the 2-amino-1,3,4-thiadiazole to chalcone as biselectrophile afforded 5,7-diphenyl-6-[1,3-diphenylpropan-1-on-3-yl][1,3,4]thiadiazolo[3,2-a]pyrimidine (3 instead of 5,7-diphenyl-5H-[1,3,4]thiadiazolo[3,2-a]pyrimidine (5 via further Michael addition at C5 in pyrimidine moiety. The structure 3 was established through the aspect of ab initio calculations, elemental analysis and spectral data.

  8. Impact of {sup 134}Cs and {sup 137}Cs from the Chernobyl reactor accident on the Spanish Mediterranean marine environment

    Energy Technology Data Exchange (ETDEWEB)

    Molero, J.; Sanchez-Cabeza, J.A.; Merino, J. [Grup de Fisica de les Radiacions, Departament de Fisica, Facultat de Ciencies, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Mitchell, P.I. [Laboratory of Radiation Physics, University College, Dublin (Ireland); Vidal-Quadras, A. [Grup de Fisica de les Radiacions, Departament de Fisica, Facultat de Ciencies, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain)

    1999-05-01

    As part of a study aiming to establish the distribution and bioavailability of man-made radionuclides in the marine environment, radiocaesium levels were determined in large volume sea water samples and in the sea-grass Posidonia oceanica collected along the Spanish Mediterranean coast. Results obtained from 1987 to 1991 showed the enhancement of radiocaesium levels in the Spanish Mediterranean marine environment after the Chernobyl accident. The well-known {sup 134}Cs/{sup 137}Cs isotopic ratio in Chernobyl fresh deposition was used to identify the weapon tests fall-out and Chernobyl deposition components. {sup 137}Cs and {sup 134}Cs mean concentrations in surface waters from the Spanish Mediterranean shoreline were 4.8{+-}0.2 and 0.27{+-}0.01 Bq m{sup -3}, respectively. {sup 137}Cs concentration incorporated into Mediterranean waters as a consequence of the post-Chernobyl deposition was estimated to be 1.16{+-}0.04 Bq m{sup -3}, which is a 33{+-}2% increase over the previous levels. {sup 137}Cs estimated inventory in the surface water layer (0-50 m) of the Catalan-Balearic basin was 17.4{+-}0.5 TBq for {sup 137}Cs, of which 4.3{+-}0.2 TBq must be attributed to post-Chernobyl deposition, and 1.00{+-}0.04 TBq for {sup 134}Cs. Activation and fission products such as {sup 106}Ru, {sup 110m}Ag, {sup 134}Cs, {sup 137}Cs and {sup 144}Ce, were detected in all samples of Posidonia oceanica. Mean radiocaesium levels in the bioindicator were 1.02{+-}0.25 and 0.20{+-}0.03 Bq kg{sup -1} for {sup 137}Cs and {sup 134}Cs, respectively, corresponding to a mean isotopic ratio {sup 134}Cs/{sup 137}Cs equal to 0.20{+-}0.04 (1987). {sup 137}Cs activity incorporated by Posidonia oceanica after the Chernobyl deposition over the Mediterranean Sea was estimated as 0.51{+-}0.08 Bq kg{sup -1}. Therefore, {sup 137}Cs specific activity had increased 100{+-}40% one year after the accident. Low level radioactive liquid effluents from the nuclear power plants located on the southern Catalan

  9. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    INTRODUCTION. Fluorescent materials, particularly blue fluorescent materials have gained strong interest because ... emitting complexes in different technical applications, such as emitting materials for organic light emitting ..... properties of three novel two-dimensional lanthanide coordination polymers with mixed aromatic ...

  10. Pyroelectric Ferroelectric and Resistivity Studies on Samarium ...

    African Journals Online (AJOL)

    Barium Strontium Sodium Niobate (Ba1-xSrx)2NaNb5O15 (BSNN) belongs to tungsten bronze ferroelectric morphotrophic phase boundary (MPB) system at x = 0.6, having large spontaneous polarisation, pyroelectric coefficient and low dielectic constant and is expected to be applicable for piezoceramic filter and ...

  11. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    emitting complexes in different technical applications, such as emitting materials for organic light emitting diodes, sensitizers in solar energy conversion, chemical sensors and so forth [6-9]. The ability of bipy to act as a rigid ..... properties of three-dimensional organic-inorganic hybrids based on α-metatungstate. Inorg. Chim.

  12. Estimation of total released amount of Cs-137 and Cs-134 derived from TEPCO-FNPP1 accident into the North Pacific Ocean by using optimal interpolation analysis

    Science.gov (United States)

    Inomata, Yayoi; Aoyama, Michio; Tsubono, Takaki; Tsumune, Daisuke; Hirose, Katsumi

    2015-04-01

    The oceanic distribution of Cs-137 and Cs-134 released from the Tokyo Electric Power Company-Fukushima Daiichi Nuclear Power Plant (TEPCO-FNPP1) accident were investigated by using the optimal interpolation (OI) analysis. The two domains (open ocean, >141.5°E; coastal region near the TEPCO-FNPP1, inventory of FNPP1-released Cs-134 in the North Pacific Ocean is estimated to be 15.2±1.8 PBq. In these, about half (8.3±1.8 PBq) of the total released Cs-134 amount existed in the coastal region near the TEPCO-FNPP1. It appeared that the total OICs134 inventory, which is defined as a total Cs-134 inventory in the coastal area near the TEPCO-FNPP1, is controlled by direct release, atmospheric deposition, and coastal current system. Leak of stagnant water induced by heavy rainfall would also cause the increase of the total OICs134 inventory. After the direct discharge of the contaminated water ceased on 6 April, 2011, the total OICs134 inventory exponentially with a half-time of 4.2±0.5 days and became to about 2.0±0.4 PBq at the middle of May 2011. Considering that the Cs-134/Cs-137 activity ratios for the FNPP1 accident were very close to one (0.99±0.03) and extremely uniform during the first month, the total amount of Cs-137 released by the TEPCO-FNPP1 accident reached to 20% of a current North Pacific inventory (60 PBq, Aoyama et al., 2012) of bomb-derived Cs-137 injected in the 1950s and early 1960s.

  13. A New Route to Synthesis of 3,6-Diaryl-1,2,4- triazolo [ 3,4-b ] 1,3,4-oxadiazoles

    Institute of Scientific and Technical Information of China (English)

    QIU,Zao-Zao; DAI,Chao-Feng; CHAO,Shu-Jun; HUI,Xin-Ping; XU,Peng-Fei

    2004-01-01

    @@ Various 1,2,4-triazoles and 1,3,4-oxadiazole derivatives have been reported to possess diverse biological activities.In addition to above biological activity, we coupled these two rings together to get 1,2,4-triazolo[3,4-b] 1,3,4-oxadiazole derivatives. This ring system was first reported in 1961[1] and synthesized in 1971.

  14. Dry deposition of particulate Cs-134 to several leafy vegetable species and comparison to deposition of gaseous radioiodine

    Energy Technology Data Exchange (ETDEWEB)

    Tschiersch, J.; Shinonaga, T.; Heuberger, H. [GSF-National Research Center for Environment and Health, Institute of Radiation Protection, Neuherberg, (Germany)

    2004-07-01

    The height of the dry deposition of particulate radionuclides to leafy vegetable is quite uncertain because of the different habit, surface texture and leaf uptake of the different species. There is no comparative data on the deposition to various species, but leafy vegetables are taken as reference plants for the estimation of the height of contamination of vegetable foods after a nuclear accident. Therefore new chamber experiments were performed to determine under homogeneous and controlled conditions the dry deposition of particulate radio-caesium on mature leafy vegetable. The simultaneous exposition of endive, head lettuce, red oak leaf lettuce and spinach (spring leafy vegetable) rsp. curly kale, white cabbage and spinach (summer leafy vegetable) was arranged. The sample collective of each species was such large that for the expected variation of the results a statistically firm analysis was possible. For spring vegetable, there was no significant difference observed in deposition of {sup 134}Cs between spinach and leaf lettuce, about twice the amount was deposited on both species as on endive and 3 times as on head lettuce. All summer vegetables showed differences in deposition for Caesium, the deposition to curly kale was highest, about twice that on spinach and 35 times (80 times) that on white cabbage. The normalized deposition velocity could be estimated, in average it was about 8 times lower for {sup 134}Cs than for gaseous elemental {sup 131}I. The influence of the particle size on the deposition velocity was small in the considered size range of 0.58-1.1{mu}m (AMAD) of the monodisperse aerosol. Washing could reduce the contamination by about 45% for {sup 134}Cs. (author)

  15. Synthesis, characterization of some novel 1,3,4-oxadiazole compounds containing 8-hydroxy quinolone moiety as potential antibacterial and anticancer agents

    Directory of Open Access Journals (Sweden)

    Vinayak Mahadev Adimule

    2014-12-01

    Full Text Available In the present work a series of novel derivatives of 8-hydroxy quinolone substituted 1,3,4-oxadiazole compounds were synthesized by convergent synthetic method and studied for their antibacterial and anticancer properties. The cell lines used for cytotoxic evaluation were HeLa, Caco-2 and MCF7. The synthetic chemistry involved conversion of various substituted aromatic acids into ethyl ester 2a-e. The ethyl ester was converted into corresponding carbohydrazide 3a-e. Carbohydrazides are reacted with chloroacetic acid, phosphorous oxytrichloride and irradiated with microwave in order to obtain the various key intermediates 2-(chloromethyl-5-(substituted phenyl-1,3,4-oxadiazole 4a-e. The 2-(chloromethyl-5-(substituted phenyl-1,3,4-oxadiazole was reacted with 8-hydroxy quinolone in presence of sodium hydride and obtained a series of 8-hydroxy quinoline substituted 1,3,4-oxadiazoles 5a-e. Among the synthesised compounds, the cytotoxicity of the compound 5b i.e. 8-{[5-(2,4-dichlorophenyl-1,3,4-oxadiazol-2-yl]methoxy}quinoline against MCF7 with IC50 of 5.3µM and the compound 5e i.e. 8-{[5-(4-bromophenyl-1,3,4-oxadiazol-2-yl]methoxy}quinoline showed MIC of < 6.25µg/mL against Staphylococcus aureus which is comparable with the known standards. The standards used for cytotoxic evaluation was 5-fluorouracil and for antibacterial was nitrofurazone

  16. Efficient synthesis of novel azo compounds based on pyrimido[4,5-e][1,3,4]thiadiazine

    Directory of Open Access Journals (Sweden)

    Mohsen Nikpour

    2012-12-01

    Full Text Available Some new 5-bromo-2,4-dichloro-6-alkylpyrimidines were prepared by sequential treatment of 6-alkyl-pyrimidin-2,4(1H,3H-diones with bromine and phosphoryl chloride. Condensation of the dithizone with 5-bromo-2,4-dichloro-6-alkylpyrimidines in alkaline acetonitrile achieved 5-alkyl-7-chloro-3-phenylazo-1-phenyl-1H-pyrimido[4,5-e][1,3,4] thiadiazines. 7-chlorine atom of these compounds was replaced by secondary amines in boiling ethanol to afford their 7-amino derivatives. DOI: http://dx.doi.org/10.4314/bcse.v26i1.12

  17. Boson-model M1 form factors for inelastic electron scattering on sup 130,132,134 Ba

    Energy Technology Data Exchange (ETDEWEB)

    Lipas, P.O.; Koskinen, M. (Jyvaeskylae Univ. (Finland). Dept. of Physics); Harter, H.; Nojarov, R.; Faessler, Amand (Tuebingen Univ. (Germany, F.R.). Inst. fuer Theoretische Physik)

    1991-06-01

    The proton-neutron interacting-boson model (IBA-2) is used to predict the (e,e') form factor for collective 1{sup +} excitation in {sup 130,132,134}Ba. A simple estimate of the {sup 130}Ba transition current density, and thence of the form factor, is obtained from the known form factor of {sup 164}Dy by a scaling method built on PWBA and Fourier-Bessel analysis. A weightier prediction is obtained from microscopic boson structure and DWBA. The 1{sup +} excitation should be observable in the bariums. Boson g factors are calculated. (author).

  18. Experimental Investigation of Gas Hydrate Production at Injection of Liquid Nitrogen into Water with Bubbles of Freon 134A

    Directory of Open Access Journals (Sweden)

    Meleshkin Anton V.

    2016-01-01

    Full Text Available The hydrodynamic processes during the injection of the cryogenic liquid into the volume of water with bubbles of gas freon 134a are studding experimentally. A processes during the explosive boiling of liquid nitrogen in the volume of water are registered. Video recording of identified gas hydrate flakes formed during this process is carried out by high speed camera. These results may be useful for the study of the new method of producing gas hydrates, based on the shock-wave method.

  19. 1.34 µm picosecond self-mode-locked Nd:GdVO4 watt-level laser

    Science.gov (United States)

    Han, Ming; Peng, Jiying; Li, Zuohan; Cao, Qiuyuan; Yuan, Ruixia

    2017-01-01

    With a simple linear configuration, a diode-pumped, self-mode-locked Nd:GdVO4 laser at 1.34 µm is experimentally demonstrated for the first time. Based on the aberrationless theory of self-focusing and thermal lensing effect, through designing and optimizing the resonator, a pulse width as short as 9.1 ps is generated at a repetition rate of 2.0 GHz and the average output power is 2.51 W. The optical conversion efficiency and the slope efficiency for the stable mode-locked operation are approximately 16.7% and 19.2%, respectively.

  20. Investigations on mixture preparation for two phase adiabatic pressure drop of R134a flowing in 5 mm diameter channel

    Science.gov (United States)

    Muszyński, Tomasz; Andrzejczyk, Rafał; Dorao, Carlos A.

    2017-09-01

    The article presents detailed two-phase adiabatic pressure drops data for refrigerant R134a. Study cases have been set for a mass flux varying from 200 to 400 kg/m2s, at the saturation temperature of 19.4 °C. Obtained experimental data was compared with the available correlations from the literature for the frictional pressure drop during adiabatic flow. Influence of mixture preparation on pressure drop was investigated, for varying inlet subcooling temperature in the heated section. The flow patterns have also been obtained by means of a high-speed camera placed in the visualization section and compared with literature observations.

  1. Endogenous PTH Deficiency Impairs Fracture Healing and Impedes the Fracture-Healing Efficacy of Exogenous PTH(1-34)

    Science.gov (United States)

    Feng, Yuxu; Shu, Lei; Cao, Xiaojian; Karaplis, Andrew; Goltzman, David; Miao, Dengshun

    2011-01-01

    Background Although the capacity of exogenous PTH1-34 to enhance the rate of bone repair is well established in animal models, our understanding of the mechanism(s) whereby PTH induces an anabolic response during skeletal repair remains limited. Furthermore it is unknown whether endogenous PTH is required for fracture healing and how the absence of endogenous PTH would influence the fracture-healing capacity of exogenous PTH. Methodology/Principal Findings Closed mid-diaphyseal femur fractures were created and stabilized with an intramedullary pin in 8-week-old wild-type and Pth null (Pth−/−) mice. Mice received daily injections of vehicle or of PTH1-34 (80 µg/kg) for 1–4 weeks post-fracture, and callus tissue properties were analyzed at 1, 2 and 4 weeks post-fracture. Cartilaginous callus areas were reduced at 1 week post-fracture, but were increased at 2 weeks post-fracture in vehicle-treated and PTH-treated Pth−/− mice compared to vehicle-treated and PTH-treated wild-type mice respectively. The mineralized callus areas, bony callus areas, osteoblast number and activity, osteoclast number and surface in callus tissues were all reduced in vehicle-treated and PTH-treated Pth−/− mice compared to vehicle-treated and PTH-treated wild-type mice, but were increased in PTH-treated wild-type and Pth−/− mice compared to vehicle-treated wild-type and Pth−/− mice. Conclusions/Significance Absence of endogenous PTH1-84 impedes bone fracture healing. Exogenous PTH1-34 can act in the absence of endogenous PTH but callus formation, including accelerated endochondral bone formation and callus remodeling as well as mechanical strength of the bone are greater when endogenous PTH is present. Results of this study suggest a complementary role for endogenous PTH1-84 and exogenous PTH1-34 in accelerating fracture healing. PMID:21829585

  2. Chemotaxis of Ralstonia eutropha JMP134(pJP4) to the Herbicide 2,4-Dichlorophenoxyacetate

    OpenAIRE

    Hawkins, Andrew C.; Harwood, Caroline S.

    2002-01-01

    Ralstonia eutropha JMP134(pJP4) and several other species of motile bacteria can degrade the herbicide 2,4-dichlorophenoxyacetate (2,4-D), but it was not known if bacteria could sense and swim towards 2,4-D by the process of chemotaxis. Wild-type R. eutropha cells were chemotactically attracted to 2,4-D in swarm plate assays and qualitative capillary assays. The chemotactic response was induced by growth with 2,4-D and depended on the presence of the catabolic plasmid pJP4, which harbors the ...

  3. Functions of Flavin Reductase and Quinone Reductase in 2,4,6-Trichlorophenol Degradation by Cupriavidus necator JMP134

    OpenAIRE

    Belchik, Sara Mae; Xun, Luying

    2007-01-01

    The tcpRXABCYD operon of Cupriavidus necator JMP134 is involved in the degradation of 2,4,6-trichlorophenol (2,4,6-TCP), a toxic pollutant. TcpA is a reduced flavin adenine dinucleotide (FADH2)-dependent monooxygenase that converts 2,4,6-TCP to 6-chlorohydroxyquinone. It has been implied via genetic analysis that TcpX acts as an FAD reductase to supply TcpA with FADH2, whereas the function of TcpB in 2,4,6-TCP degradation is still unclear. In order to provide direct biochemical evidence for t...

  4. 4-(4-Methylpiperazin-1-yl-3-(5-phenyl-1,3,4-oxadiazol-2-yl-7-(trifluoromethylquinoline

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2011-11-01

    Full Text Available In the title compound, C23H20F3N5O, the piperazine ring adopts a chair conformation. The quinoline ring makes dihedral angles of 56.61 (11, 49.94 (12 and 42.58 (14° with the piperazine ring, the 1,3,4-oxadiazole ring and the benzene ring, respectively. An intramolecular C—H...O hydrogen bond generates an S(7 ring motif. In the crystal, molecules are linked into infinite chains along the b axis by C—H...N hydrogen bonds.

  5. Bis{N-[5-(4-methoxyphenyl-1,3,4-oxadiazol-2-yl]ethanimidamidato}copper(II

    Directory of Open Access Journals (Sweden)

    Yacine Djebli

    2010-04-01

    Full Text Available The title compound, [Cu(C11H11N4O22], was prepared by solvothermal synthesis using 2-amino-5-(4-methoxyphenyl-1,3,4-oxadiazole and copper sulfate pentahydrate in an acetonitrile solution. The CuII atom lies on an inversion center and is four-coordinated in a slightly distorted square-planar geometry by four N atoms of the ligands obtained from the formation of a bond between the amine N atom of the oxadiazole molecule and the nitrile C atom of the solvent. In the crystal structure an intermolecular N—H...N hydrogen bond links inversion-related molecules.

  6. High dose teriparatide (rPTH1-34 therapy increases callus volume and enhances radiographic healing at 8-weeks in a massive canine femoral allograft model.

    Directory of Open Access Journals (Sweden)

    Kohei Nishitani

    Full Text Available Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34 effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20 received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1 Placebo (n = 5; daily saline, 2 Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op, or 3 Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op. Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05. These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR on host bone and graft-host junctions (p<0.05. Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05. Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01. In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.

  7. Symmetries of Quadrupole-Collective Vibrational Motion in Transitional Even-Even 124−134Xenon Nuclei

    CERN Document Server

    Pietralla, N; Rainovski, G; Ahn, T; Bauer, C; Leske, J; Möller, O; Möller, T

    2010-01-01

    Projectile-Coulomb excitation of Xe isotopes has been performed at ANL using the Gammasphere array for the detection of γ-rays. The one-quadrupole phonon 2+ 1,ms mixed-symmetry state (MSS) has been traced in the stable N=80 isotones down to 134Xe. First, the data on absolute E2 andM1 transition rates quantify the amount of F-spin symmetry in these nuclei and provide a new local measure for the pn-QQ interaction. Second, the evolution of the 2+ 1,ms state has been studied along the sequence of stable even-even 124−134Xe isotopes that are considered to form a shape transition path from vibrational nuclei with vibrational U(5) symmetry near N=82 to γ-softly deformed shapes with almost O(6) symmetry. Third, our data on more than 50 absolute E2 transition rates between off-yrast low-spin states of 124,126Xe enable us to quantitatively test O(6) symmetry in these nuclei. As a result we find that O(6) symmetry is more strongly broken in the A=130 mass region than previously thought. The data will be discussed.

  8. Comparative Study of R134a and R744 Driven Solar Assisted Heat Pump Systems for Different Applications

    Science.gov (United States)

    Baradey, Y.; Hawlader, M. N. A.; Ismail, A. F.; Hrairi, M.

    2017-03-01

    A solar assisted heat pump (SAHP) system is considered in this study where space cooling, water heating, drying and desalination are carried out using solar energy, ambient energy and the waste heat available from air conditioning system. The integration of different applications with SAHP system leads to many benefits, but the most significant is the energy conservation issue where the prices of fossil fuels are increasing. In recent years, researches have been conducted worldwide to improve the performance of these systems. These systems usually use synthetic refrigerant, such as R134a, which contributes to many atmospheric problems. Currently, embracing natural refrigerants, such as, carbon dioxide in SAHP has become a trend specifically after Kyoto agreement to reduce global warming and improve the performance of SAHP systems. In this paper, comparative study using R134a and R744 in SAHP systems have been considered. The comparison includes the most significant results of previous work relevant to this issue, and the thermo physical properties of the two refrigerants when used in SAHP.

  9. Synthesis and Antibacterial Evaluation of New Sulfone Derivatives Containing 2-Aroxymethyl-1,3,4-Oxadiazole/Thiadiazole Moiety

    Directory of Open Access Journals (Sweden)

    Shihu Su

    2016-12-01

    Full Text Available Sulfones are one of the most important classes of agricultural fungicides. To discover new lead compounds with high antibacterial activity, a series of new sulfone derivatives were designed and synthesized by introducing the aroxymethyl moiety into the scaffold of 1,3,4-oxadiazole/thiadiazole sulfones. Antibacterial activities against three phytopathogens (Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, Xanthomonas axonopodis pv. citri. were assayed in vitro. As compared to the control of commercial fungicides and some reported sulfone fungicides, seven compounds 5I-1–5I-7 exerted remarkably higher activities with EC50 values ranging from 0.45–1.86 μg/mL against X. oryzae and 1.97–20.15 μg/mL against R. solanacearum. Exhilaratingly, 5I-1, 5I-2 and 5I-4 displayed significant in vivo activity against X. oryzae with protective effect of 90.4%, 77.7%, and 81.1% at 200 μg/mL, respectively, much higher than that exhibited by Bismerthiazol (25.6% and Thiadiazole-copper (32.0%. And the differential phytotoxicity of active derivatives was preliminarily checked. The results demonstrated that derivative of 2-aroxymethyl-1,3,4-oxadiazole/thiadiazole sulfone can serve as potential alternative bactericides for the management of plant bacterial diseases.

  10. An Inversion Disrupting FAM134B Is Associated with Sensory Neuropathy in the Border Collie Dog Breed

    Directory of Open Access Journals (Sweden)

    Oliver P. Forman

    2016-09-01

    Full Text Available Sensory neuropathy in the Border Collie is a severe neurological disorder caused by the degeneration of sensory and, to a lesser extent, motor nerve cells with clinical signs starting between 2 and 7 months of age. Using a genome-wide association study approach with three cases and 170 breed matched controls, a suggestive locus for sensory neuropathy was identified that was followed up using a genome sequencing approach. An inversion disrupting the candidate gene FAM134B was identified. Genotyping of additional cases and controls and RNAseq analysis provided strong evidence that the inversion is causal. Evidence of cryptic splicing resulting in novel exon transcription for FAM134B was identified by RNAseq experiments. This investigation demonstrates the identification of a novel sensory neuropathy associated mutation, by mapping using a minimal set of cases and subsequent genome sequencing. Through mutation screening, it should be possible to reduce the frequency of or completely eliminate this debilitating condition from the Border Collie breed population.

  11. Synthesis, Structural Elucidation, and Antibacterial Evaluation of Some New Molecules Derived from Coumarin, 1,3,4-Oxadiazole, and Acetamide

    Directory of Open Access Journals (Sweden)

    Shahid Rasool

    2016-01-01

    Full Text Available Because of the reported biological activities of coumarin, 1,3,4-oxadiazole, and acetamides, some new compounds incorporating these moieties were synthesized and evaluated for their biological potential against Gram-positive and Gram-negative bacteria. In the present work, 4-chlororesorcinol (1 and ethyl acetoacetate (2 were mixed in a strong acidic medium to synthesize 6-chloro-7-hydroxy-4-methyl-2-oxo-2H-chromene (3 which was subjected to the intermolecular cyclization after consecutive three steps to synthesize 5-[(6-chloro-4-methyl-2-oxo-2H-chromen-7-yloxy]methyl-1,3,4-oxadiazol-2-thiol (6. A series of acetamoyl electrophiles, 8a–o, were synthesized from aralkyl/alkyl/aryl amines, 7a–o, in an aqueous basic medium. The final compounds, 9a–o, were synthesized by the reaction of compounds 6 and 8a–o in DMF/NaH. The synthesized compounds were structurally elucidated by spectral data analysis of IR, 1H-NMR, and EIMS. The most of the synthesized compounds remained moderate to excellent antibacterial agents. The molecules, 9e, 9j, and 9k, were the most efficient ones against all the five bacterial strains taken into account.

  12. Synthesis and Anticancer Activity of N-Aryl-5-substituted-1,3,4-oxadiazol-2-amine Analogues

    Directory of Open Access Journals (Sweden)

    Mohamed Jawed Ahsan

    2014-01-01

    Full Text Available In continuance of our search for anticancer agents, we report herein the synthesis and anticancer activity of some novel oxadiazole analogues. The compounds were screened for anticancer activity as per National Cancer Institute (NCI US protocol on leukemia, melanoma, lung, colon, CNS, ovarian, renal, prostate, and breast cancers cell lines. N-(2,4-Dimethylphenyl-5-(4-methoxyphenyl-1,3,4-oxadiazol-2-amine (4s showed maximum activity with mean growth percent (GP of 62.61 and was found to be the most sensitive on MDA-MB-435 (melanoma, K-562 (leukemia, T-47D (breast cancer, and HCT-15 (colon cancer cell lines with GP of 15.43, 18.22, 34.27, and 39.77, respectively. Maximum GP was observed on MDA-MB-435 (melanoma cell line (GP=6.82 by compound N-(2,4-dimethylphenyl-5-(4-hydroxyphenyl-1,3,4-oxadiazol-2-amine (4u.

  13. Assimilation and biological turnover of cesium-134, iodine-131, and chromium-51 in brown crickets, Acheta domesticus (L. )

    Energy Technology Data Exchange (ETDEWEB)

    Van Hook, R.I. Jr.; Crossley, D.A. Jr.

    1969-01-01

    Understanding of radionuclide accumulation by insects requires careful assessment of assimilation and turnover rates. In separate experiments, three radionuclides (/sup 134/Cs, /sup 131/I or /sup 51/Cr) were fed to adult brown crickets for a 24-hr period. The insects were then transferred to nonradioactive food and their whole-body retention measured at 1-hr intervals. The retention of each radionuclide can be described by a sum of two exponential functions, a shorter one related to loss of unassimilated radionuclide from the gut and a longer one describing excretion of assimilated radionuclide from tissues. The shorter components had similar rates (half-time = about 4 hr) for all three radionuclides, indicating that they were a measure of gut clearance time. Chromium had the lowest assimilation (6%) and cesium the highest (65%). Assimilated /sup 134/Cs and /sup 51/Cr were eliminated at moderate rates (biological half-lives of 62 and 83 hr, respectively) but assimilated /sup 131/I was stored rather than excreted. 18 references, 2 figures, 1 table.

  14. Performance of smooth and micro-fin tubes in high mass flux region of R-134a during evaporation

    Science.gov (United States)

    Wongsa-ngam, Jittraporn; Nualboonrueng, Thipjak; Wongwises, Somchai

    . The two-phase heat transfer coefficient and pressure drop during evaporation of pure R-134a in smooth and micro-fin tubes are experimentally investigated. Different from most previous studies, the present experiments have been performed at high mass flux conditions. The test section is a 2.5 m long counterflow horizontal double tube heat exchanger with refrigerant flow inside the tube while hot water flows in the annulas. The inner tubes are made from smooth or micro-fin horizontal copper tubing of 9.52 mm outer diameter. The test runs are done at average saturated evaporating temperatures ranging between 10 and 20 °C. The mass fluxes are between 400 and 800 kg/m2s. The experimental results of both smooth and micro-fin tubes show that the average heat transfer coefficient tends to increase with an increase of average quality, mass flux, and evaporating temperature. The pressure drop increases with an increase of average quality and mass flux, but tends to slightly decrease with a rise of evaporating temperature. The average heat transfer coefficient of the 9.52 mm OD micro-fin tube is 50% to 100% higher than that of the 9.52 mm OD smooth tube while the pressure drop is 10% to 60% higher. New correlations for the evaporation heat transfer coefficient and pressure drop in high mass flux region of R-134a are proposed for practical use.

  15. Electroacupuncture Regulates Hippocampal Synaptic Plasticity via miR-134-Mediated LIMK1 Function in Rats with Ischemic Stroke.

    Science.gov (United States)

    Liu, Weilin; Wu, Jie; Huang, Jia; Zhuo, Peiyuan; Lin, Yunjiao; Wang, Lulu; Lin, Ruhui; Chen, Lidian; Tao, Jing

    2017-01-01

    MircoRNAs (miRs) have been implicated in learning and memory, by regulating LIM domain kinase (LIMK1) to induce synaptic-dendritic plasticity. The study aimed to investigate whether miRNAs/LIMK1 signaling was involved in electroacupuncture- (EA-) mediated synaptic-dendritic plasticity in a rat model of middle cerebral artery occlusion induced cognitive deficit (MICD). Compared to untreatment or non-acupoint-EA treatment, EA at DU20 and DU24 acupoints could shorten escape latency and increase the frequency of crossing platform in Morris water maze test. T2-weighted imaging showed that the MICD rat brain lesions were located in cortex, hippocampus, corpus striatum, and thalamus regions and injured volumes were reduced after EA. Furthermore, we found that the density of dendritic spine and the number of synapses in the hippocampal CA1 pyramidal cells were obviously reduced at Day 14 after MICD. However, synaptic-dendritic loss could be rescued after EA. Moreover, the synaptic-dendritic plasticity was associated with increases of the total LIMK1 and phospho-LIMK1 levels in hippocampal CA1 region, wherein EA decreased the expression of miR-134, negatively regulating LIMK1 to enhance synaptic-dendritic plasticity. Therefore, miR-134-mediated LIMK1 was involved in EA-induced hippocampal synaptic plasticity, which served as a contributor to improving learning and memory during the recovery stage of ischemic stroke.

  16. Loss of Catalytic Activity in the E134D, H67A, and H349A Mutants of DapE: Mechanistic Analysis with QM/MM Investigation.

    Science.gov (United States)

    Dutta, Debodyuti; Mishra, Sabyashachi

    2016-11-17

    In the fight against bacterial infections and antibiotic resistance, the dapE-encoded N-succinyl-l,l-diaminopimelic acid desuccinylase (DapE) is a potentially safe target enzyme. The role of the Glu134, His67, and His349 residues in the binding and hydrolysis of N-succinyl-l,l-diaminopimelic acid (SDAP) is investigated by employing molecular dynamics simulation and hybrid quantum mechanical-molecular mechanical (MM) calculations of the E134D, H67A, and H349A mutants of DapE. The free energy of substrate binding obtained from the MM-Poisson-Boltzmann surface area approach correctly reproduced the experimentally observed ordering of substrate affinity, that is, E134D > wt > H67A > H349A. The mechanism of catalytic action by the E134D mutant is elucidated by structurally and energetically characterizing the intermediates and the transition states along the reaction pathway. The rate-determining step in the general acid-base hydrolysis reaction by the E134D mutant is found to be the nucleophilic attack step, which involves an activation energy barrier 10 kcal/mol greater than that in the wild-type (wt)-DapE. This explains the 3 orders of magnitude decrease in the experimentally determined kcat value for the E134D mutant compared to that of wt-DapE. In the H67A and H349A mutants, the Glu134 residue undergoes a conformational change and exhibits a strong coordination with the metal centers. This not only results in a weaker substrate binding in the two histidine mutants but also hinders the activation of the catalytic water molecule, which constitutes the first step of the substrate hydrolysis by DapE. This leads to an effective quenching of the catalytic activity in the H67A and H349A mutants.

  17. Mycobacterial and HIV infections up-regulated human zinc finger protein 134, a novel positive regulator of HIV-1 LTR activity and viral propagation.

    Directory of Open Access Journals (Sweden)

    Ronald Benjamin

    Full Text Available BACKGROUND: Concurrent occurrence of HIV and Tuberculosis (TB infections influence the cellular environment of the host for synergistic existence. An elementary approach to understand such coalition at the molecular level is to understand the interactions of the host and the viral factors that subsequently effect viral replication. Long terminal repeats (LTR of HIV genome serve as a template for binding trans-acting viral and cellular factors that regulate its transcriptional activity, thereby, deciding the fate of HIV pathogenesis, making it an ideal system to explore the interplay between HIV and the host. METHODOLOGY/PRINCIPAL FINDINGS: In this study, using biotinylated full length HIV-1 LTR sequence as bait followed by MALDI analyses, we identified and further characterized human-Zinc-finger-protein-134 (hZNF-134 as a novel positive regulator of HIV-1 that promoted LTR-driven transcription and viral production. Over-expression of hZNF-134 promoted LTR driven luciferase activity and viral transcripts, resulting in increased virus production while siRNA mediated knockdown reduced both the viral transcripts and the viral titers, establishing hZNF-134 as a positive effector of HIV-1. HIV, Mycobacteria and HIV-TB co-infections increased hZNF-134 expressions in PBMCs, the impact being highest by mycobacteria. Corroborating these observations, primary TB patients (n = 22 recorded extraordinarily high transcript levels of hZNF-134 as compared to healthy controls (n = 16. CONCLUSIONS/SIGNIFICANCE: With these observations, it was concluded that hZNF-134, which promoted HIV-1 LTR activity acted as a positive regulator of HIV propagation in human host. High titers of hZNF-134 transcripts in TB patients suggest that up-regulation of such positive effectors of HIV-1 upon mycobacterial infection can be yet another mechanism by which mycobacteria assists HIV-1 propagation during HIV-TB co-infections. hZNF-134, an uncharacterized host protein, thus

  18. Cellular Effects and Delivery Propensity of Penetratin Is Influenced by Conjugation to Parathyroid Hormone Fragment 1-34 in Synergy with pH.

    Science.gov (United States)

    Kristensen, Mie; Nielsen, Line Hagner; Zor, Kinga; Boisen, Anja; Christensen, Malene Vinther; Berthelsen, Jens; Mørck Nielsen, Hanne

    2018-01-09

    The cell-penetrating peptide (CPP) penetratin has demonstrated potential as a carrier for transepithelial delivery of cargo peptides, such as the therapeutically relevant part of parathyroid hormone, i.e., PTH(1-34). The purpose of the present study was to elucidate the relevance of pH for PTH(1-34)-penetratin conjugates and coadministered penetratin with PTH(1-34) regarding transepithelial permeation of PTH(1-34) and cellular effects. Transepithelial permeation was assessed using monolayers of the Caco-2 cell culture model, and effects on Caco-2 cellular viability kinetics were evaluated by using the Real-Time-GLO assay as well as by microscopy following Tryphan blue staining. Morphological Caco-2 cell changes were studied exploiting the impedance-based xCELLigence system as well as optically using the oCelloscope setup. Finally, the effect of pH on the folding propensity of the PTH(1-34)-penetratin conjugate and its ability to disrupt lipid membranes were assessed by circular dichroism (CD) spectroscopy and the calcein release assay, respectively. The transepithelial PTH(1-34) permeation was not pH-dependent when applying the coadministration approach. However, by applying the conjugation approach, the PTH(1-34) permeation was significantly enhanced by lowering the pH from 7.4 to 5 but also associated with a compromised barrier and a lowering of the cellular viability. The negative effects on the cellular viability following cellular incubation with the PTH(1-34)-penetratin conjugate were moreover confirmed during real-time monitoring of the Caco-2 cell viability as well as by enhanced Tryphan blue uptake. In addition, morphological changes were primarily observed for cells incubated with the PTH(1-34)-penetratin conjugate at pH 5, which was moreover demonstrated to have an enhanced membrane permeating effect following lowering of the pH from 7.4 to 5. The latter observation was, however, not a result of better secondary folding propensity at pH 5 when compared

  19. Measurements of HFC-134a and HCFC-22 in groundwater and unsaturated-zone air: implications for HFCs and HCFCs as dating tracers

    Science.gov (United States)

    Haase, Karl B.; Busenberg, Eurybiades; Plummer, L. Niel; Casile, Gerolamo; Sanford, Ward E.

    2014-01-01

    A new analytical method using gas chromatography with an atomic emission detector (GC–AED) was developed for measurement of ambient concentrations of hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) in soil, air, and groundwater, with the goal of determining their utility as groundwater age tracers. The analytical detection limits of HCFC-22 (difluorochloromethane, CHClF2) and HFC-134a (1,2,2,2-tetrafluoroethane, C2H2F4) in 1 L groundwater samples are 4.3 × 10− 1 and 2.1 × 10− 1 pmol kg− 1, respectively, corresponding to equilibrium gas-phase mixing ratios of approximately 5–6 parts per trillion by volume (pptv). Under optimal conditions, post-1960 (HCFC-22) and post-1995 (HFC-134a) recharge could be identified using these tracers in stable, unmixed groundwater samples. Ambient concentrations of HCFC-22 and HFC-134a were measured in 50 groundwater samples from 27 locations in northern and western parts of Virginia, Tennessee, and North Carolina (USA), and 3 unsaturated-zone profiles were collected in northern Virginia. Mixing ratios of both HCFC-22 and HFC-134a decrease with depth in unsaturated-zone gas profiles with an accompanying increase in CO2 and loss of O2. Apparently, ambient concentrations of HCFC-22 and HFC-134a are readily consumed by methanotrophic bacteria under aerobic conditions in the unsaturated zone. The results of this study indicate that soils are a sink for these two greenhouse gases. These observations contradict the previously reported results from microcosm experiments that found that degradation was limited above-ambient HFC-134a. The groundwater HFC and HCFC concentrations were compared with concentrations of chlorofluorocarbons (CFCs, CFC-11, CFC-12, CFC-113) and sulfur hexafluoride (SF6). Nearly all samples had measured HCFC-22 or HFC-134a that were below concentrations predicted by the CFCs and SF6, with many samples showing a complete loss of HCFC-22 and HFC-134a. This study indicates that HCFC-22 and HFC-134

  20. Temporal and spatial variations of 134Cs and 137Cs levels in the Sea of Japan and Pacific coastal region: Implications for dispersion of FDNPP-derived radiocesium.

    Science.gov (United States)

    Inoue, M; Shirotani, Y; Yamashita, S; Takata, H; Kofuji, H; Ambe, D; Honda, N; Yagi, Y; Nagao, S

    2018-02-01

    To investigate the dispersion of Fukushima Dai-ichi Nuclear Power Plant (FDNPP)-derived radiocesium in the Sea of Japan and western Pacific coastal region and determine the sources of radiocesium in these areas, we examined the temporal and spatial variations of 134Cs and 137Cs concentrations (activities) during 2011-2016 in seawaters around the western Japanese Archipelago, particularly in the Sea of Japan. In May 2013, the surface concentration of 134Cs was ∼0.5 mBq/L (decay-corrected to March 11, 2011), and that of 137Cs exceeded the pre-accident level in this study area, where the effects of radiocesium depositions just after the FDNPP accident disappeared in surface waters in October 2011. Subsequently, radiocesium concentrations gradually increased during 2013-2016 (∼0.5-1 mBq/L for 134Cs), exhibiting approximately homogeneous distributions in each year. The temporal and spatial variations of 134Cs and 137Cs concentrations indicated that FDNPP-derived radiocesium around the western Japanese Archipelago, including the Sea of Japan, has been supported by the Kuroshio Current and its branch, Tsushima Warm Current, during 2013-2016. However, in the Sea of Japan, the penetration of 134Cs was limited to depths of less than ∼200 m during three years following the re-delivery of FDNPP-derived radiocesium. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Synthesis of Some New 1,3,4-Thiadiazole, Thiazole and Pyridine Derivatives Containing 1,2,3-Triazole Moiety

    Directory of Open Access Journals (Sweden)

    Nadia A. Abdelriheem

    2017-02-01

    Full Text Available In this study, 1-(5-Methyl-1-(p-tolyl-1H-1,2,3-triazol-4-ylethan-1-one, was reacted with Thiosemicarbazide, alkyl carbodithioate and benzaldehyde to give thiosemicarbazone, alkylidenehydrazinecarbodithioate and 3-phenylprop-2-en-1-one-1,2,3-triazole derivatives. The 1,3,4-thiadiazole derivatives containing the 1,2,3-triazole moiety were obtained via reaction of alkylidenecarbodithioate with hydrazonoyl halides. Also, hydrazonoyl halides were reacted with thiosemicarbazone and pyrazolylthioamide to give 1,3-thiazoles derivatives. Subsequently, 3-phenyl2-en-1-one was used to synthesize substituted pyridines and substituted nicotinic acid ester. The latter was converted to its azide compound which was reacted with aromatic amines and phenol to give substituted urea and phenylcarbamate containing 1,2,3-triazole moiety. The newly synthesized compounds were established by elemental analysis, spectral data and alternative synthesis whenever possible.

  2. Pandemic preparedness with live attenuated influenza vaccines based on A/Leningrad/134/17/57 master donor virus.

    Science.gov (United States)

    Rudenko, Larisa; Isakova-Sivak, Irina

    2015-03-01

    Continuously evolving avian influenza viruses pose a constant threat to the human public health. In response to this threat, a number of pandemic vaccine candidates have been prepared and evaluated in animal models and clinical trials. This review summarizes the data from the development and preclinical and clinical evaluation of pandemic live attenuated influenza vaccines (LAIV) based on Russian master donor virus A/Leningrad/134/17/57. LAIV candidates of H5N1, H5N2, H7N3, H1N1 and H2N2 subtypes were safe, immunogenic and protected animals from challenge with homologous and heterologous viruses. Clinical trials of the pandemic LAIVs demonstrated their safety and immunogenicity for healthy adult volunteers. The vaccine viruses were infectious, genetically stable and did not transmit to unvaccinated contacts. In addition, here we discuss criteria for the assessment of pandemic LAIV immunogenicity and efficacy necessary for their licensure.

  3. Microwave-Assisted Synthesis of Some 1,3,4-Oxadiazole Derivatives and Evaluation of Their Antibacterial and Antifungal Activity

    Directory of Open Access Journals (Sweden)

    Deepak Swarnkar

    2014-01-01

    Full Text Available A series of substituted 1,3,4-oxadiazole derivatives (3a–f and (6a–f have been synthesized from diphenylacetic acid hydrazide under microwave irradiation in various reaction conditions. The structures of the synthesized compounds were assigned on the basis of elemental analysis, IR, and 1H NMR. These targeted compounds have been tested for their antibacterial and antifungal activities compared to ampicillin and griseofulvin as standard drug. Compounds 3a, 3e, 3f, 6c, 6d, 6e, and 6d exhibited the maximum antibacterial activities while 3b, 3c, 3d, 3e, 6a, 6d, and 6e exhibited the maximum antifungal activities.

  4. Large-scale heat transfer experiments with supercritical R134a flowing upward in a circular tube

    Energy Technology Data Exchange (ETDEWEB)

    Feuerstein, Florian; Coelho Silva, Alexandre; Klingel, Denis; Cheng, Xu [KIT Karlsruhe Institute of Technology (Germany). Inst. of Fusion and Reactor Technology

    2017-02-15

    Heat transfer experiments with supercritical Freon R134a flowing upward in a circular tube with inner diameter of 10 mm and a heating length of 2,495 mm were conducted with a wide range of parameters: mass fluxes of 300 to 2,000 kg/m2s, heat fluxes of 10 to 200 kW/m2, bulk fluid temperature of 50 to 124 C and pressures of 4.22 to 5.51 MPa. Effects of heat flux, mass flux, pressure and inlet temperature on heat transfer behavior are analyzed. Significant heat transfer deterioration is observed above a critical heat flux to mass flux ratio. Six representative correlations were selected and compared with the test data.

  5. A Comparative Study of Inclusion Complexes of Orthosubstituted [Arylidenamino]-1,3,4- thiadiazino[6,5b] Indole Derivatives

    Directory of Open Access Journals (Sweden)

    Sunakar Panda

    2012-01-01

    Full Text Available Some[Arylidenamino]-1,3,4-thiadiazino[6,5b] indoles have been synthesized starting from indole-2,3-dione, thiosemicarbazide and aromatic aldehydes with activating and deactivating groups. Inclusion complexes of these compounds have been prepared with β-cyclodextrin so as increase the solubility and bioaccessibility. Thermodynamic properties like change in free energy, change in enthalpy, change in entropy and stability constant of the inclusion complexes have been determined to know whether the inclusion complex formation is thermodynamically allowed or not. The compounds and their inclusion complexes are also screened againt S.aureus and E.coli.to know the antibacterial activity change after inclusion complex formation The antioxidant activities are also studied.

  6. PTH(1-34) for Surgical Hypoparathyroidism: A 2 year Prospective, Open-Label Investigation of Efficacy and Quality of Life.

    Science.gov (United States)

    Palermo, Andrea; Santonati, Assunta; Tabacco, Gaia; Bosco, Daniela; Spada, Antonio; Pedone, Claudio; Raggiunti, Bruno; Doris, Tina; Maggi, Daria; Grimaldi, Franco; Manfrini, Sivlia; Vescini, Fabio

    2017-11-01

    Daily PTH(1-34) administrations can reduce the required total daily dose of calcium/calcitriol and restore normocalcemia in refractory hypoparathyroidism. However, most of the PTH(1-34) trials were conducted on small cohorts including subjects with hypoparathyroidism of various etiologies and quality of life(QOL) was not investigated. To investigate the effects of 24 month PTH(1-34) treatment in a homogeneous cohort of adult subjects with postoperative hypoparathyroidism and to evaluate quality of life(QOL) changes. Prospective open-label study. Italian multicentric study. 42 subjects. twice-daily PTH(1-34) 20 mcg sc injection. calcium and vitamin D supplementation requirements, serum calcium, phosphate, urinary calcium excretion (3,6,12,18,24 months). At baseline, 6 and 24 months, QOL was evaluated by the RAND 36-Item Short Form(SF-36) Health Survey covering eight domains of physical and mental health. mean serum calcium concentration significantly increased from baseline to 3 months(7.6±0.6 vs 8.9±1.1mg/dl, P<.001) and remained stable until the end of the study, despite a significant reduction in calcium and vitamin D supplementation. Phosphate levels gradually decreased from baseline to 6 months(4.3±1.1 vs 3.9±0.6 mg/dl, P<.019) remaining stable until 24 months. Serum alkaline phosphatase and calcium excretion gradually increased from baseline to 24 months. Data from SF-36 showed a significant improvement in the mean scores of all 8 domains(P<.001). this is the largest study that demonstrates the efficacy and safety of PTH(1-34) to treat adult patients with post-surgical hypoparathyroidism. For the first time, it has been shown that PTH(1-34) can improve their mental and physical health.

  7. Ingestion doses in Finland due to (90)Sr, (134)Cs, and (137)Cs from nuclear weapons testing and the Chernobyl accident.

    Science.gov (United States)

    Rantavaara, A

    2008-11-01

    (90)Sr and (137)Cs in domestic foodstuffs and water have been analysed in Finland since the early 1960s, and (134)Cs since 1986. Using data on radionuclide deposition levels, agricultural production, and the processing and consumption of foodstuffs, the average intake and radiation dose from the ingestion of these radionuclides have been assessed. The estimated committed effective dose from the ingestion of (90)Sr, (137)Cs, and (134)Cs in food and water for the period 1960-2005 is 2.2 mSv, and for the period since the Chernobyl accident in 1986 it is 1.3 mSv.

  8. Determination of specific radioactivity of samarium-153 product. 1. Quantitative determination of samarium by spectrophotometry

    Energy Technology Data Exchange (ETDEWEB)

    Izumo, Mishiroku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nemoto, Masahiro [Tokyo Nuclear Service Co., Ltd., Tokyo (Japan)

    2002-03-01

    On the specific radioactivity of Sm-153 for the radiotherapy of cancers, a simple method for determination of the amount of Sm was described. The method used Arsenazo III as a colorimetric reagent. The sample irradiated in the reactor was dissolved in 1M HCl solution. A small part of it was taken and mixed with Arsenazo III at pH 3.2, and the amount of Sm was determined by the spectrophotometric method at a wavelength of 652 nm. The molar absorptivity of Sm at 652 nm was 6.6x10{sup 3} m{sup -1}{center_dot}mm{sup -1}. The error of measurement in the partial different conditions was about 2% of the value determined. The effects of impurities, Fe, Zn and Cu mixing in the Sm during operation, were clarified. (author)

  9. Synthesis and structure-activity relationships of carbohydrazides and 1,3,4-oxadiazole derivatives bearing imidazolidine moiety against the yellow fever and dengue vector, Aedes aegypti

    Science.gov (United States)

    BACKGROUND: 1,3,4-oxadiazole and imidazolidine rings are important heterocyclic compounds exhibiting a variety of biological activities. In this study, novel compounds with oxadiazole and imidazolidine rings were synthesized from 3-(methylsulfonyl)-2-oxoimidazolidine-1-carbonyl chloride and screened...

  10. 25 CFR 900.134 - At the end of a self-determination construction contract, what happens to savings on a cost...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false At the end of a self-determination construction contract... SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Construction § 900.134 At the end of a self-determination construction contract, what happens to savings on a cost...

  11. Test Report #33: Compressor Calorimeter Test of R-410A Alternative: R-32/R-134a Mixture Using a Scroll Compressor

    Energy Technology Data Exchange (ETDEWEB)

    Shrestha, Som [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sharma, Vishaldeep [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Abdelaziz, Omar [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-02-18

    This report investigates the tested performance of lower - GWP candidate refrigerant, 94.07 wt% R - 32 + 5.93 wt % R - 134 a mixture (hereafter referred to as R - 32/134a), as an alternative to baseline refrigerant R - 410 A using a 36,000 Btu/hr compressor calorimeter located at the Heat Exchanger Advanced Testing Facility at Oak Ridge National Laboratory . These tests were conducted during May and August 2013. R - 410A is a near - azeotropic blend of R - 32 and R - 125 with 0.5/0.5 mass fraction and has a GWP 100 of 2100. R - 32 and R - 134a are pure refrigerants and have GWP 100 of 716 and 1370 1, respectively. Based on the GWP 100 values of pure refrigerants and their mass fraction in the blend, GWP 100 of R - 32/134a, which is under development by National Refrigerant, is 755. This report compares various performance parameters, such as cooling capacity, compressor power, refrigerant mass flow rate, EER, isentropic efficiency and discharge temperature of the alternative refrigerant to that of R - 410 A.

  12. "N"-Heterocyclic Carbene-Catalyzed Reaction of Chalcone and Cinnamaldehyde to Give 1,3,4-Triphenylcyclopentene Using Organocatalysis to Form a Homoenolate Equivalent

    Science.gov (United States)

    Snider, Barry B.

    2015-01-01

    In this experiment, students carry out a modern organocatalytic reaction using IMes·HCl and NaOH to catalyze the formation of 1,3,4-triphenylcyclopentene from cinnamaldehyde and chalcone in water. Deprotonation of IMes·HCl with NaOH forms the "N"-heterocyclic carbene IMes that reacts with cinnamaldehyde to form a homoenolate equivalent…

  13. 25 CFR 134.1 - Partial reimbursement of irrigation charges; 5 percent per annum of cost of system, June 30, 1920.

    Science.gov (United States)

    2010-04-01

    ... PROJECTS § 134.1 Partial reimbursement of irrigation charges; 5 percent per annum of cost of system, June... owner of irrigable land under any irrigation system constructed for the benefit of Indians under provisions of law requiring reimbursement of the cost of such system and to which land, water for irrigation...

  14. 40 CFR Appendix C to Subpart B of... - SAE J2788 Standard for Recovery/Recycle and Recovery/Recycle/Recharging Equipment for HFC-134a...

    Science.gov (United States)

    2010-07-01

    .../Recycle and Recovery/Recycle/Recharging Equipment for HFC-134a Refrigerant C Appendix C to Subpart B of... Appendix C to Subpart B of Part 82—SAE J2788 Standard for Recovery/Recycle and Recovery/Recycle/Recharging... mobile A/C system being serviced. 6.1.1If recovery/recycle equipment has refrigerant identification...

  15. Synthesis, spectral analysis and pharmacological study of N'- substituted-2-(5-((2,4-dimethylphenoxymethyl-1,3,4-oxadiazol-2-ylthioacetohydrazides

    Directory of Open Access Journals (Sweden)

    Shahid Rasool

    Full Text Available ABSTRACT A series of molecules bearing multiple functional groups were synthesized to study their antibiotic effect against Gram-positive and Gram-negative bacteria and lipoxygenase activity as well. 2,4-Dimethylcarbolic acid (1 was refluxed with ethyl 2-bromoacetate to synthesize ethyl 2-(2,4-dimethylphenoxyacetate (2. Compound 2 was converted to the corresponding hydrazide 3, again on refluxing with hydrazine. The compound 5-((2,4-dimethylphenoxymethyl-1,3,4-oxadiazol-2-thiol (4 was synthesized by the reaction of 3 and CS2 in the presence of KOH. Compound 4 was further converted to the corresponding ester 5 and then 2-(5-((2,4-dimethylphenoxymethyl-1,3,4-oxadiazol-2-ylthioacetohydrazide (6. The final molecules N'-substituted-2-(5-((2,4-dimethylphenoxymethyl-1,3,4-oxadiazol-2-ylthioacetohydrazide, 8a-m, bearing ether, 1,3,4-oxadiazole, thioether, hydrazone and azomethine functional groups were synthesized by stirring the aryl carboxaldehydes 7a-m with 6 in methanol at room temperature. The depicted structures of all synthesized molecules were corroborated by IR, 1H-NMR and EIMS spectral data analysis. 8m and 8i showed substantial antibacterial activity and lipoxygenase inhibitory activity, respectively.

  16. Transfer factors and effective half-lives of (134)Cs and (137)Cs in different environmental sample types obtained from Northern Finland: case Fukushima accident.

    Science.gov (United States)

    Koivurova, Matias; Leppänen, Ari-Pekka; Kallio, Antti

    2015-08-01

    The Fukushima NPP accident caused a small but detectable cesium fallout in northern Finland, of the order of 1 Bq/m(2). This fallout transferred further to soil, water, flora and fauna. By using modern HPGe detector systems traces of (134)Cs from the Fukushima fallout were observed in various samples of biota. In northern Finland different types of environmental samples such as reindeer meat, berries, fish, lichens and wolf were collected during 2011-2013. The observed (134)Cs concentrations varied from 0.1 Bq/kg to a few Bq/kg. By using the known (134)Cs/(137)Cs ratio observed in Fukushima fallout the increase of the Fukushima accident to the (137)Cs concentrations was found to vary from 0.06 % to 6.9 % depending on the sample type. The aggregated transfer factors (Tag) and effective half-lives (Teff) for (134)Cs and (137)Cs were also determined and then compared with known values found from earlier studies which are calculated based on the fallout from the Chernobyl accident. Generally, the Tag and Teff values determined in this study were found to agree with the values found in the earlier studies. The Teff values were sample-type specific and were found to vary from 0.91 to 2.1 years for (134)Cs and the estimates for (137)Cs ranged between 1.6 and 19 years. Interestingly, the ground lichens had the longest Teff whereas the beard lichen had the shortest. In fauna, highest Tag values were determined for wolf meat ranging between 1.0 and 2.2 m(2)/kg. In flora, the highest Tag values were determined for beard lichens, ranging from 1.9 m(2)/kg to 3.5 m(2)/kg. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Chimeric HCMV/HSV-1 and Δγ134.5 oncolytic herpes simplex virus elicit immune mediated antigliomal effect and antitumor memory

    Directory of Open Access Journals (Sweden)

    Mohammed G. Ghonime

    2018-02-01

    Full Text Available Malignant gliomas are the most common primary brain tumor and are characterized by rapid and highly invasive growth. Because of their poor prognosis, new therapeutic strategies are needed. Oncolytic virotherapy (OV is a promising strategy for treating cancer that incorporates both direct viral replication mediated and immune mediated mechanisms to kill tumor cells. C134 is a next generation Δγ134.5 oHSV-1 with improved intratumoral viral replication. It remains safe in the CNS environment by inducing early IFN signaling which restricts its replication in non-malignant cells. We sought to identify how C134 performed in an immunocompetent tumor model that restricts its replication advantage over first generation viruses. To achieve this we identified tumors that have intact IFN signaling responses that restrict C134 and first generation virus replication similarly. Our results show that both viruses elicit a T cell mediated anti-tumor effect and improved animal survival but that subtle difference exist between the viruses effect on median survival despite equivalent in vivo viral replication. To further investigate this we examined the anti-tumor activity in immunodeficient mice and in syngeneic models with re-challenge. These studies show that the T cell response is integral to C134 replication independent anti-tumor response and that OV therapy elicits a durable and circulating anti-tumor memory. The studies also show that repeated intratumoral administration can extend both OV anti-tumor effects and induce durable anti-tumor memory that is superior to tumor antigen exposure alone.

  18. Characterization of {sup 241}Am and {sup 134}Cs bioaccumulation in the king scallop Pecten maximus: investigation via three exposure pathways

    Energy Technology Data Exchange (ETDEWEB)

    Metian, Marc, E-mail: metian@hawaii.edu [International Atomic Energy Agency, Marine Environment Laboratories, 4, Quai Antoine Ier, MC-98000, Principality of Monaco (Monaco); Littoral Environnement et Societes (LIENSs), UMR 6250, CNRS-Universite de La Rochelle, 2 rue Olympe de Gouges, F-17042 La Rochelle Cedex 01 (France); Warnau, Michel; Teyssie, Jean-Louis [International Atomic Energy Agency, Marine Environment Laboratories, 4, Quai Antoine Ier, MC-98000, Principality of Monaco (Monaco); Bustamante, Paco, E-mail: paco.bustamante@univ-lr.fr [Littoral Environnement et Societes (LIENSs), UMR 6250, CNRS-Universite de La Rochelle, 2 rue Olympe de Gouges, F-17042 La Rochelle Cedex 01 (France)

    2011-06-15

    In order to understand the bioaccumulation of {sup 241}Am and {sup 134}Cs in scallops living in sediments, the uptake and depuration kinetics of these two elements were investigated in the king scallop Pecten maximus exposed via seawater, food, or sediment under laboratory conditions. Generally, {sup 241}Am accumulation was higher and its retention was stronger than {sup 134}Cs. This was especially obvious when considering whole animals exposed through seawater with whole-body concentration factors (CF{sub 7d}) of 62 vs. 1, absorption efficiencies (A{sub 0l}) of 78 vs. 45 for seawater and biological half-lives (T{sub b1/2l}) of 892 d vs. 22 d for {sup 241}Am and {sup 134}Cs, respectively. In contrast, following a single feeding with radiolabelled phytoplankton, the assimilation efficiency (AE) and T{sub b1/2l} of {sup 134}Cs were higher than those of {sup 241}Am (AE: 28% vs. 20%; T{sub b1/2l}: 14 d vs. 9 d). Among scallop tissues, the shells always contained the higher proportion of the total body burden of {sup 241}Am whatever the exposure pathway. In contrast, the whole soft parts presented the major fraction of whole-body burden of {sup 134}Cs, which was generally associated with muscular tissues. Our results showed that the two radionuclides have contrasting behaviors in scallops, in relation to their physico-chemical properties. - Highlights: > We determined Am and Cs uptake and depuration kinetics following seawater, food and sediment exposures. > We determined radionuclide tissue distribution after exposure and after depuration periods. > Am was mainly associated to the shell whatever the exposure pathway was. > Transfer processes occurred between soft and hard tissues for Am.

  19. The Peach RGF/GLV Signaling Peptide pCTG134 Is Involved in a Regulatory Circuit That Sustains Auxin and Ethylene Actions

    Directory of Open Access Journals (Sweden)

    Nicola Busatto

    2017-10-01

    Full Text Available In vascular plants the cell-to-cell interactions coordinating morphogenetic and physiological processes are mediated, among others, by the action of hormones, among which also short mobile peptides were recognized to have roles as signals. Such peptide hormones (PHs are involved in defense responses, shoot and root growth, meristem homeostasis, organ abscission, nutrient signaling, hormone crosstalk and other developmental processes and act as both short and long distant ligands. In this work, the function of CTG134, a peach gene encoding a ROOT GROWTH FACTOR/GOLVEN-like PH expressed in mesocarp at the onset of ripening, was investigated for its role in mediating an auxin-ethylene crosstalk. In peach fruit, where an auxin-ethylene crosstalk mechanism is necessary to support climacteric ethylene synthesis, CTG134 expression peaked before that of ACS1 and was induced by auxin and 1-methylcyclopropene (1-MCP treatments, whereas it was minimally affected by ethylene. In addition, the promoter of CTG134 fused with the GUS reporter highlighted activity in plant parts in which the auxin-ethylene interplay is known to occur. Arabidopsis and tobacco plants overexpressing CTG134 showed abnormal root hair growth, similar to wild-type plants treated with a synthetic form of the sulfated peptide. Moreover, in tobacco, lateral root emergence and capsule size were also affected. In Arabidopsis overexpressing lines, molecular surveys demonstrated an impaired hormonal crosstalk, resulting in a re-modulated expression of a set of genes involved in both ethylene and auxin synthesis, transport and perception. These data support the role of pCTG134 as a mediator in an auxin-ethylene regulatory circuit and open the possibility to exploit this class of ligands for the rational design of new and environmental friendly agrochemicals able to cope with a rapidly changing environment.

  20. Pharmacologic Evaluation of Antidepressant Activity and Synthesis of 2-Morpholino-5-phenyl-6H-1,3,4-thiadiazine Hydrobromide

    Directory of Open Access Journals (Sweden)

    Alexey P. Sarapultsev

    2016-05-01

    Full Text Available Substituted thiadiazines exert a reliable therapeutic effect in treating stress, and a schematic description of their ability to influence all aspects of a stress response has been depicted. This study was conducted to pharmacologically evaluate compound L-17, a substituted thiadiazine, (2-morpholino-5-phenyl-6H-1,3,4-thiadiazine, hydrobromide for possible anti-psychotic/antidepressant activity. Compound L-17 was synthesized by cyclocondensation of α-bromoacetophenone with the original morpholine-4-carbothionic acid hydrazide. Pharmacologic evaluations were conducted using methods described by E.F. Lavretskaya (1985, and in accordance with published guidelines for studying drugs for neuroleptic activity. Compound L-17 was evaluated for various possible mechanisms of action, including its effects on cholinergic system agonists/antagonists, dopaminergic neurotransmission, the adrenergic system, and 5-HT3 serotonin receptors. One or more of these mechanisms may be responsible for the beneficial effects shown by thiadiazine compounds in experiments conducted to evaluate their activity in models of acute stress and acute myocardial infarction.

  1. Neoadjuvant radiochemotherapy and radical resection for advanced squamous cell carcinoma of the oral cavity. Outcome of 134 patients

    Energy Technology Data Exchange (ETDEWEB)

    Eich, H.T.; Loeschcke, M.; Kocher, M.; Bongartz, R.; Mueller, R.P. [Dept. of Radiation Oncology, Univ. of Cologne (Germany); Scheer, M.; Zoeller, J.E. [Dept. of Cranio-Maxillofacial and Oral Surgery, Univ. of Cologne (Germany); Wacker, S. [Inst. of Medical Statistics, Informatics, and Epidemiology, Univ. of Cologne (Germany)

    2008-01-15

    Background and purpose: several multimodal strategies have been developed to treat patients with squamous cell carcinoma of the oral cavity. The advantages of preoperative radiochemotherapy are downstaging of the primary tumor, an increased resectability rate, and the elimination of micrometastases. After successful phase II trials, the following therapy regimen for resectable advanced oral carcinoma was applied. Patients and methods: 134 patients with resectable squamous cell carcinoma of the oral cavity stage II-IV received neoadjuvant radiochemotherapy consisting of 39.6 Gy in daily fractions of 1.8 Gy and concomitant carboplatin (70 mg/m{sup 2} days 1-5). Radical resection and neck dissection were carried out afterwards. Results: after a median follow-up of 73 months, 82 patients (61%) had died. 54 patients (40%) experienced locoregional relapses or distant metastases. The overall survival was 65% {+-} 4% after 2 years and 45% {+-} 4% after 5 years. Cox regression survival analysis identified tumor regression, extracapsular lymph node spread and resection state as prognostic factors. Side effects of grade 3-4 were rare. Conclusion: neoadjuvant radiochemotherapy with subsequent radical surgery can be recommended as an effective and safe treatment for primary resectable advanced tumors of the oral cavity. Acute and long-term toxicities appear to be moderate. (orig.)

  2. Synthesis and Preliminary Antimicrobial Activities of New Arylideneamino-1,3,4-thiadiazole-(thio/dithio-acetamido Cephalosporanic Acids

    Directory of Open Access Journals (Sweden)

    Shakir Mahmood Alwan

    2012-01-01

    Full Text Available New derivatives of 7-aminocephalosporanic acid 1–8 were synthesized by acylation of the 7-amino group of the cephem nucleus with various arylidinimino-1,3,4-thiadiazole-thio(or dithio-acetic acid intermediates 3a–d and 5a–d, respectively, so the acyl side chains of these new cephalosporins contained a sulfide or disulfide bond. This unique combination of a Schiff base with the sulfide or disulfide bonds in the acyl side chain afforded new cephalosporins of reasonable potencies, some of which were found to possess moderate activities against the tested microorganisms. Their chemical structures were characterized by ¹H-NMR, IR spectroscopy and elemental microanalysis. Preliminary in vitro antimicrobial activities of the prepared cephalosporins were investigated using a panel of selected microorganisms. Results indicated that the newly synthesized cephalosporins containing disulfide bonds (compounds 5–8 exhibited better activities against Staphylococcus aureus and Escherichia coli. The cephalosporins cross-linked by a sulfide bond (compounds 1–4 showed a slight change in antimicrobial activities when compared with that of the reference cephalosporin (cephalexin.

  3. Evidence of 131I and (134,137)Cs activities in Bordeaux, France due to the Fukushima nuclear accident.

    Science.gov (United States)

    Perrot, F; Hubert, Ph; Marquet, Ch; Pravikoff, M S; Bourquin, P; Chiron, H; Guernion, P-Y; Nachab, A

    2012-12-01

    Following the Fukushima nuclear accident, low-background gamma spectrometry measurements were performed with HPGe detectors at the PRISNA platform located at the CENBG laboratory in Bordeaux, France. Different kinds of samples were collected and measured between March 26 and May 14, 2011. The first fission product observed was (131)I with maximum activity values of 2.4 mBq/m(3) in atmospheric dusts in air, 3.5 Bq/L in rain water, 15 Bq/kg in grass and 0.9 Bq/L in cow milk. The (134,137)Cs isotopes were also detected in air and in grass at a maximum level of 0.2 mBq/m(3) and 0.7 Bq/kg respectively, around one order of magnitude less than (131)I activity, but they were below detection limits in the other samples. All these activity values were consistent with others measured in France by IRSN and were well below those reported in May 1986 after the Chernobyl accident. Copyright © 2012 Elsevier Ltd. All rights reserved.

  4. 5-(4-pyridinyl)-1,3,4-oxadiazole-2-thiol on gold: SAM formation and electroactivity

    Energy Technology Data Exchange (ETDEWEB)

    Paulo, Tercio de F.; Silva, Maria A.S. da; Pinheiro, Solange de O.; Meyer, Emerson; Moreira, Icaro de S.; Diogenes, Izaura C.N. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Quimica Organica e Inorganica]. E-mail: izaura@dqoi.ufc.br; Pinheiro, Lucidalva S.; Freire, Jose A. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Fisica; Tanaka, Auro A. [Universidade Federal do Maranhao (UFMA), Sao Luis, MA (Brazil). Dept. de Quimica; Lima Neto, Pedro de [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Quimica Analitica e Fisico Quimica

    2008-07-01

    5-(4-pyridinyl)-1,3,4-oxadiazole-2-thiol (Hpyt) spontaneously adsorbs on gold forming SAMs (self-assembled monolayers) that, based on STM (Scanning Tunneling Microscopy) and electrochemical data, contain pinholes through which [Fe(CN){sub 6}]{sup 4-} and [Ru(NH{sub 3}){sub 6}]{sup 3+} probe molecules access the underlying gold electrode. For the former molecule, the dependence of the faradaic current on the electrolyte solution pH value allowed the evaluation of the surface pKa as 4.2. The thermodynamic parameters {delta}H{sub ads} and {delta}G{sub ads} for the Hpyt adsorption process could be described by the Langmuir model and were calculated as -20.01 and -39.39 kJ mol{sup -1}, respectively. Electrodic redox reaction of cytochrome c metalloprotein was accessed by using the Hpyt SAM with a heterogeneous electron transfer rate constant of 2.29 x 10{sup -3} cm s{sup -1}. (author)

  5. Compressor Calorimeter Test of R-410A Alternative: R-32/134a Mixture Using a Scroll Compressor

    Energy Technology Data Exchange (ETDEWEB)

    Shrestha, Som S [ORNL; Sharma, Vishaldeep [ORNL; Abdelaziz, Omar [ORNL

    2014-02-01

    As a contribution to the AHRI Low-GWP Alternative Refrigerants Evaluation Program (AREP), this study compares the performance of lower-GWP alternative refrigerant R-32 + R-134a mixture, to that of refrigerant R-410A (baseline) in a scroll compressor designed for air-conditioning and heat pump applications. These comparisons were carried out via compressor calorimeter tests performed on a compressor designed for refrigerant R-410A and having a nominal rated capacity of 21,300 Btu/hr. Tests were conducted over a suction dew point temperature range of 10 F to 55 F in 5 F increments and a discharge dew point temperature range of 70 F to 140 F in 10 F increments. All the tests were performed with 20 F superheat, 40 F superheat, and 65 F suction temperature. A liquid subcooling level of 15 F was maintained for all the test conditions. The tests showed that the discharge temperature of the alternative refrigerant was higher than that of R-410A at all test conditions. Also, the energy efficiency ratio (EER) and cooling capacity of compressor using the alternative refrigerant were slightly lower in comparison to that of R-410A.

  6. Comment on "Study of dielectric relaxations of anhydrous trehalose and maltose glasses" [J. Chem. Phys. 134, 014508 (2011)].

    Science.gov (United States)

    Kaminski, K; Wlodarczyk, P; Paluch, M

    2011-10-28

    Very recently Kwon et al. [H.-J. Kwon, J.-A. Seo, H. K. Kim, and Y. H. Hwang, J. Chem. Phys. 134, 014508 (2011)] published an article on the study of dielectric relaxation in trehalose and maltose glasses. They carried out broadband dielectric measurements at very wide range of temperatures covering supercooled liquid as well as glassy state of both saccharides. It is worth to mention that authors have also applied a new method for obtaining anhydrous glasses of trehalose and maltose that enables avoiding their caramelization. Four relaxation processes were identified in dielectric spectra of both saccharides. The slower one was identified as structural relaxation process the next one, not observed by the others, was assigned as Johari-Goldstein (JG) β-relaxation, while the last two secondary modes were of the same nature as found by Kaminski et al. [K. Kaminski, E. Kaminska, P. Wlodarczyk, S. Pawlus, D. Kimla, A. Kasprzycka, M. Paluch, J. Ziolo, W. Szeja, and K. L. Ngai, J. Phys. Chem. B 112, 12816 (2008)]. In this comment we show that the authors mistakenly assigned the slowest relaxation process as structural mode of disaccharides. We have proven that this relaxation process is an effect of formation of thin layer of air or water between plate of capacitor and sample. The same effect can be observed if plates of capacitor are oxidized. Thus, we concluded that their slowest mode is connected to the dc conduction process while their β JG process is primary relaxation of trehalose and maltose.

  7. Comment on ``Study of dielectric relaxations of anhydrous trehalose and maltose glasses'' [J. Chem. Phys. 134, 014508 (2011)

    Science.gov (United States)

    Kaminski, K.; Wlodarczyk, P.; Paluch, M.

    2011-10-01

    Very recently Kwon et al. [H.-J. Kwon, J.-A. Seo, H. K. Kim, and Y. H. Hwang, J. Chem. Phys. 134, 014508 (2011)] published an article on the study of dielectric relaxation in trehalose and maltose glasses. They carried out broadband dielectric measurements at very wide range of temperatures covering supercooled liquid as well as glassy state of both saccharides. It is worth to mention that authors have also applied a new method for obtaining anhydrous glasses of trehalose and maltose that enables avoiding their caramelization. Four relaxation processes were identified in dielectric spectra of both saccharides. The slower one was identified as structural relaxation process the next one, not observed by the others, was assigned as Johari-Goldstein (JG) β-relaxation, while the last two secondary modes were of the same nature as found by Kaminski et al. [K. Kaminski, E. Kaminska, P. Wlodarczyk, S. Pawlus, D. Kimla, A. Kasprzycka, M. Paluch, J. Ziolo, W. Szeja, and K. L. Ngai, J. Phys. Chem. B 112, 12816 (2008)]. In this comment we show that the authors mistakenly assigned the slowest relaxation process as structural mode of disaccharides. We have proven that this relaxation process is an effect of formation of thin layer of air or water between plate of capacitor and sample. The same effect can be observed if plates of capacitor are oxidized. Thus, we concluded that their slowest mode is connected to the dc conduction process while their β JG process is primary relaxation of trehalose and maltose.

  8. sup 137 Cs and sup 134 Cs human internal contamination in Italy following the 1986 Chernobyl event

    Energy Technology Data Exchange (ETDEWEB)

    Tarroni, G.; Melandri, C.; Battisti, P.; Castellani, C.M.; Formignani, M. (ENEA, Bologna (Italy)); Rampa, E. (ENEA, Rome (Italy))

    1990-01-01

    A synthesis of the data concerning the distribution and behaviour over time until September 1989 of {sup 134}Cs and {sup 137}Cs human contamination derived from the accident to Unit 4 of the Chernobyl Nuclear Power Station on 26 April 1986, is presented. The controls have been performed by means of two intercalibrated whole-body counters on healthy adult male and female volunteers living in different Italian regions. The main topics investigated are: the behaviour over time of the contamination in Bologna and Rome; geographic distribution in Italy in September 1987; the statistical distribution of data; the variability of the individual activity in relation to the mean activity of homogeneous groups; the intersex differences; and the effect of the element's biokinetic uncertainties on the committed effective dose equivalent evaluation. Trends are also found, mainly useful where extended contamination involves too large a fraction of the population for individual control of all the subjects concerned, thus requiring the identification of small groups of individuals representative of large population groups. (author).

  9. The methylenetetrahydrofolate reductase (MTHFR) C677T polymorphism and tumor risk: evidence from 134 case-control studies.

    Science.gov (United States)

    Tang, Min; Wang, Shang-Qian; Liu, Bian-Jiang; Cao, Qiang; Li, Bing-Jie; Li, Peng-Chao; Li, Yong-Fei; Qin, Chao; Zhang, Wei

    2014-07-01

    Methylenetetrahydrofolate reductase (MTHFR) is an important enzyme involved in folate metabolism, which is essential for DNA synthesis and methylation. Genetic variations in the MTHFR gene seem to contribute to a decreased activity of MTHFR, ultimately confer increased susceptibility to cancer. As the most extensively studied polymorphism, MTHFR C677T polymorphism was shown to contribute to cancer susceptibility but the results were inconsistent. The authors performed a meta-analysis including 134 studies (46,207 cases and 69,160 controls) to address the issue. Odds ratios (ORs) with corresponding 95% confidence intervals (CIs) were used to assess the association. Overall, a significant elevated risk of cancer was associated with the MTHFR C677T polymorphism in T-allele versus C-allele comparison (OR = 1.06, 95% CI 1.02-1.11, P(heterogeneity) MTHFR C677T polymorphism and increased risk of esophageal and stomach cancer, especially among Asians. Additionally, more high-quality studies and that the covariates responsible for heterogeneity should be controlled to obtain a more conclusive response about the function of MTHFR C677T in cancer.

  10. Development of 1,3,4-oxadiazole thione based novel anticancer agents: Design, synthesis and in-vitro studies.

    Science.gov (United States)

    Yadav, Nalini; Kumar, Parveen; Chhikara, Aruna; Chopra, Madhu

    2017-11-01

    A series of new 1,3,4-oxadiazole-2(3H)-thione analogues (3a to 3o) have been designed, synthesized and evaluated for their anticancer activity. Four different cancerous cell lines viz. HeLa (cervical), U-87 (glioblastoma), Panc (pancreatic) and MCF-7 (breast) were used to assess the potency of the synthesized compounds as anticancer agents. Among them 3i and 3j showed promising cytotoxicity against HeLa cell line. Further, 3i and 3j successfully inhibited cell cycle progression and displayed cell death in HeLa cells via apoptosis as visualized by Annexin V APC and DNA fragmentation assay. 3i and 3j induced caspase-3 activation, PARP cleavage, increase in expression of proapoptotic protein Bax and decrease in the expression of antiapoptotic protein Bcl-2. Also, 3i and 3j induced overexpression of p21 and decreased expression of cyclin B1 indicating the arrest of cells in G2-M phase of the cell cycle. Therefore, new lead compounds are being suggested having anticancer activity through cell cycle inhibition and apoptosis. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  11. The effect of heating direction on flow boiling heat transfer of R134a in micro-channels

    Science.gov (United States)

    Xu, Mingchen; Jia, Li; Dang, Chao; Peng, Qi

    2017-04-01

    This paper presents effects of heating directions on heat transfer performance of R134a flow boiling in micro- channel heat sink. The heat sink has 30 parallel rectangular channels with cross-sectional dimensions of 500μm width 500μm depth and 30mm length. The experimental operation condition ranges of the heat flux and the mass flux were 13.48 to 82.25 W/cm2 and 373.3 to 1244.4 kg/m2s respectively. The vapor quality ranged from 0.07 to 0.93. The heat transfer coefficients of top heating and bottom heating both were up to 25 kW/m2 K. Two dominate transfer mechanisms of nucleate boiling and convection boiling were observed according to boiling curves. The experimental results indicated that the heat transfer coefficient of bottom heating was 13.9% higher than top heating in low heat flux, while in high heat flux, the heat transfer coefficient of bottom heating was 9.9%.higher than the top heating, because bubbles were harder to divorce the heating wall. And a modified correlation was provided to predict heat transfer of top heating.

  12. A Study of the Heat Transfer Coefficient of a Mini Channel Evaporator with R-134a as Refrigerant

    Science.gov (United States)

    Dollera, E. B.; Villanueva, E. P.

    2015-09-01

    The present study is to evaluate the heat transfer coefficient of the minichannel copper blocks used as evaporator with R-134a as the refrigerant. Experiments were conducted using three evaporator specimens of different channel hydraulic diameters (1.0mm, 2.0mm, 3.0mm). The total length for each channel is 640 mm. The dimension of each is 100mm.x50mm.x20mm. and the outside surfaces were machined to have fins. They were connected to a standard vapour compression refrigeration system. During each run of the experiment, the copper block evaporator was placed inside a small wind tunnel where controlled flow of air from a forced draft fan was introduced for the cooling process. The experimental set-up used data acquisition software and computer-aided simulation software was used to simulate the pressure drop and temperature profiles of the evaporator during the experimental run. The results were then compared with the Shah correlation. The Shah correlation over predicted and under predicted the values as compared with the experimental results for all of the three diameters and high variation for Dh=1.0mm. This indicates that the Shah correlation at small diameters is not the appropriate equation for predicting the heat transfer coefficient. The trend of the heat transfer coefficient is increasing as the size of the diameter increases.

  13. Production of highly-enriched 134Ba for a reference material for isotope dilution mass spectrometry measurements

    Energy Technology Data Exchange (ETDEWEB)

    J.J. Horkley; K.P/ Carnery; E.M. Gantz; J.E. Davis; R.R. Lewis; J.P. Crow; C.A. Poole; T.S. Grimes; J.J. Giglio

    2015-03-01

    t Isotope dilution mass spectrometry (IDMS) is an analytical technique capable of providing accurate and precise quantitation of trace isotope abundance and assay providing measurement uncertainties below 1 %. To achieve these low uncertainties, the IDMS method ideally utilizes chemically pure ‘‘spike’’ solutions that consist of a single highly enriched isotope that is well-characterized relating to the abundance of companion isotopes and concentration in solution. To address a current demand for accurate 137Cs/137Ba ratio measurements for ‘‘age’’ determination of radioactive 137Cs sources, Idaho National Laboratory (INL) is producing enriched 134Ba isotopes that are tobe used for IDMS spikes to accurately determine 137Ba accumulation from the decay of 137Cs. The final objective of this work it to provide a homogenous set of reference materials that the National Institute of Standards and Technology can certify as standard reference materials used for IDMS. The process that was developed at INL for the separation and isolation of Ba isotopes, chemical purification of the isotopes in solution,

  14. Fatores de morbimortalidade na cirurgia eletiva do aneurisma da aorta abdominal infra-renal: experiência de 134 casos Morbidity and mortality factors in the elective surgery of infrarenal abdominal aortic aneurysm: a case study with 134 patients

    Directory of Open Access Journals (Sweden)

    Aquiles Tadashi Ywata de Carvalho

    2008-09-01

    Full Text Available CONTEXTO: O tratamento cirúrgico convencional do aneurisma da aorta abdominal (AAA infra-renal pode resultar em complicações graves. A fim de otimizar os resultados na evolução do tratamento, é importante que sejam identificados os pacientes predispostos a determinadas complicações e instituídas condutas preventivas. OBJETIVOS: Avaliar a taxa de mortalidade operatória precoce, analisar as complicações pós-operatórias e identificar os fatores de risco relacionados com a morbimortalidade. MÉTODO: Foram analisados 134 pacientes com AAA infra-renal submetidos a correção cirúrgica eletiva no período de fevereiro de 2001 a dezembro de 2005. RESULTADOS: A taxa de mortalidade foi de 5,2%, sendo secundária principalmente a infarto agudo de miocárdio (IAM e isquemia mesentérica. As complicações cardíacas foram as mais freqüentes, seguidas das pulmonares e renais. A presença de diabetes melito (DM, insuficiência cardíaca congestiva (ICC, insuficiência coronariana (ICO e cintilografia miocárdica positiva para isquemia estiveram associadas às complicações cardíacas. A idade avançada, a doença pulmonar obstrutiva crônica (DPOC e a capacidade vital forçada reduzida aumentaram os riscos de atelectasia e pneumonia. História de nefropatia, tempo de pinçamento aórtico prolongado e níveis de uréia elevados aumentaram os riscos de insuficiência respiratória aguda (IRA. A isquemia dos membros inferiores esteve associada ao tabagismo e à idade avançada, e a maior taxa de mortalidade, à presença de coronariopatia, tempos prolongados de pinçamento aórtico e de cirurgia. CONCLUSÃO: A taxa de morbimortalidade esteve compatível com a literatura nacional e internacional, sendo secundária às complicações cardíacas, respiratórias e renais. Os fatores de risco identificados no pré e transoperatório estiveram relacionados com essas complicações.BACKGROUND: Conventional surgical treatment of infrarenal abdominal

  15. Pages 134 - 139.pmd

    African Journals Online (AJOL)

    Administrator

    Department of Biology, Bahir Dar University, Science College, P.O. Box 79, Bahir Dar, Ethiopia. 3. Department of Microbiology, Parasitology and Immunology, College of Medicine and Health ... have occurred in time so that updated recommendation for optimal empirical therapy of. UTI can be made12. Routine antimicrobial ...

  16. 129 - 134 Abdullahi 2

    African Journals Online (AJOL)

    User

    2015-12-02

    Dec 2, 2015 ... The toxicity of plants is caused by the presence of certain compounds such as cyanogenic glycosides and lectins. (Daisy et al., 2009). Many food plants possess toxic compounds unless processed, or are toxic at certain stages of their life. Several plant extracts have been examined for use in a wide variety ...

  17. PTH 1-34 Ameliorates the Osteopenia and Delayed Healing of Stabilized Tibia Fracture in Mice with Achondroplasia Resulting from Gain-Of-Function Mutation of FGFR3

    Science.gov (United States)

    Chen, Hangang; Sun, Xianding; Yin, Liangjun; Chen, Shuai; Zhu, Ying; Huang, Junlan; Jiang, Wanling; Chen, Bo; Zhang, Ruobin; Chen, Lin; Nie, Mao; Xie, Yangli; Deng, Zhongliang

    2017-01-01

    Bone fracture healing is processed through multiple stages including the cartilaginous callus formation and its transition to bony callus. FGFR3 negatively regulates chondrogenesis and enhances osteogenesis during skeleton development. We previously found in mice carrying gain-of-function mutation of FGFR3 that FGFR3 delays the healing of un-stabilized fracture that heals mainly through endochondral ossification. Since fracture is regularly treated in clinics with rigid fixation, and stabilized fracture is healed largely through intramembranous ossification, we asked whether FGFR3, a key regulator of osteogenesis, also affect the regeneration of stabilized fracture. We found that gain-of-function mutation of FGFR3 inhibits the initiation of chondrogenesis and the subsequent bone formation. We further studied whether PTH1-34 can improve the osteopenia and delayed healing of the stabilized tibia fracture in mice with achondroplasia. Fracture healing was evaluated by radiography, micro-CT, biomechanical tests, histology, and real-time polymerase chain reaction (RT-PCR) analysis. We found that PTH 1-34 can alleviate the decreased bone mass and compromised architecture in ACH mice. Histological analysis revealed that administration of PTH1-34 increased the size of both the total callus and cartilaginous callus at 14 days after the surgery in ACH mice. RT-PCR data suggested that systemic PTH1-34 accelerated the initiation of chondrogenesis and chondrocyte maturation (earlier and higher levels of expression of chondrogenesis related markers) and enhanced the osteogenic differentiation in the fracture callus in ACH mice. These results indicate that the PTH1-34 administration resulted in an enhanced callus formation during bone fracture healing in ACH mice, which is at least in part mediated by an increase of cartilaginous callus at early stage and the promotion of bone formation in bony callus. In summary, in this study we revealed that FGFR3 delays the regeneration of

  18. Fallout and drinking water contamination by I-131 and Cs-134, 137 in Japan, from the Fukushima Daiichi NPS accident

    Energy Technology Data Exchange (ETDEWEB)

    Kelecom, Alphonse; Miyashita, Erika; Kelecom, Patrick Vicent [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil)

    2011-07-01

    The earthquake followed by a tsunami in Japan, on last March 11, seriously damaged four of the six reactors of the Fukushima Daiichi nuclear power station (NPS). Radioactive smokes and highly contaminated water were released for weeks to the environment. Since March 12, when the plant operator TEPCO and Japan's nuclear agency (NISA) confirmed the presence of radionuclides near the NPS, a giant environmental monitoring operation was set up, covering the entire Japanese territory. Daily thousands measurements are realized. We here analyze data released during 60 days on I-131 and Cs-134,137 radioactive concentrations in drinking water and fallout for 45 prefectures. Miyagi and Fukushima, that requires a separate study, are not considered here. Drinking water contamination by I-131 was observed in 13 prefectures, including Tokyo. The most impacted one was Tochigi (maximum of 110 Bq/l, March 24). This value turned water not drinkable for infants and babies. Cs-137 was detected in drinking water in 8 prefectures, with a maximum level of 18 Bq/l in Ibaraki. These levels do not affect potability of tap water. I-131 was observed in fallout in 27 prefectures, with level reaching 93 kBq/m2 in Ibaraki and 36 kBq/m{sup 2} in Tokyo on March 21 and 23 respectively. Fallout of Cs-137 was observed in 19 prefectures. The maximum deposition occurred again in Ibaraki (13kBq/m{sup 2}, March 21) and in Tokyo (5.3 kBq/m2, March 22). Since mid April, only trace contamination has been observed for both radionuclides in drinking water. Sporadically medium levels of Cs-137 are still observed in fallout. (author)

  19. Oral Health-Related Quality of Life among a large national cohort of 87,134 Thai adults

    Directory of Open Access Journals (Sweden)

    Seubsman Sam-ang

    2011-06-01

    Full Text Available Abstract Background Oral health has been of interest in many low and middle income countries due to its impact on general health and quality of life. But there are very few population-based reports of adult Oral Health Related Quality of Life (OHRQoL in developing countries. To address this knowledge gap for Thailand, we report oral health findings from a national cohort of 87,134 Thai adults aged between 15 and 87 years and residing all over the country. Methods In 2005, a comprehensive health questionnaire was returned by distance learning cohort members recruited through Sukhothai Thammathirat Open University. OHRQoL dimensions included were discomfort speaking, swallowing, chewing, social interaction and pain. We calculated multivariate (adjusted associations between OHRQoL outcomes, and sociodemographic, health behaviour and dental status. Results Overall, discomfort chewing (15.8%, social interaction (12.5%, and pain (10.6% were the most commonly reported problems. Females were worse off for chewing, social interaction and pain. Smokers had worse OHRQoL in all dimensions with Odds Ratios (OR ranging from 1.32 to 1.51. Having less than 20 teeth was strongly associated with difficulty speaking (OR = 6.43, difficulty swallowing (OR = 6.27, and difficulty chewing (OR = 3.26. Conclusions Self-reported adverse oral health correlates with individual function and quality of life. Outcomes are generally worse among females, the poor, smokers, drinkers and those who have less than 20 teeth. Further longitudinal study of the cohort analysed here will permit assessment of causal determinants of poor oral health and the efficacy of preventive programs in Thailand.

  20. [Hip rotation degrees, intoeing problem, and sitting habits in nursery school children: an analysis of 1,134 cases].

    Science.gov (United States)

    Altinel, Levent; Köse, Kamil Cağri; Aksoy, Yusuf; Işik, Cengiz; Erğan, Volkan; Ozdemir, Aykut

    2007-01-01

    We investigated hip rotation degrees, frequency of intoeing problems, and sitting habits in nursery school children and the relationship between these parameters. The study included 1,134 children (612 boys, 522 girls), aged between three to six years, attending 26 nursery schools in the central area of Afyon. First, informed consent was obtained from the parents and a questionnaire was administered about demographic data and sitting habits of the children. Then, the children were examined in lower underwear. Foot progression angles were determined and progression to midline during walking was evaluated as intoeing. Internal and external rotation degrees of the hips were measured using a goniometer in prone and supine positions. In girls, internal rotation of the hip was nearly 13 degrees greater in the prone position, and 9 degrees greater in the supine position compared to those of the boys. Intoeing was detected in 67 children (5.9%), 76.1% being bilateral. The girl-to-boy ratio was 2.4/1. Intoeing problem originated from the femur in 74.6%, and from the tibia in 25.4%. Compared to normal children, intoeing was associated with a greater internal rotation and a smaller external rotation of the hip. Overall, 36.7% had a crossed-leg sitting habit, and 63.3% had a television sitting habit. The latter was more frequent in intoeing children (p=0.001). Although hip rotation degrees in our study were similar to those reported in the literature, higher hip internal rotation degrees were found especially in girls. Television sitting which is a frequently preferred position among nursery school children was significantly prevalent in intoeing children.

  1. Biofilm vs. Planktonic Lifestyle: Consequences for Pesticide 2,4-D Metabolism by Cupriavidus necator JMP134

    Directory of Open Access Journals (Sweden)

    Thomas Z. Lerch

    2017-05-01

    Full Text Available The development of bacterial biofilms in natural environments may alter important functions, such as pollutant bioremediation by modifying both the degraders' physiology and/or interactions within the matrix. The present study focuses on the influence of biofilm formation on the metabolism of a pesticide, 2,4-dichlorophenoxyacetic acid (2,4-D, by Cupriavidus necator JMP134. Pure cultures were established in a liquid medium with 2,4-D as a sole carbon source with or without sand grains for 10 days. Bacterial numbers and 2,4-D concentrations in solution were followed by spectrophotometry, the respiration rate by gas chromatography and the surface colonization by electron microscopy. In addition, isotopic techniques coupled with Fatty Acid Methyl Ester (FAME profiling were used to determine possible metabolic changes. After only 3 days, approximately 80% of the cells were attached to the sand grains and microscopy images showed that the porous medium was totally clogged by the development of a biofilm. After 10 days, there was 25% less 2,4-D in the solution in samples with sand than in control samples. This difference was due to (1 a higher (+8% mineralization of 2,4-D by sessile bacteria and (2 a retention (15% of 2,4-D in the biofilm matrix. Besides, the amount of carbohydrates, presumably constituting the biofilm polysaccharides, increased by 63%. Compound-specific isotope analysis revealed that the FAME isotopic signature was less affected by the biofilm lifestyle than was the FAME composition. These results suggest that sessile bacteria differ more in their anabolism than in their catabolism compared to their planktonic counterparts. This study stresses the importance of considering interactions between microorganisms and their habitat when studying pollutant dynamics in porous media.

  2. Surgical treatment of the impingement syndrome and of the rotator cuff tears: personal experience in 134 cases

    Directory of Open Access Journals (Sweden)

    A. Rioda

    2011-09-01

    Full Text Available The time-course covered by the original definition of scapulo-humeral periarthritis suggested by Duplay through the more recent term of subacromial impingement syndrome coined by Neer, follows the identification of the pathogenetic mechanisms leading to chronic subacromial impingement and degenerative tears of the rotator cuff. The Authors recall the functional-anatomic development evolution of the shoulder and the disequilibrium between the depressor and the elevator muscles which may promote the chronic friction against the acromion. However, the actual pathogenesis of the impingement still remains controversial. We evaluated 134 patients (81F, 53M, mean age 56.4 years with chronic subacromial impingement syndrome. In 92 cases (69% non traumatic tears of the rotator cuff were also present as confirmed by ultrasonography in 94 cases, CT in18 cases and magnetic resonance in 102 cases. The different tear patterns of the rotator cuff were classified as suggested by Ellman (L shaped, L reverse, triangular, trapezoidal and massive with retraction and clinical results were analysed following Sahlstrand clinical criteria and Costant numerical scale. According to the anatomical damage, patients were divided into those with impingement without severe cuff tendinopathy (42 cases, those with rotator cuff tears without loss of motion of the shoulder (32 cases and those with cuff tears and loss of active motion (60 cases. The different surgical techniques and rehabilitation procedures after surgery are also reported. After a mean follow-up of 1.3 years (range 8 months - 2 years, good or excellent results were obtained in 91% of the patients without rotator cuff tears, in 87% of the patients with tears but without loss of motion and in 75% of the cases with loss of active motion. Our data demonstrate that in the majority of patients with chronic impingement syndrome and rotator cuff tears, surgical treatment shows high success rates. When surgery is

  3. Body mass index and health-related behaviours in a national cohort of 87,134 Thai open university students.

    Science.gov (United States)

    Banwell, C; Lim, L; Seubsman, S A; Bain, C; Dixon, J; Sleigh, A

    2009-05-01

    Thailand is undergoing a health-risk transition with overweight and obesity emerging as an important population health problem. This paper reports on a study of the transition, focusing on "lifestyle" factors such as diet (fried foods, soft drinks, Western-style fast foods) and physical activity (mild, moderate, strenuous exercise, housework/gardening and screen time). A baseline survey was administered to 87 134 adult students from all regions of Thailand attending an open university. 54% of the cohort was female. Participants' median age was 29 years. By self-reported Asian standards, 16% of the sample was obese (body mass index (BMI)>or=25) and 15% overweight at risk (BMI>or=23-24.9). Men were twice as likely as women to be overweight (21% vs 9%) or obese (23% vs 10%). Obesity was associated with urban residence and doing little housework or gardening and with spending more than 4 hours a day watching television or using computers. The latter occurred among 30% of the cohort, with a population attributable fraction (PAF) suggesting that it accounts for 11% of the current problem. Daily consumption of fried food was associated with obesity, and eating fried foods every second day or daily had a PAF of nearly 20%. These health-related behaviours underpinning the Thai health transition are associated with increasing obesity. They are modifiable through policies addressing structural issues and with targeted health promotion activities to prevent future obesity gains. Insights into future trends in the Thai health transition can be gained as this student cohort ages.

  4. Decay out of the yrast and excited highly-deformed bands in the even-even nucleus {sup 134}Nd

    Energy Technology Data Exchange (ETDEWEB)

    Petrache, C.M.; Bazzacco, D.; Lunardi, S. [Sezione di Padova (Italy)] [and others

    1996-12-31

    The resolving power achieved by the new generation of {gamma}-ray detector arrays allows now to observe transitions with intensities of the order of {approximately}10{sup {minus}3} of the population of the final residual nucleus, making therefore feasible the study of the very weakly populated excited bands built on the superdeformed (SD) minimum or of the decay out of the SD bands. As a matter of fact, numerous excited SD bands have been observed in the different regions of superdeformation, which led to a deeper understanding of the single-particle excitation in the second minimum. The first experimental breakthrough in the study of the decay out process has been achieved in the odd-even {sup 133,135}Nd nuclei of the A=130 mass region. There, the observation of the discrete linking transitions has been favored by the relatively higher intensity of the highly-deformed (HD) bands ({approximately}10%), as well as by the small excitation energy with respect to the yrast line in the decay-out region ({approximately}1 MeV). No discrete linking transitions have been so far observed in the A=80, 150 mass regions. The present results suggest that the decay out of the HD bands in {sup 134}Nd is triggered by the crossing with the N=4 [402]5/2{sup +} Nilsson orbital, that has a smaller deformation than the corresponding N=6 intruder configuration. The crossing favours the mixing with the ND rotational bands strongly enhancing the decay-out process and weakening the in-band transition strength. The HD band becomes fragmented and looses part of its character. The intensity of the decay-out transitions increases when the spin of the HD state decreases, indicating enhanced ND amplitude in the wavefunction when going down the band. Lifetime measurements of the HD bands are crucial to further elucidate the decay-out process.

  5. A Novel 2.3 Mb Microduplication of 9q34.3 Inserted into 19q13.4 in a Patient with Learning Disabilities

    Directory of Open Access Journals (Sweden)

    Shalinder Singh

    2012-01-01

    Full Text Available Insertional translocations in which a duplicated region of one chromosome is inserted into another chromosome are very rare. We report a 16.5-year-old girl with a terminal duplication at 9q34.3 of paternal origin inserted into 19q13.4. Chromosomal analysis revealed the karyotype 46,XX,der(19ins(19;9(q13.4;q34.3q34.3pat. Cytogenetic microarray analysis (CMA identified a ~2.3Mb duplication of 9q, which was confirmed by Fluorescence in situ hybridisation (FISH. The duplication at 9q34.3 is the smallest among the cases reported so far. The proband exhibits similar clinical features to those previously reported cases with larger duplication events.

  6. Long non-coding RNA PCAT7 regulates ELF2 signaling through inhibition of miR-134-5p in nasopharyngeal carcinoma.

    Science.gov (United States)

    Liu, Yejun; Tao, Zezhang; Qu, Jining; Zhou, Xuhong; Zhang, Chenghong

    2017-09-16

    While some long noncoding RNAs (lncRNAs) might promote nasopharyngeal carcinoma (NPC) initiation and progression, the involved molecular mechanisms remain largely unclear. Here, we discovered the novel LncRNA, prostate cancer associated transcript 7 (PCAT7), which was overexpressed and associated with worse prognosis in NPC. Decreased PCAT7 expression was found to significantly suppress tumor cell proliferation in vitro, and inhibited tumor growth and reduced the expression of proliferation antigen Ki-67 in vivo. Rescue assay was performed to further confirm that PCAT7 contributed to the progression of NPC through regulating miR-134-5p/ELF2 signal pathway. These results indicated that PCAT7 might contribute to the tumor progression in NPC by functioning as a ceRNA to sponge miR-134-5p. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Improved synthesis of 1,3,4-thiadiazolium-2-phenylamines using microwave and ultrasound irradiation and investigation of their cytotoxic activity

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Camilla Moretto dos; Miranda, Amanda Fraga; Echevarria, Aurea, E-mail: echevarr@ufrrj.b [Universidade Federal Rural do Rio de Janeiro (DQ/ICE/UFRRJ), Seropedica, RJ (Brazil). Inst. de Ciencias Exatas. Dept. de Quimica; Echevarria-Lima, Juliana [Universidade Federal do Rio de Janeiro (DI/IMPG/UFRJ), RJ (Brazil). Inst. de Microbiologia Paulo de Goes. Dept. de Imunologia

    2011-07-01

    A new and efficient synthesis of eight 1,3,4-thiadiazolium-2-phenylamine derivatives (1-8, where 8 is novel in the literature) was performed using thionyl chloride or trimethylsilyl chloride as catalysts under microwave or ultrasound irradiation. The target compounds were obtained in good yields and remarkably short times, 5 min under microwave irradiation and 10 min under ultrasound irradiation, where compared to traditional methodology (24 to 48 h at room temperature standing). The best yields were obtained using the microwave irradiation and, in general way, using thionyl chloride instead trimethylsilyl chloride. The cytotoxicity against K562 human leukemia and Daudi lymphoma lines was evaluated and showed promising results from the 4-phenyl-5-(4'-nitro-styryl)-1,3,4-thiadiazolium-2-phenylamine chloride derivative. (author)

  8. Viscosity measurements and correlations of binary mixtures: 1,1,1,2-tetrafluoroethane (HFC-134a)+tetraethylene glycol dimethylether (TEGDME)

    DEFF Research Database (Denmark)

    Monsalvo, Matias Alfonso; Baylaucq, A.; Reghem, P.

    2005-01-01

    This paper reports viscosity data for the binary system 1, 1, 1,2-tetrafluoroethane (HFC-134a), x(1), +tetraethylene glycol dimethylether (TEGDME), 1 - x(1). The measurements (200 data points) were obtained at various pressures (between 10 and 100 MPa) in the homogeneous liquid state from T= 293.......15-373.15 K. The measurements have been carried out with a failing body viscometer for four molar fractions x(1) =(0.28, 0.44, 0.63 and 0.88). The density values of this system were interpolated from previous results obtained at the laboratory. All of the available viscosity data, including pure HFC-134a...... and pure TEGDME (both previously studied at the laboratory), have been correlated using several viscosity models (mixing rules, self-refrencing model, hard-sphere theory, friction theory and free volume model). The resulting models are presented and discussed in this work. (c) 2005 Elsevier B.V. All rights...

  9. 134Cs and 137Cs activities in coastal seawater along Northern Sanriku and Tsugaru Strait, northeastern Japan, after Fukushima Dai-ichi Nuclear Power Plant accident.

    Science.gov (United States)

    Inoue, M; Kofuji, H; Hamajima, Y; Nagao, S; Yoshida, K; Yamamoto, M

    2012-09-01

    A total of 37 seawater samples were collected at 10 sites along the coastline of the Northern Sanriku and Tsugaru Strait, 250-450 km north of the Fukushima Dai-ichi Nuclear Power Plant in April-December 2009 and May-June 2011, and analyzed for (134)Cs and (137)Cs activities using low-background γ-spectrometry. The (134)Cs and (137)Cs activities measured in these samples in May 2011 were found to be 2-3 mBq/L and 2.5-4 mBq/L, respectively. By June, these values had decreased by 25-45%/month and 5-30%/month, respectively. These results can be plausibly explained by surface infusion of these isotopes into the sea by atmospheric transport from Fukushima and their subsequent reduction by water migration to off-shore and deeper regions. Copyright © 2011 Elsevier Ltd. All rights reserved.

  10. Synthesis of some new 5-substituted-2-((6-chloro-3,4-methylenedioxyphenylmethylthio-1,3,4-oxadiazole derivatives as suitable antibacterial inhibitors

    Directory of Open Access Journals (Sweden)

    Aziz-ur-Rehman

    2015-06-01

    Full Text Available Heterocyclic molecules belong to the most attractive group owing to their broad spectrum of antimicrobial activities. In the undertaken research, a number of new 5-substituted-2-((6-chloro-3,4-methylenedioxyphenylmethylthio-1,3,4-Oxadiazole derivatives (6a–l were synthesized by converting various aryl/aralkyl carboxylic acids (1a–l into corresponding esters (2a–l, carbohydrazides (3a–l and 5-substituted-1,3,4-Oxadiazol-2-thiols (4a–l. The last step included the synthesis of target molecules, 6a–l, by stirring 4a–l and 6-chloro-3,4-methylenedioxybenzyl chloride (5 in a polar aprotic solvent. The structures of all the synthesized molecules were corroborated through spectral analysis. The screening of these molecules against antibacterial activity rendered them moderate inhibitors and most likely against Escherichia coli, relative to the reference standard, ciprofloxacin.

  11. The crystal structure of 6-(4-chlorophenyl-2-(4-methylbenzylimidazo[2,1-b][1,3,4]thiadiazole-5-carbaldehyde

    Directory of Open Access Journals (Sweden)

    A. Sowmya

    2016-10-01

    Full Text Available In the title imidazo[2,1-b][1,3,4]thiadiazole derivative, C19H14ClN3OS, the 4-methylbenzyl and chlorophenyl rings are inclined to the planar imidazo[2,1-b][1,3,4]thiadiazole moiety (r.m.s. deviation = 0.012 Å by 64.5 (1 and 3.7 (1°, respectively. The molecular structure is primarily stabilized by a strong intramolecular C—H...O hydrogen bond, leading to the formation of a pseudo-seven-membered S(7 ring motif, and a short intramolecular C—H...N contact forming an S(5 ring motif. In the crystal, molecules are linked by pairs of C—H...S hydrogen bonds, forming inversion dimers. The dimers are linked by C—H...O and C—H...π interactions, forming chains propagating along [110].

  12. Measurement of airborne 131I, 134Cs, and 137Cs nuclides due to the Fukushima reactors accident in air particulate in Milan (Italy)

    CERN Document Server

    Clemenza, Massimiliano; Previtali, Ezio; Sala, Elena

    2011-01-01

    After the earthquake and the tsunami occurred in Japan on 11th March 2011, four of the Fukushima reactors had released in air a large amount of radioactive isotopes that had been diffused all over the world. The presence of airborne 131I, 134Cs, and 137Cs in air particulate due to this accident has been detected and measured in the Low Radioactivity Laboratory operating in the Department of Environmental Sciences of the University of Milano-Bicocca. The sensitivity of the detecting apparatus is of 0.2 \\mu Bq/m3 of air. Concentration and time distribution of these radionuclides were determined and some correlations with the original reactor releases were found. Radioactive contaminations ranging from a few to 400 \\mu Bq/m3 for the 131I and of a few tens of \\mu Bq/m3 for the 137Cs and 134Cs have been detected

  13. SYNTHESIS AND ANTICONVULSANT ACTIVITY OF NOVEL 2-AMINO-5-[4-CHLORO-2-(2-CHLOROPHENOXY PHENYL]-1,3,4-THIADIAZOLE DERIVATIVES

    Directory of Open Access Journals (Sweden)

    Foroumadi A.

    2007-05-01

    Full Text Available Several novel 2-amino-5-[4-chloro-2-(2-chlorophenoxyphenyl]-1,3,4-thiadiazole derivatives 4a-d were synthesized and their anticonvulsant activity was determined by evaluation of the ability of theses compounds to protect mice against convulsion induced by a lethal doses of pentylentetrazole (PTZ and maximal electroshock (MES. The result of anticonvulsant data shows that among the synthesized compounds, 5-[4-chloro-2-(2-chlorophenoxyphenyl]-N-ethyl-1,3,4-thiadiazol-2-amine 4c was the most active compound in both MES and PTZ tests with an ED50 of 20.11 and 35.33 mg/kg, respectively.

  14. Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi Nuclear Power Plant accident

    Directory of Open Access Journals (Sweden)

    J. Kameník

    2013-09-01

    Full Text Available Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable 134Cs values that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2–1.5 Bq m–3 were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6–1.8 Bq m–3 were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m–3 (Station Aloha, 18 values. In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1–4 Bq m–3, and 137Cs levels were about 2–3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

  15. Resonance Energy Transfer Studies from Derivatives of Thiophene Substituted 1,3,4-Oxadiazoles to Coumarin-334 Dye in Liquid and Dye-Doped Polymer Media

    Science.gov (United States)

    Naik, Lohit; Deshapande, Narahari; Khazi, Imtiyaz Ahamed M.; Malimath, G. H.

    2017-11-01

    In the present work, we have carried out energy transfer studies using newly synthesised derivatives of thiophene substituted 1,3,4-oxadiazoles namely, 2-(-4-(thiophene-3-yl)phenyl)-5-(5-(thiophene-3-yl)thiophene-2-yl)-1,3,4-oxadiazole [TTO], 2-(-4-(benzo[b]thiophene-2-yl)phenyl)-5-(5-(benzo[b]thiophene-2-yl)-1,3,4-oxadiozole [TBO] and 2-(4-(4-(trifluoromethyl)phenyl)phenyl)-5-(5-(4-(trifluoromethyl)phenyl)thiophen-2-yl)-1,3,4-oxadiazole [TMO] as donors and laser dye coumarin-334 as acceptor in ethanol and dye-doped polymer (poly(methyl methacrylate) (PMMA)) media following steady-state and time-resolved fluorescence methods. Bimolecular quenching constant (k q), translation diffusion rate parameter (k d), diffusion length (D l), critical transfer distance (R 0), donor- acceptor distance (r) and energy transfer efficiency (E T) are calculated. It is observed that, critical transfer distance is more than the diffusion length for all the pairs. Further, bimolecular quenching constant is also more than the translation diffusion rate parameter. Hence, our experimental findings suggest that overall energy transfer is due to Förster resonance energy transfer (FRET) between donor and acceptor in both the media and for all the pairs. In addition, considerable increase in fluorescence intensity and energy transfer efficiency is observed in dye-doped polymer matrix systems as compared to liquid media. This suggests that, these donor-acceptor pairs doped in PMMA matrix may be used for applications such as energy transfer dye lasers (ETDL) to improve the efficiency and photostability, to enhance tunability and for plastic scintillation detectors.

  16. Thermodynamic characteristics of the adsorption of 1,3,4-oxadiazoles and 1,2,4,5-tetrazines from methanol and water-methanol solutions onto hypercrosslinked polystyrene

    Science.gov (United States)

    Saifutdinov, B. R.; Davankov, V. A.; Il'in, M. M.

    2017-03-01

    The thermodynamic characteristics of the adsorption of several 1,3,4-oxadiazoles and 1,2,4,5- tetrazines from methanol and water-methanol solutions onto neutral hypercrosslinked polystyrene with a degree of crosslinking of 150% are determined via high performance liquid chromatography. It is shown how the obtained characteristics depend on the molecular structure of adsorbed substances and the composition of the liquid phase in which adsorption occurs.

  17. Resonance Energy Transfer Studies from Derivatives of Thiophene Substituted 1,3,4-Oxadiazoles to Coumarin-334 Dye in Liquid and Dye-Doped Polymer Media

    Science.gov (United States)

    Naik, Lohit; Deshapande, Narahari; Khazi, Imtiyaz Ahamed M.; Malimath, G. H.

    2018-02-01

    In the present work, we have carried out energy transfer studies using newly synthesised derivatives of thiophene substituted 1,3,4-oxadiazoles namely, 2-(-4-(thiophene-3-yl)phenyl)-5-(5-(thiophene-3-yl)thiophene-2-yl)-1,3,4-oxadiazole [TTO], 2-(-4-(benzo[b]thiophene-2-yl)phenyl)-5-(5-(benzo[b]thiophene-2-yl)-1,3,4-oxadiozole [TBO] and 2-(4-(4-(trifluoromethyl)phenyl)phenyl)-5-(5-(4-(trifluoromethyl)phenyl)thiophen-2-yl)-1,3,4-oxadiazole [TMO] as donors and laser dye coumarin-334 as acceptor in ethanol and dye-doped polymer (poly(methyl methacrylate) (PMMA)) media following steady-state and time-resolved fluorescence methods. Bimolecular quenching constant ( k q), translation diffusion rate parameter ( k d), diffusion length ( D l), critical transfer distance ( R 0), donor- acceptor distance ( r) and energy transfer efficiency ( E T) are calculated. It is observed that, critical transfer distance is more than the diffusion length for all the pairs. Further, bimolecular quenching constant is also more than the translation diffusion rate parameter. Hence, our experimental findings suggest that overall energy transfer is due to Förster resonance energy transfer (FRET) between donor and acceptor in both the media and for all the pairs. In addition, considerable increase in fluorescence intensity and energy transfer efficiency is observed in dye-doped polymer matrix systems as compared to liquid media. This suggests that, these donor-acceptor pairs doped in PMMA matrix may be used for applications such as energy transfer dye lasers (ETDL) to improve the efficiency and photostability, to enhance tunability and for plastic scintillation detectors.

  18. Corrosion inhibition performance of 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole for carbon steel in HCl solution: Gravimetric, electrochemical and XPS studies

    Energy Technology Data Exchange (ETDEWEB)

    Bouanis, M.; Tourabi, M.; Nyassi, A. [Laboratoire de Catalyse et de Corrosion des Matériaux (LCCM), Faculté des Sciences, Université Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); Zarrouk, A. [LCAE-URAC 18, Faculty of Science, First Mohammed University, PO Box 717, M-60 000 Oujda (Morocco); Jama, C. [UMET-ISP, CNRS UMR 8207, ENSCL, Université Lille Nord de France, CS 90108, F-59652 Villeneuve d' Ascq Cedex (France); Bentiss, F., E-mail: fbentiss@gmail.com [Laboratoire de Catalyse et de Corrosion des Matériaux (LCCM), Faculté des Sciences, Université Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); UMET-ISP, CNRS UMR 8207, ENSCL, Université Lille Nord de France, CS 90108, F-59652 Villeneuve d' Ascq Cedex (France)

    2016-12-15

    Highlights: • 2,5-Bis(4-dimethylaminophenyl)-1,3,4-oxadiazole is good corrosion inhibitor for carbon steel in 1 M HCl. • XPS analysis has provided the composition of adsorbed protective layer on the steel surface. • The adsorption of the investigated 1,3,4-oxadiazole is mainly due to chemisorption. - Abstract: Corrosion inhibition of carbon steel in normal hydrochloric acid solution at 30 °C by 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole (DAPO) has been studied by weight loss measurements and electrochemical techniques (polarization and AC impedance). The experimental results showed that DAPO acted as an efficient inhibitor against the carbon steel corrosion in 1 M HCl, and its inhibition efficiency increased with the inhibitor concentration reaching a value up to 93% at 1 mM. Polarization studies showed that the DAPO was a mixed-type inhibitor. The adsorption of this 1,3,4-oxadiazole derivative on the carbon steel surface in 1 M HCl solution followed the Langmuir adsorption isotherm and the corresponding value of the standard Gibbs free energy of adsorption (ΔG°{sub ads}) is associated to a chemisorption mechanism. Scanning Electron Microscopy (SEM) and X-Ray Photoelectron Spectroscopy (XPS) analyses were carried out to characterize the chemical composition of the inhibitive film formed on the steel surface. The surfaces studies showed that the inhibitive layer is composed of an iron oxide/hydroxide mixture where DAPO molecules are incorporated. The cytotoxicity of DAPO was also determined using cell culture system.

  19. 2,5-Bis[(3,3,4,4,5,5,6,6,7,7,8,8,8-tridecafluorooctylsulfanyl]-1,3,4-thiadiazole

    Directory of Open Access Journals (Sweden)

    Gabriel Partl

    2017-02-01

    Full Text Available The title compound, C18H8F26N2S3, was obtained by double S-perfluorohexylethylation of dipotassium 1,3,4-thiadiazole-2,5-dithiolate in methanol. The molecule exhibits twofold rotational symmetry, with the S atom lying on the rotation axis. The fluorocarbon chains adopt helical conformations and the F atoms of the two terminal C atoms are disordered over two sets of sites. No directional intermolecular interactions occur in the crystal.

  20. Synthesis and evaluation of a series of pyrimidine substituted 1,3,4-oxadiazole derivatives as antimicrobial and anti-inflammatory agents

    Directory of Open Access Journals (Sweden)

    Sanath Kumar Goud Palusa

    2011-01-01

    Full Text Available Novel pyrimidine substituted 1,3,4-oxadiazole derivatives (11a-k were synthesized from the condensation of different substituted aromatic carboxylic acids with substituted pyrimidine carboxy hydrazide using POCl3 as condensing agent. Their structures were characterized by physical and spectral studies. The synthesized compounds were evaluated for their in vitro antimicrobial and anti-inflammatory activity. Some of the newly synthesized compounds showed good antimicrobial and anti-inflammatory activities.

  1. 4-Chloro-N-[3-methyl-1-(5-thioxo-4,5-dihydro-1,3,4-oxadiazol-2-ylbutyl]benzamide

    Directory of Open Access Journals (Sweden)

    Yu-Gang Yan

    2010-06-01

    Full Text Available In the title compound, C14H16ClN3O2S, the dihedral angle between the 4-chlorophenyl and 1,3,4-oxadiazole rings is 67.1 (1° and the orientation of the amide N—H and C=O bonds is anti. In the crystal, molecules are linked by N—H...O and N—H...S hydrogen bonds.

  2. Export of 134 Cs and 137 Cs in the Fukushima river systems at heavy rains by Typhoon Roke in September 2011

    Directory of Open Access Journals (Sweden)

    S. Nagao

    2013-10-01

    Full Text Available At stations on the Natsui River and the Same River in Fukushima Prefecture, Japan, effects of a heavy rain event on radiocesium export were studied after Typhoon Roke during 21–22 September 2011, six months after the Fukushima Dai-ichi Nuclear Power Plant accident. Radioactivity of 134Cs and 137Cs in river waters was 0.009–0.098 Bq L−1 in normal flow conditions during July–September 2011, but it increased to 0.85 Bq L−1 in high flow conditions because of heavy rains occurring with the typhoon. The particulate fractions of 134Cs and 137Cs were 21–56% of total radiocesium in the normal flow condition, but were close to 100% after the typhoon. These results indicate that the pulse input of radiocesium associated with suspended particles from land to coastal ocean occurred because of the heavy rain event. Export flux of 134Cs and 137Cs attributable to the heavy rain accounts for 30–50% of the annual radiocesium flux from inland to coastal ocean region in 2011. Results show that rain events are one factor contributing to the transport and dispersion of radiocesium in river watersheds and coastal marine environments.

  3. Utilization of 134Cs/137Cs in the environment to identify the reactor units that caused atmospheric releases during the Fukushima Daiichi accident

    Science.gov (United States)

    Chino, Masamichi; Terada, Hiroaki; Nagai, Haruyasu; Katata, Genki; Mikami, Satoshi; Torii, Tatsuo; Saito, Kimiaki; Nishizawa, Yukiyasu

    2016-08-01

    The Fukushima Daiichi nuclear power reactor units that generated large amounts of airborne discharges during the period of March 12-21, 2011 were identified individually by analyzing the combination of measured 134Cs/137Cs depositions on ground surfaces and atmospheric transport and deposition simulations. Because the values of 134Cs/137Cs are different in reactor units owing to fuel burnup differences, the 134Cs/137Cs ratio measured in the environment was used to determine which reactor unit ultimately contaminated a specific area. Atmospheric dispersion model simulations were used for predicting specific areas contaminated by each dominant release. Finally, by comparing the results from both sources, the specific reactor units that yielded the most dominant atmospheric release quantities could be determined. The major source reactor units were Unit 1 in the afternoon of March 12, 2011, Unit 2 during the period from the late night of March 14 to the morning of March 15, 2011. These results corresponded to those assumed in our previous source term estimation studies. Furthermore, new findings suggested that the major source reactors from the evening of March 15, 2011 were Units 2 and 3 and that the dominant source reactor on March 20, 2011 temporally changed from Unit 3 to Unit 2.

  4. Magnetic and magnetocaloric properties of spin-glass material DyNi{sub 0.67}Si{sub 1.34}

    Energy Technology Data Exchange (ETDEWEB)

    Chen, X. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); College of Physics and Electronic Information Engineering, Neijiang Normal University, Neijiang 641100 (China); Mudryk, Y., E-mail: slavkomk@ameslab.gov [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Pathak, A.K.; Feng, W. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Pecharsky, V.K. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Department of Materials Science and Engineering, Iowa State University, Ames, IA 50011-2300 (United States)

    2017-08-15

    Highlights: • Spin-glass state is observed in the DyNi{sub 0.67}Si{sub 1.4} compound. • Random Ni/Si distribution in the AlB{sub 2}-type structure leads to magnetic frustration. • Magnetic frustration affects magnetic field dependence of magnetocaloric effect. - Abstract: Structural, magnetic, and magnetocaloric properties of DyNi{sub 0.67}Si{sub 1.34} were investigated using X-ray powder diffraction, magnetic susceptibility, and magnetization measurements. X-ray powder diffraction pattern shows that DyNi{sub 0.67}Si{sub 1.34} crystallizes in the AlB{sub 2}-type hexagonal structure (space group: P6/mmm, No. 191, a = b = 3.9873(9) Å, and c = 3.9733(1) Å). The compound is a spin-glass with the freezing temperature T{sub G} = 6.2 K. The ac magnetic susceptibility measurements confirm magnetic frustration in DyNi{sub 0.67}Si{sub 1.34}. The maximum value of the magnetic entropy change determined from M(H) data is −16.1 J/kg K at 10.5 K for a field change of 70 kOe.

  5. Flow boiling heat transfer and pressure drop analysis of R134a in a brazed heat exchanger with offset strip fins

    Science.gov (United States)

    Amaranatha Raju, M.; Ashok Babu, T. P.; Ranganayakulu, C.

    2017-10-01

    The saturated flow boiling heat transfer and friction analysis of R 134a were experimentally analyzed in a brazed plate fin heat exchanger with offset strip fins. Experiments were performed at mass flux range of 50-82 kg/m2 s, heat flux range of 14-22 kW/m2 and quality of 0.32-0.75. The test section consists of three fins, one refrigerant side fin in which the boiling heat transfer was estimated and two water side fins. These three fins are stacked, held together and vacuum brazed to form a plate fin heat exchanger. The refrigerant R134a flowing in middle of the test section was heated using hot water from upper and bottom sides of the test section. The temperature and mass flow rates of water circuit is controlled to get the outlet conditions of refrigerant R134a. Two-phase flow boiling heat transfer and frictional coefficient was estimated based on experimental data for offset strip fin geometry and presented in this paper. The effects of mass flux, heat flux and vapour quality on heat transfer coefficient and pressure drop were investigated. Two-phase local boiling heat transfer coefficient is correlated in terms of Reynolds number factor F, and Martinelli parameter X. Pressure drop is correlated in terms of two-phase frictional multiplier ϕ f , and Martinelli parameter X.

  6. Energy savings with the effect of magnetic field using R290/600a mixture as substitute for CFC12 and HFC134a

    Directory of Open Access Journals (Sweden)

    Mani Kolandavel

    2008-01-01

    Full Text Available This paper presents an experimental study on the replacement of CFC12 and HFC134a by the new R290/R600a refrigerant mixture as drop-in replacement refrigerant with and without the effect of magnetic field. Without any modification to the system components drop-in experimental tests were performed on a vapour compression refrigeration system with a reciprocating compressor, which was originally designed to operate with CFC12.The test results with no magnets showed that the refrigerant R290/R600a had 19.9-50.1% higher refrigerating capacity than R12 and 28.6-87.2% than R134a. The mixture R290/R600a consumed 6.8- -17.4% more energy than R12. The coefficient of performance of R290/R600a mixture increases from 3.9-25.1% than R12 at lower evaporating temperatures and 11.8-17.6% at higher evaporating temperatures. The effect of magnetic field force reduced the compressor energy consumption by 1.5-2.5% than with no magnets. The coefficient of performance of the system was higher in the range 1.5-2.4% with the effect of magnetic field force. The R290/600a (68/32 by wt.% mixture can be considered as an excellent alternative refrigerant for CFC12 and HFC134a systems.

  7. Synthesis of new N-(5-chloro-2-methoxyphenyl-4-(5-substituted-1,3,4-oxadiazol-2-ylthiobutanamide derivatives as suitable lipoxygenase inhibitors

    Directory of Open Access Journals (Sweden)

    Aziz-ur-Rehman

    2016-09-01

    Full Text Available Heterocyclic compounds are the most attractive class for researchers due to their biological activities. In the undertaken research, a number of N-(5-chloro-2-methoxyphenyl-4-(5-substituted-1,3,4-oxadiazol-2-ylthiobutanamide (6a–k compounds were prepared by converting multifarious phenyl/aryl/aralkyl/heterocyclic organic acids (1a–k consecutively into the corresponding esters (2a–k, hydrazides (3a–k and 5-substituted-1,3,4-oxadiazol-2-thiols (4a–k. Finally, the target compounds 6a–k were synthesized by stirring 5-substituted-1,3,4-oxadiazol-2-thiols (4a–k with N-(5-chloro-2-methoxyphenyl-4-bromobutanamide (5 in the presence of N,N-dimethylformamide (DMF and sodium hydride (NaH. The structure elucidation of the synthesized compounds was processed through 1H-NMR, IR and mass spectral data. The synthesized compounds were screened against lipoxygenase enzyme (LOX and showed moderately good activities relative to the reference standard Baicalein.

  8. Pre-assessment of dose rates of (134)Cs, (137)Cs, and (60)Co for marine biota from discharge of Haiyang Nuclear Power Plant, China.

    Science.gov (United States)

    Li, Jingjing; Liu, Senlin; Zhang, Yongxing; Chen, Ling; Yan, Yuan; Cheng, Weiya; Lou, Hailin; Zhang, Yongbao

    2015-09-01

    Haiyang Nuclear Power Plant to be built in China was selected as a case for the dose pre-assessment for marine biota in this study. The concentrations of Cs and Co in organisms (turbot, yellow croaker, swimming crab, abalone, sea cucumber, and sea lettuce), seawater, and bottom sediment sampled on-site were measured by neutron activation analysis, and the site-specific transfer parameters (concentration ratios and distribution coefficients) of Cs and Co were calculated. (134)Cs, (137)Cs, and (60)Co activity concentrations in the organisms and the sediment at the site were calculated with the site-specific transfer parameters and the anticipated activity concentrations in the liquid effluent of the nuclear power plant. The ERICA tool was used to estimate the dose rates of (134)Cs, (137)Cs, and (60)Co to the selected organisms based on the biological models developed. The total dose rates of (134)Cs, (137)Cs, and (60)Co to the six organisms were all <0.001 μGy h(-1). Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Lateral variation of 134Cs and 137Cs concentrations in surface seawater in and around the Japan Sea after the Fukushima Dai-ichi Nuclear Power Plant accident.

    Science.gov (United States)

    Inoue, M; Kofuji, H; Nagao, S; Yamamoto, M; Hamajima, Y; Yoshida, K; Fujimoto, K; Takada, T; Isoda, Y

    2012-07-01

    A total of 82 surface seawater samples was collected in the Japan Sea and the southwestern Okhotsk Sea before and after the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident. Analysis of (134)Cs and (137)Cs concentrations using low-background γ-spectrometry revealed that the (137)Cs concentration of the samples collected in June 2011 was 1.5-2.8mBq/L, which is approximately 1-2 times higher than the pre-accident (137)Cs level, while the (134)Cs concentration was less than detectable to 1mBq/L. In addition to (134)Cs being clearly detected (∼1mBq/L), (137)Cs concentration in water samples from the northeastern Japan Sea (2-2.8mBq/L) was also higher than that from the coast in the southwestern Japan Sea (∼1.5mBq/L). These higher concentrations in the northeastern Japan Sea could be ascribed to the atmospheric transport of nuclides from the FDNPP as aerosols and subsequent transport and dilution after delivery to the sea surface. Copyright © 2012 Elsevier Ltd. All rights reserved.

  10. Deletion of hepatic FoxO1/3/4 genes in mice significantly impacts on glucose metabolism through downregulation of gluconeogenesis and upregulation of glycolysis.

    Directory of Open Access Journals (Sweden)

    Xiwen Xiong

    Full Text Available Forkhead transcription factors FoxO1/3/4 have pleiotrophic functions including anti-oxidative stress and metabolism. With regard to glucose metabolism, most studies have been focused on FoxO1. To further investigate their hepatic functions, we generated liver-specific FoxO1/3/4 knockout mice (LTKO and examined their collective impacts on glucose homeostasis under physiological and pathological conditions. As compared to wild-type mice, LTKO mice had lower blood glucose levels under both fasting and non-fasting conditions and they manifested better glucose and pyruvate tolerance on regular chow diet. After challenged by a high-fat diet, wild-type mice developed type 2 diabetes, but LTKO mice remained euglycemic and insulin-sensitive. To understand the underlying mechanisms, we examined the roles of SIRT6 (Sirtuin 6 and Gck (glucokinase in the FoxO-mediated glucose metabolism. Interestingly, ectopic expression of SIRT6 in the liver only reduced gluconeogenesis in wild-type but not LTKO mice whereas knockdown of Gck caused glucose intolerance in both wild-type and LTKO mice. The data suggest that both decreased gluconeogenesis and increased glycolysis may contribute to the overall glucose phenotype in the LTKO mice. Collectively, FoxO1/3/4 transcription factors play important roles in hepatic glucose homeostasis.

  11. Synthesis, spectral analysis and anti-bacterial study of N-substituted derivatives of 2-(5-(1-(phenylsulfonylpiperidin-4-yl-1,3,4-oxadiazol-2-ylthioacetamide

    Directory of Open Access Journals (Sweden)

    Hira Khalid

    2016-09-01

    Full Text Available 1,3,4-Oxadiazole bearing compounds are one of the most attractive class for researchers due to their biological activities. In the undertaken research, a number of N-substituted derivatives of 2-(5-(1-(phenylsulfonylpiperidin-4-yl-1,3,4-oxadiazol-2-ylthioacetamide (6a–n were synthesized through a series of steps. The reaction of benzenesulfonyl chloride with ethyl isonipecotate yielded ethyl 1-(phenylsulfonylpiperidin-4-carboxylate (1, which was further converted into 1-(phenylsulfonylpiperidin-4-carbohydrazide (2 and 5-(1-(phenylsulfonylpiperidin-4-yl-1,3,4-oxadiazol-2-thiol (3 respectively. The target compounds 6a–n were synthesized by the reaction of compound 3 with different N-aralkyl/aryl substituted 2-bromoacetamides (5a–n in the presence of a weak base and polar aprotic solvent. The structures of the synthesized compounds were elucidated through 1H-NMR, IR and mass spectral data. The synthesized compounds were screened against Gram-negative and Gram-positive bacteria and exhibited moderate to talented activity.

  12. Synthesis of some novel enzyme inhibitors and antibacterial agents derived from 5-(1-(4-tosylpiperidin-4-yl-1,3,4-oxadiazol-2-thiol

    Directory of Open Access Journals (Sweden)

    Almas Sattar

    Full Text Available ABSTRACT Keeping in mind the pharmacological importance of the 1,3,4-oxadiazole moiety, a series of new S-substituted derivatives, 5a-h, of 5-(1-(4-tosylpiperidin-4-yl-1,3,4-oxadiazol-2-thiol (3 were synthesized. The reaction of p-toluenesulfonyl chloride (a and ethyl isonipecotate (b produced ethyl 1-(4-tosylpiperidin-4-carboxylate (1 which was further transformed into 1-(4-tosylpiperidin-4-carbohydrazide (2 by hydrazine hydrate in methanol. Compound 2 was refluxed with CS2 in the presence of KOH to synthesize 5-(1-(4-tosylpiperidin-4-yl-1,3,4-oxadiazol-2-thiol (3. The desired compounds, 5a-h, were synthesized by stirring 3 with aralkyl halides, 4a-h, in DMF using NaH as an activator. The structures of synthesized compounds were elucidated by 1H-NMR, IR and EI-MS spectral studies. These compounds were further evaluated for enzyme inhibitory activity against lipoxygenase and alpha-glucosidase, along with antibacterial activity against Gram-negative and Gram-positive bacteria.

  13. Synthesis and Antibacterial Activity of Some Derivatives of 2-Methylbenzimidazole Containing 1,3,4-Oxadiazole or 1,2,4-Triazole Heterocycle

    Directory of Open Access Journals (Sweden)

    Cong Nguyen Tien

    2016-01-01

    Full Text Available 5-[(2-Methyl-1H-benzimidazol-1-ylmethyl]-1,3,4-oxadiazole-2-thiol or 5-[(2-methyl-1H-benzimidazol-1-ylmethyl]-4-(4-methylphenyl-1,2,4-triazol-3-thiol which were prepared starting from 2-methylbenzimidazole in the reaction with appropriate N-aryl-2-chloroacetamides afforded two series of N-aryl-2-{5-[(2-methyl-1H-benzimidazol-1-ylmethyl]-1,3,4-oxadiazol-2-yl}sulfanylacetamides and N-aryl-2-{5-[(2-methyl-1H-benzimidazol-1-ylmethyl]-4-(4-methylphenyl-4H-1,2,4-triazol-3-ylthio}acetamides, respectively. The structures of the compounds were elucidated on the basis of IR, MS, 1H-NMR, and 13C-NMR spectral data. The compounds containing 1,3,4-oxadiazole or 1,2,4-triazole heterocycle also were tested for their antimicrobial activity against bacteria, mold, and yeast.

  14. [Evaluation of the use of the CO2 laser in 134 patients with expansive processes in the central nervous system].

    Science.gov (United States)

    Lovrić, D; Negovetić, L; Lupret, V; Vidović, D; Gnjidić, Z

    1989-01-01

    The laser began to be used in neurosurgery towards the end of the 60s. The early experience of their clinical use did not promise much; but from the first half of the 70s with the improvement of the laser and the accumulation of laboratory and clinical experiences, the new technology began irrepressibly to spread throughout the world. Three lasers are in use today: CO2, ND.YAG and Argon laser. Each one of them, due to their different wave length and electromagnetic radiation, gave separate characteristics of employment, i.e., the interaction between the biologic tissues and the radiation is different. Depending upon the type of intraoperative needs we will choose one of the lasers. Presently the CO2-laser is the most used in neurosurgery due to its characteristics of low penetration into the tissue and the vaporization of the tissue which is exposed to the radiation. That is why such a laser (Sharplan 1060) has been acquired by our clinic. During one year we performed 134 operations due to expansive processes in the CNS with a partial or complete use of the laser during every phase of the operation. The accumulated experiences showed that the laser is a fairly useful new tool during the various surgical situations with a wide use of the everyday work of the neurosurgeon; with its implementation we have significantly improved the surgical technique in the tumors of the CNS, both in terms of radicality as well as in sparing the healthy tissue. We believe that the laser has an absolute indication in all the glioma tumors regardless of the localization, thereafter in all remaining tumors which are not extremely supplied by blood, while at the same time reducing the time needed for the surgical procedure. In time we spread the use of the laser on arteriovenous malformations as well, which, until now, has not been suggested in literature. Our results on 4 smaller superficial angiomas fully justified the use of a laser in such cases. But it also showed us that generally

  15. 137Cs and 134Cs activity in the North Pacific Ocean water from 1945 to 2020 by eddy-resolving ROMS

    Science.gov (United States)

    Tsubono, Takaki; Misumi, Kazuo; Tsumune, Daisuke; Aoyama, Michio; Hirose, Katsumi

    2017-04-01

    We conducted the simulation of 137Cs activity in the North Pacific Ocean (NPO) water from 1945 to 2020, before and after the Fukushima Dai-ichi Nuclear Power Plant (1F NPP) accident. Using the Regional Ocean Model System (ROMS) with high resolution (1/12°-1/4° in horizontal, 45 levels in vertical), of which domain was the NPO, we preliminarily estimated a factor multiplying the total 134Cs fluxes, which have been estimated for the atmospheric deposition and the direct discharge from the accident. The direct comparison of the observed and calculated 134Cs showed that the total 134Cs flux was 1.6 times greater than the previous estimates. We re-calculated the 134Cs activityies in the NPO water using the flux multiplied by 1.6 and confirmed the improvement of the simulation by the multiplied flux, which suggested that 134Cs and 137Cs inventories in the NPO increase by about 16PBq, respectively, due to the accident. For the hindcast and forecast of the 137Cs activityies in the NPO water, we calculated the 137Cs activityy in the NPO water from 1945 to 2020 by using the global fallout flux due to atmospheric nuclear weapons' tests and the Chernobyl accident and the estimated fluxes of the 1F NPP accident. For the calculation, five ensemble calculations of 137Cs activity were conducted by moving the start period of the input flux for one year. The 137Cs activity in the surface water showed that the plume due to the 1F NPP accident with relatively higher activity than 5 Bq m-3, which was lower than that in 1985, was transported to the western area of 135°W in 2015. The peak year of the 137Cs activity can be estimated from the hindcast and forecast. The 137Cs activity in the surface water north of 30°N shows that the 137Cs peak in 2011 occurs up to 180°, but the peak from 2012 to 2017 is distributed from near 180° to 90°W. The total inventory of 137Cs in the NPO increased up to 77 PBq in 2011 and gradually decreased to 61PBq in 2018 by transport outside of the domain

  16. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  17. Roles of Parathyroid Hormone (PTH) Receptor and Reactive Oxygen Species in Hyperlipidemia-Induced PTH(1-34) Resistance in Preosteoblasts.

    Science.gov (United States)

    Li, Xin; Garcia, Jamie; Lu, Jinxiu; Iriana, Sidney; Kalajzic, Ivo; Rowe, David; Demer, Linda; Tintut, Yin

    2013-01-01

    Bioactive lipids initiate inflammatory reactions leading to pathogenesis of atherosclerosis. Evidence shows that they also contribute to bone loss by inhibiting parathyroid hormone receptor (PTH1R) expression and differentiation of osteoblasts. We previously demonstrated that bone anabolic effects of PTH(1-34) are blunted in hyperlipidemic mice and that these PTH effects are restored by antioxidants. However, it is not clear which osteoblastic cell developmental stage is targeted by bioactive lipids. To investigate the effects of hyperlipidemia at the cellular level, hyperlipidemic Ldlr−/− mice were bred with Col3.6GFPtpz mice, in which preosteoblasts/osteoblasts carry a topaz fluorescent label, and with Col2.3GFPcyan mice, in which more mature osteoblasts/osteocytes carry a cyan fluorescent label. Histological analyses of trabecular bone surfaces in femoral as well as calvarial bones showed that intermittent PTH(1-34) increased fluorescence intensity in WT-Tpz mice, but not in Tpz-Ldlr−/− mice. In contrast, PTH(1-34) did not alter fluorescence intensity in femoral cortical envelopes of either WT-Cyan or Ldlr−/−-Cyan mice. To test the mechanism of PTH1R downregulation, preosteoblastic MC3T3-E1 cells were treated with bioactive lipids and the antioxidant Trolox. Results showed that inhibitory effects of PTH1R levels by bioactive lipids were rescued by pretreatment with Trolox. The inhibitory effects on expression of PTH1R as well as on PTH-induced osteoblastic genes were mimicked by xanthine/xanthine oxidase, a known generator of reactive oxygen species. These findings suggest an important role of preosteoblasts as the target development stage and downregulation of PTH receptor expression mediated by intracellular oxidant stress as a mechanism in hyperlipidemia-induced PTH resistance. PMID:24038594

  18. Microdosimetric analysis confirms similar biological effectiveness of external exposure to gamma-rays and internal exposure to 137Cs, 134Cs, and 131I.

    Directory of Open Access Journals (Sweden)

    Tatsuhiko Sato

    Full Text Available The risk of internal exposure to 137Cs, 134Cs, and 131I is of great public concern after the accident at the Fukushima-Daiichi nuclear power plant. The relative biological effectiveness (RBE, defined herein as effectiveness of internal exposure relative to the external exposure to γ-rays is occasionally believed to be much greater than unity due to insufficient discussions on the difference of their microdosimetric profiles. We therefore performed a Monte Carlo particle transport simulation in ideally aligned cell systems to calculate the probability densities of absorbed doses in subcellular and intranuclear scales for internal exposures to electrons emitted from 137Cs, 134Cs, and 131I, as well as the external exposure to 662 keV photons. The RBE due to the inhomogeneous radioactive isotope (RI distribution in subcellular structures and the high ionization density around the particle trajectories was then derived from the calculated microdosimetric probability density. The RBE for the bystander effect was also estimated from the probability density, considering its non-linear dose response. The RBE due to the high ionization density and that for the bystander effect were very close to 1, because the microdosimetric probability densities were nearly identical between the internal exposures and the external exposure from the 662 keV photons. On the other hand, the RBE due to the RI inhomogeneity largely depended on the intranuclear RI concentration and cell size, but their maximum possible RBE was only 1.04 even under conservative assumptions. Thus, it can be concluded from the microdosimetric viewpoint that the risk from internal exposures to 137Cs, 134Cs, and 131I should be nearly equivalent to that of external exposure to γ-rays at the same absorbed dose level, as suggested in the current recommendations of the International Commission on Radiological Protection.

  19. Direct observation of 134Cs and 137Cs in surface seawater in the western and central North Pacific after the Fukushima Dai-ichi nuclear power plant accident

    Directory of Open Access Journals (Sweden)

    H. Kaeriyama

    2013-06-01

    Full Text Available The horizontal distribution of radioactive cesium (Cs derived from the Fukushima Dai-ichi nuclear power plant (FNPP in the North Pacific is still unclear due to the limitation of direct measurement of the seawater in the open ocean. We present the result of direct observation of radioactive Cs in surface seawater collected from a broad area in the western and central North Pacific in July 2011, October 2011 and July 2012. We also conducted a simple particle tracking experiment to estimate the qualitative spatial distribution of radioactive Cs in the North Pacific. 134Cs was detected at 94 stations out of 123 stations, and 137Cs was detected at all stations. High 134Cs and 137Cs concentrations more than 10 m Bq kg−1 were observed in the area of the northern part of Kuroshio Extension at 144° E and 155° E in July 2011, in the area 147–175° E around 40° N in October 2011, and the northern part of Kuroshio Extension at 155° E and 175°30´ E in July 2012. Combining the result of direct observations and particle tracking experiment, the radioactive Cs derived from the FNPP had been dispersed eastward to the central North Pacific during 2011. It was considered from the horizontal distribution that radioactive Cs was dispersed not only eastward but also north- and southward in the central North Pacific. Pronounced dilution process of radioactive Cs from the FNPP during study period is suggested from temporal change in the activity ratio of 134Cs / 137Cs, which was decay-corrected on 6 April 2011, and relationships between radioactive Cs and temperature.

  20. Microdosimetric analysis confirms similar biological effectiveness of external exposure to gamma-rays and internal exposure to 137Cs, 134Cs, and 131I.

    Science.gov (United States)

    Sato, Tatsuhiko; Manabe, Kentaro; Hamada, Nobuyuki

    2014-01-01

    The risk of internal exposure to 137Cs, 134Cs, and 131I is of great public concern after the accident at the Fukushima-Daiichi nuclear power plant. The relative biological effectiveness (RBE, defined herein as effectiveness of internal exposure relative to the external exposure to γ-rays) is occasionally believed to be much greater than unity due to insufficient discussions on the difference of their microdosimetric profiles. We therefore performed a Monte Carlo particle transport simulation in ideally aligned cell systems to calculate the probability densities of absorbed doses in subcellular and intranuclear scales for internal exposures to electrons emitted from 137Cs, 134Cs, and 131I, as well as the external exposure to 662 keV photons. The RBE due to the inhomogeneous radioactive isotope (RI) distribution in subcellular structures and the high ionization density around the particle trajectories was then derived from the calculated microdosimetric probability density. The RBE for the bystander effect was also estimated from the probability density, considering its non-linear dose response. The RBE due to the high ionization density and that for the bystander effect were very close to 1, because the microdosimetric probability densities were nearly identical between the internal exposures and the external exposure from the 662 keV photons. On the other hand, the RBE due to the RI inhomogeneity largely depended on the intranuclear RI concentration and cell size, but their maximum possible RBE was only 1.04 even under conservative assumptions. Thus, it can be concluded from the microdosimetric viewpoint that the risk from internal exposures to 137Cs, 134Cs, and 131I should be nearly equivalent to that of external exposure to γ-rays at the same absorbed dose level, as suggested in the current recommendations of the International Commission on Radiological Protection.

  1. Highly Productive Synthesis, Characterization, and Fluorescence and Heavy Metal Ion Adsorption Properties of Poly(2,5-dimercapto-1,3,4-thiadiazole Nanosheets

    Directory of Open Access Journals (Sweden)

    Chao Li

    2017-12-01

    Full Text Available Poly(2,5-dimercapto-1,3,4-thiadiazole (PBT nanosheets were synthesized by chemical oxidative synthesis under mild conditions. The media, oxidant species, monomer concentrations, oxidant/monomer molar ratio, and temperature were optimized to achieve higher yields and better performance. The molecular structure, morphology, and properties of the nanosheets were analyzed by Fourier transform infrared (FT-IR, ultraviolet-visible (UV-Vis, and fluorescence spectroscopies, wide-angle X-ray diffraction (WAXD, matrix-assisted laser desorption/ionization/time-of-flight (MALDI-TOF mass spectrometry, X-ray photoelectron spectroscopy (XPS, scanning electronic microscopy (SEM, transmission electron microscopy (TEM, and simultaneous thermogravimetry and differential scanning calorimetry (TG-DSC. It was found that the polymerization of 2,5-dimercapto-1,3,4-thiadiazole occurs via dehydrogenation coupling between two mercapto groups to form the –S–S– bond. PBTs show the highest polymerization yield of up to 98.47% and form uniform nanosheets with a thickness of 89~367 nm. poly(2,5-dimercapto-1,3,4-thiadiazole polymers (PBTs exhibit good chemical resistance, high thermostability, interesting blue-light emitting fluorescence, and wonderful heavy metal ion adsorption properties. Particularly, the PBT nanosheets having a unique synergic combination of three kinds of active –S–, –SH, and =N– groups with a moderate specific area of 15.85 m2 g−1 exhibit an ultra-rapid initial adsorption rate of 10,653 mg g−1 h−1 and an ultrahigh adsorption capacity of up to 680.01 mg g−1 for mercury ion, becoming ultrafast chelate nanosorbents with a high adsorption capacity. With these impressive properties, PBT nanosheets are very promising materials in the fields of water treatment, sensors, and electrodes.

  2. Impact of alkali cations on properties of metakaolin and metakaolin/slag geopolymers: Microstructures in relation to sorption of 134Cs radionuclide.

    Science.gov (United States)

    El-Naggar, M R; Amin, M

    2018-02-15

    Radio-cesium constitutes major environmental threats. Sorption of hazardous species onto geopolymeric sorbents is relatively recent and may give information about the retention mechanisms when geopolymers are applied to immobilize radwastes. Here, Na-MK, K-MK, Na-MKBFS, and K-MKBFS geopolymeric sorbents were synthesized from metakaolin (MK) and blast furnace slag (BFS) and were characterized using XRD, XRF, FT-IR, DTA/TGA and SEM. FT-IR/XRF results clarified the impact of mono-valent alkali cation (M+) in dividing the sorbents into Al-rich (sodium-based) and Si-rich (potassium-based). All sorbents were amorphous to semi-crystalline containing mica-phyllosilicates (greater in Si-rich), tobermorites (greater in MKBFS-based), gehlenite, calcite, quartz, hematite and hydrotalcite. Isotherms of 134Cs radionuclide sorption were constructed, being regular with a positive temperature effect. Al-rich sorbents gave higher sorption capacities than Si-rich ones. Na-MK sorbent recorded the more distinctive sorption capacity (74.95mg/g; at 333K). Langmuir, Freundlich and D-R models were used to disclose the capacities and mechanisms governing the sorption processes. Sorption of Cs+ onto the examined sorbents was favorable. All systems were controlled by ion exchange mechanism, except 134Cs/K-MK system which was controlled by physi- sorption mechanism. 134Cs/Na-MK GP system was the only spontaneous among all. The endothermic natures were the common denominator between the tested systems. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Increase of the uterus-relaxant effect of nifedipine by the Abcg2 efflux protein inhibitor KO134 in the rat in vivo.

    Science.gov (United States)

    Lovasz, Norbert; Ducza, Eszter; Zupko, Istvan; Falkay, George

    2013-01-01

    High Abcg2 (ATP-Binding Cassette Transporter Subfamily G, Member-2) levels have been found in reproductive tissues, such as the placenta and uterus. The substrate specificity of Abcg2 is very wide, including uterus-relaxant agents (e.g. nifedipine and prazosine). Through the use of a potent inhibitor (KO134), intracellular accumulation of the substrate can be increased. Nifedipine, commonly used in acute tocolytic therapy, exerts a greater tocolytic effect and has fewer side-effects than β2-adrenergic receptor agonists. The aims of the present study were to investigate the expression of Abcg2 in the rat uterus during gestation and the uterus-relaxant effect of nifedipine in the presence of the Abcg2 inhibitor KO134. Real-time Polymerase Chain Reaction (PCR) and western blot analyses were performed to detect the levels of Abcg2 during gestation in the rat. The uterus-relaxant effect of nifedipine in vivo was investigated by the intra-uterine pressure measuring method, described by Csapo. Low levels of Abcg2 were found in non-pregnant animals and early-pregnancy (days 6, 8 and 10), but on day 15 of gestation, a sharp increase in Abcg2 levels was observed, which reached its maximum on day 18 and later decreased until the end of gestation. The post-partum levels were similar to those in non-pregnant rats. The in vivo contractility studies revealed that nifedipine had a strong uterus-relaxant effect on spontaneous contractions, and that this effect was significantly and dose-dependently increased by the Abcg2 blocker KO134. The administration of efflux pump inhibitors in combination with tocolytic agents may be of novel therapeutic relevance in the management of pre-term labour.

  4. {sup 134}Cs uptake by four plant species and Cs-K relations in the soil-plant system as affected by Ca(OH){sub 2} application to an acid soil

    Energy Technology Data Exchange (ETDEWEB)

    Massas, I., E-mail: massas@aua.g [Soil Science Laboratory, Department of Natural Resources Management and Agricultural Engineering, Agricultural University of Athens, Iera Odos 75, 11855 Athens (Greece); Skarlou, V.; Haidouti, C.; Giannakopoulou, F. [Soil Science Laboratory, Department of Natural Resources Management and Agricultural Engineering, Agricultural University of Athens, Iera Odos 75, 11855 Athens (Greece)

    2010-03-15

    Three rates of Ca(OH){sub 2} were applied to an acid soil and the {sup 134}Cs uptake by radish, cucumber, soybean and sunflower plants was studied. The {sup 134}Cs concentration in all plant species was reduced from 1.6-fold in the sunflower seeds to 6-fold in the soybean vegetative parts at the higher Ca(OH){sub 2} rate. Potassium (K) concentration in plants was also reduced, but less effectively. The significantly decreased {sup 134}Cs-K soil to plant distribution factors (D.F.) clearly suggest a stronger effect of soil liming on {sup 134}Cs than on K plant uptake. This observation was discussed in terms of ionic interactions in the soil matrix and within the plants. The results also indicated that the increased Ca{sup 2+} concentration in the exchange phase and in the soil solution along with the improved root activity, due to the soil liming, enhanced the immobilization of {sup 134}Cs in the soil matrix and consequently lowered the {sup 134}Cs availability for plant uptake.

  5. Metal Complexes of 1,3,4-Thiadiazole-2,5-Disulfonamide are Strong Dual Carbonic Anhydrase Inhibitors, although the Ligand Possesses very Weak such Properties.

    Science.gov (United States)

    Supuran, C T

    1995-01-01

    Coordination compounds of Co(II), Ni(II), Cu(II), Zn(II), and Cd(II) with 1,3,4-thiadiazole-2,5-disulfonamide as ligand were synthesized and characterized by IR and UV spectroscopy, conductimetry and thermogravimetry. The parent ligand is a very weak carbonic anhydrase (CA) inhibitor, although it constituted the lead for developing important classes of diuretics. The complex derivatives behave as much stronger CA inhibitors, with IC(50) values around 10(-8)M against isozyme CA II, and 10(-7) M against isozyme CAI.

  6. Metal Complexes of 1,3,4-Thiadiazole-2,5-Disulfonamide are Strong Dual Carbonic Anhydrase Inhibitors, although the Ligand Possesses very Weak such Properties

    OpenAIRE

    Claudiu T. Supuran

    1995-01-01

    Coordination compounds of Co(II), Ni(II), Cu(II), Zn(II), and Cd(II) with 1,3,4-thiadiazole-2,5-disulfonamide as ligand were synthesized and characterized by IR and UV spectroscopy, conductimetry and thermogravimetry. The parent ligand is a very weak carbonic anhydrase (CA) inhibitor, although it constituted the lead for developing important classes of diuretics. The complex derivatives behave as much stronger CA inhibitors, with IC50 values around 10−8M against isozyme CA II, and 10−7 M agai...

  7. Aging Periosteal Progenitor Cells have Reduced Regenerative Responsiveness to Bone Injury and to the Anabolic Actions of PTH 1-34 Treatment

    Science.gov (United States)

    Yukata, Kiminori; Xie, Chao; Li, Tian-Fang; Takahata, Masahiko; Hoak, Donna; Kondabolu, Sirish; Zhang, Xinping; Awad, Hani A.; Schwarz, Edward M.; Beck, Christopher A.; Jonason, Jennifer H.; O’Keefe, Regis J.

    2014-01-01

    A stabilized tibia fracture model was used in young (8-week old) and aged (1-year old) mice to define the relative bone regenerative potential and the relative responsiveness of the periosteal progenitor population with aging and PTH 1-34 (PTH) systemic therapy. Bone regeneration was assessed through gene expressions, radiographic imaging, histology/histomorphometry, and biomechanical testing. Radiographs and microCT showed increased calcified callus tissue and enhanced bone healing in young compared to aged mice. A key mechanism involved reduced proliferation, expansion, and differentiation of periosteal progenitor cell populations in aged mice. The experiments showed that PTH increased calcified callus tissue and torsional strength with a greater response in young mice. Histology and quantitative histomorphometry confirmed that PTH increased callus tissue area due primarily to an increase in bone formation, since minimal changes in cartilage and mesenchyme tissue area occurred. Periosteum examined at 3, 5, and 7 days showed that PTH increased cyclin D1 expression, the total number of cells in the periosteum, and width of the periosteal regenerative tissue. Gene expression showed that aging delayed differentiation of both bone and cartilage tissues during fracture healing. PTH resulted in sustained Col10a1 expression consistent with delayed chondrocyte maturation, but otherwise minimally altered cartilage gene expression. In contrast, PTH 1-34 stimulated expression of Runx2 and Osterix, but resulted in reduced Osteocalcin. β-catenin staining was present in mesenchymal chondroprogenitors and chondrocytes in early fracture healing, but was most intense in osteoblastic cells at later times. PTH increased active β-catenin staining in the osteoblast populations of both young and aged mice, but had a lesser effect in cartilage. Altogether the findings show that reduced fracture healing in aging involves decreased proliferation and differentiation of stem cells lining

  8. Characterization of a Second tfd Gene Cluster for Chlorophenol and Chlorocatechol Metabolism on Plasmid pJP4 in Ralstonia eutropha JMP134(pJP4)

    OpenAIRE

    Laemmli, Caroline M.; Leveau, Johan H. J.; Zehnder, Alexander J. B.; van der Meer, Jan Roelof

    2000-01-01

    Within the 5.9-kb DNA region between the tfdR and tfdK genes on the 2,4-dichlorophenoxyacetic acid (2,4-D) catabolic plasmid pJP4 from Ralstonia eutropha JMP134, we identified five open reading frames (ORFs) with significant homology to the genes for chlorocatechol and chlorophenol metabolism (tfdCDEF and tfdB) already present elsewhere on pJP4. The five ORFs were organized and assigned as follows: tfdDIICIIEIIFII and tfdBII (in short, the tfdII cluster), by analogy to tfdCDEF and tfdB (the t...

  9. High-pressure viscosity behavior of x 1,1,1,2-tetrafluoroethane (HFC-134a)+(1-x) triethylene glycol dimethylether (TriEGDME) mixtures: Measurements and modeling

    DEFF Research Database (Denmark)

    Monsalvo, Matias Alfonso; Baylaucq, A.; Cisneros, Sergio

    2006-01-01

    In this work new dynamic viscosity measurements for binary mixtures containing a refrigerant (HFC-134a, CF3CH2F) and a lubricant (TriEGDME, CH3O(CH2OCH2)(3)CH3) are reported. The measurements were carried out at temperatures between 293.15 and 373.15 K and pressures from 10 to 100 MPa, for two mole...... for this binary system have been used to test the ability of several viscosity models having different origins and theoretical backgrounds. The considered models range from simple mixing rules, through empirical correlations, such as the self-referencing model and the LBC model, to recent approaches...

  10. An extensive spectroscopic time-series of three Wolf-Rayet stars. I. The lifetime of large-scale structures in the wind of WR 134

    OpenAIRE

    Aldoretta, E. J.; St-Louis, N.; Richardson, N. D.; Moffat, A.F.J.; Eversberg, T.; Hill, G.M.; Shenar, T.; Artigau, É.; Gauza, B.; Knapen, J. H.; KubÁt, J.; Kubátová, B.; Maltais-Tariant, R.; Muñoz, M.; Pablo, H.

    2016-01-01

    During the summer of 2013, a 4-month spectroscopic campaign took place to observe the variabilities in three Wolf-Rayet stars. The spectroscopic data have been analyzed for WR 134 (WN6b), to better understand its behaviour and long-term periodicity, which we interpret as arising from corotating interaction regions (CIRs) in the wind. By analyzing the variability of the He II $\\lambda$5411 emission line, the previously identified period was refined to P = 2.255 $\\pm$ 0.008 (s.d.) days. The coh...

  11. Cloning and characterization of an endo-b-1,3(4) glucanase and an aspartic protease from Phaffia rhodozyma CBS 6938

    DEFF Research Database (Denmark)

    Villadsen, Ingrid; Bang, M_L; Sandal, T.

    1999-01-01

    We describe the identification and expression cloning of two novel enzymes, a P-glucanase and an aspartic protease, secreted from the basidiomycetous yeast Phaffia rhodozyma. A cDNA library from P. rhodozyma CBS 6938 was constructed, and full-length cDNA encoding an endo-1,3(4)-beta-glucanase (bg1......) and an aspartic protease (pr1) were cloned by expression cloning in Saccharomyces cerevisiae W3124. The bgl cDNA encodes a 424-residue precursor protein with a putative signal peptide. The prl cDNA encodes a 405-residue prepropolypeptide with an 81-residue leader peptide. The aspartic protease was purified...

  12. Bis{N-[5-(4-methoxy?phen?yl)-1,3,4-oxa?diazol-2-yl]ethanimidamidato}copper(II)

    OpenAIRE

    Yacine Djebli; Salima Mosbah; Sihem Boufas; Leila Bencharif; Thierry Roisnel

    2010-01-01

    The title compound, [Cu(C11H11N4O2)2], was prepared by solvothermal synthesis using 2-amino-5-(4-methoxyphenyl)-1,3,4-oxadiazole and copper sulfate pentahydrate in an acetonitrile solution. The CuII atom lies on an inversion center and is four-coordinated in a slightly distorted square-planar geometry by four N atoms of the ligands obtained from the formation of a bond between the amine N atom of the oxadiazole molecule and the nitrile C atom of the solvent. In the crystal structure an interm...

  13. One Pot Single Step Synthesis and Biological Evaluation of Some Novel Bis(1,3,4-thiadiazole Derivatives as Potential Cytotoxic Agents

    Directory of Open Access Journals (Sweden)

    Sobhi M. Gomha

    2016-11-01

    Full Text Available A novel series of bis(1,3,4-thiadiazole derivatives were synthesized in one step methodology with good yields by condensation reaction between bis-hydrazonoyl chloride 1 and various reagents. The structures of the prepared compounds were confirmed by spectral data (IR, NMR, and MS, and elemental analysis. The anticancer activity against human breast carcinoma (MCF-7 cancer cell lines was evaluated in MTT assay. The results revealed that the bis-thiadiazole derivatives 5c,d, 7b,c and 9c had higher antitumor activity than the standard drug Imatinib.

  14. 1-(1H-Benzimidazol-2-yl-3-[5-(trichloromethyl-1,3,4-oxadiazol-2-yl]propan-1-one

    Directory of Open Access Journals (Sweden)

    Nadeem Ahmed Siddique

    2012-07-01

    Full Text Available The title compound, 1-(1H-benzimidazol-2-yl-3-[5-(trichloromethyl-1,3,4-oxadiazol-2-yl]propan-1-one (2 was synthesized successfully from 4-(1H-benzimidazol-2-yl-4-oxobutanehydrazide (1 under microwave irradiation in good yield by reacting with trichloroacetic acid, and the structure of title compound was confirmed on the basis of IR, 1H-NMR, 13C-NMR, MS and CHN analyses results.

  15. Synthesis and Antimicrobial and Antioxidant Activities of Some New 5-(2-Methyl-1H-indol-3-yl-1,3,4-oxadiazol-2-amine Derivatives

    Directory of Open Access Journals (Sweden)

    Anand R. Saundane

    2013-01-01

    Full Text Available A series of 5-(2-methyl-1H-indol-3-yl-1,3,4-oxadiazol-2-amine derivatives (3–5 were synthesized. These previously unknown compounds were characterized by spectral studies and elemental analysis. These compounds were evaluated for their antimicrobial and antioxidant activities. Among all the compounds tested 5d exhibited promising antibacterial, antifungal, radical scavenging, and ferric ions (Fe3+ reducing antioxidant power (FRAP activities, whereas the compounds 3b, 4c, and 5e exhibited good FRAP and metal chelating activities. In general compounds containing chloro and methyl substituent exhibited better antimicrobial and antioxidant activities.

  16. The potentiometric and spectrophotometric determination of dissociation constants for same 2-mercapto-5-R-amino-1,3,4-thiadiazole derivatives.

    Science.gov (United States)

    Roman, L; Mirel, S; Florean, E; Oprean, R

    1998-10-01

    In order to establish the dissociation constants of organic compounds, the spectrophotometric and potentiometric methods are the most precise and useful ones. Comparing the results, we used both methods for three derivatives of 2-mercapto-5-R-amino-1,3,4-thiadiazole. For the pKa determination by the spectrophotometric method we measured the ratio between the concentration of dissociated and undissociated forms. The ratio was calculated from spectral data. The potentiometric method for pKa consists of measuring the pH values within a potentiometric titration with 0.1 M NaOH. The results proved a very low acid character of the derivatives. The pKa values were influenced by the properties of the amino group substituents, and the results confirm the theoretical considerations. The study confirms the thion-thiolic tautometry of the 2-mercapto-5-R-amino-1,3,4-thiadiazole derivates and their property of being ligands for the coordination of the cations of some representative and transitional metals, with application in the preconcentration, in the detection and the quantitative determination of polluting and toxic cations in environmental analysis.

  17. Synthesis and Characterization of Mono- and Bicycle Heterocyclic Derivatives Containing 1, 2,4-Triazole, 1,3,4-Thiadiazine and 1,3-Thiazole Rings

    Directory of Open Access Journals (Sweden)

    Navabeh Nami

    2012-01-01

    Full Text Available Reaction of tartaric acid with thiocarbohydrazide (2 and thiosemicarbazide (6 afforded 1,2-bis(4-amino-5-mercapto-4H-1,2,4-triazol-3-yl-ethane-1,2-diol (3 and 1,2-bis(5-mercapto-4H-1,2,4-triazol-3-yl-ethane-1,2-diol (7. Reaction of compounds 3 and 7 with DMAD (dimethylacety lendi carboxylate and DEAD (diethylacetylendicarboxylate gave 1,2-bis(7-[(z-methoxycarbonylmethylen]-5,6-dihydro-5H-6-one-[1,2,4] riazolo[3,4-b] [1,3,4] thiadiazin-3-yl-ethan-1,2-diol (4, 1,2-bis(7-[(z-ethoxycarbonylmethylen] -5,6-dihydro -5H-6-one-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazin-3-yl-ethan-1,2- diol (5 and 1,2-bis(6-[(z-methoxycarbonylmethylen]-5-oxo-[1,3]thiazolo[2,3-c] [1,2,4]triazol-3-yl-ethan-1,2-diol (8 in good yields.

  18. Electroanalytical and naked eye determination of Cu(2+) ion in various environmental samples using 5-amino-1,3,4-thiadiazole-2-thiol based Schiff bases.

    Science.gov (United States)

    Bandi, Koteswara Rao; Singh, Ashok Kumar; Upadhyay, Anjali

    2014-01-01

    Novel polydentate Schiff bases 4-(5-mercapto-1,3,4-thiadiazol-2-ylimino)pentan-2-one (S1) and (2-(indol-3-yl)vinyl)-1,3,4-thiadiazole-2-thiol (S2) were synthesized and explored as Cu(2+) selective polymeric membrane electrodes (PME) using different plasticizers and anionic excluders. The potentiometric data revealed that the PME having the membrane composition (S2: NaTPB: TBP: PVC as 4: 2: 58: 36 (w/w; mg)) is shown to have good results. Thus the coated graphite electrode (CGE) with the same composition as the best PME was also fabricated and investigated as Cu(2+) selective electrode. It was found that CGE showed better response characteristics than PME with respect to low detection limit (1.2×10(-8)molL(-1)), near Nernstian slope (29.8±0.4mV decade(-1) of activity), wide working concentration range (6.4×10(-8)-1.0×10(-1)molL(-1)), long shelf life (90days) and fast response time (9s). The CGE was used successfully as an indicator electrode for the potentiometric determination of Cu(2+) ion against EDTA and also used to quantify Cu(2+) ion in soil, water, medicinal plants, vegetables and edible oil samples. The Schiff base S2 is used as chemosensor for the selective determination of Cu(2+) ion. © 2013.

  19. Novel t(5;11)(q32;q13.4) with NUMA1-PDGFRB fusion in a myeloid neoplasm with eosinophilia with response to imatinib mesylate.

    Science.gov (United States)

    Zou, Ying S; Hoppman, Nicole L; Singh, Zeba N; Sawhney, Sameer; Kotiah, Sandy D; Baer, Maria R

    2017-04-01

    We report a NUMA1-PDGFRB fusion in a myeloproliferative neoplasm with eosinophilia in a 61-year old man, with response to imatinib mesylate therapy. A t(5;11) chromosome translocation involving bands 5q32 and 11q13.4 was identified by metaphase chromosome analysis, and rearrangement of the platelet-derived growth factor receptor beta (PDGFRB) gene on 5q32 was demonstrated by FISH using a PDGFRB break-apart probe set. Bacterial artificial chromosome (BAC) FISH mapping of the PDGFRB fusion partner gene narrowed the breakpoint at 11q13.4 to a 150 kb genomic region containing three genes, including NUMA1. Mate pair sequencing analysis demonstrated NUMA1-PDGFRB fusion. The fusion protein includes coiled-coil domains of nuclear mitotic apparatus protein 1 (NuMA1, involved in protein homodimerization and heteroassociation) and tyrosine kinase domains of PDGFRB. Diverse rearrangements involving the PDGFRB gene have been identified in myeloid and lymphoid neoplasms with eosinophilia, but rearrangement of the nuclear mitotic apparatus protein 1 (NUMA1) gene has previously been reported in a human malignancy in only one instance, a NUMA1-RARA fusion caused by a t(11;17) translocation in a patient with acute promyelocytic leukemia. The NUMA1-PDGFRB fusion is the second instance of rearrangement of NUMA1, encoding an element of the mitotic apparatus, in human cancer. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Synthesis and antimicrobial activity of some novel fused heterocyclic 1,2,4-triazolo [3,4-b][1,3,4] thiadiazine derivatives

    Directory of Open Access Journals (Sweden)

    Jagdish K. Sahu

    2014-01-01

    Full Text Available In the present investigation, the synthesis and antimicrobial evaluation of 1,2,4-triazolo [3,4-b][1,3,4] thiadiazine including different pharmacophores are aimed at. In this study, a series of 6-aryl-3- (3,4 -dialkoxyphenyl-7H -[1,2,4]triazolo [3,4-b][1,3,4] thiadiazine (7a-7k was synthesized by condensing 4-amino-5-(3,4-dialkoxyphenyl-4H-[1,2,4]- triazole-3-thiol (6 with various aromatic carboxylic acids in the presence of phenacyl bromides through one-pot reaction. Eleven fused heterocyclic derivatives were successfully synthesized. The structures of these newly synthesized compounds were characterized by IR, 1 H NMR and mass spectroscopic studies. All the synthesized compounds were screened for their antimicrobial evaluation. Some of the compounds exhibited promising antimicrobial activity. From the present study it may be concluded that synthesized compounds are fruitful in terms of their structural novelty and marked biological activities. These compounds could be further modified to develop potential and safer antifungal agents.

  1. Involvement of CD252 (CD134L) and IL-2 in the expression of cytotoxic proteins in bacterial- or viral-activated human T cells.

    Science.gov (United States)

    Walch, Michael; Rampini, Silvana K; Stoeckli, Isabelle; Latinovic-Golic, Sonja; Dumrese, Claudia; Sundstrom, Hanna; Vogetseder, Alexander; Marino, Joseph; Glauser, Daniel L; van den Broek, Maries; Sander, Peter; Groscurth, Peter; Ziegler, Urs

    2009-06-15

    Regulation of cytotoxic effector molecule expression in human CTLs after viral or bacterial activation is poorly understood. By using human autologous dendritic cells (DCs) to prime T lymphocytes, we found perforin only highly up-regulated in virus- (HSV-1, vaccinia virus) but not in intracellular bacteria- (Listeria innocua, Listeria monocytogenes, Mycobacterium tuberculosis, Chlamydophila pneumoniae) activated CTLs. In contrast, larger quantities of IFN-gamma and TNF-alpha were produced in Listeria-stimulated cultures. Granzyme B and granulysin were similarly up-regulated by all tested viruses and intracellular bacteria. DCs infected with HSV-1 showed enhanced surface expression of the costimulatory molecule CD252 (CD134L) compared with Listeria-infected DC and induced enhanced secretion of IL-2. Adding blocking CD134 or neutralizing IL-2 Abs during T cell activation reduced the HSV-dependent up-regulation of perforin. These data indicate a distinct CTL effector function in response to intracellular pathogens triggered via differing endogenous IL-2 production upon costimulation through CD252.

  2. Adaptive neuro-fuzzy inference system model for adsorption of 1,3,4-thiadiazole-2,5-dithiol onto gold nanoparticales-activated carbon.

    Science.gov (United States)

    Ghaedi, M; Hosaininia, R; Ghaedi, A M; Vafaei, A; Taghizadeh, F

    2014-10-15

    In this research, a novel adsorbent gold nanoparticle loaded on activated carbon (Au-NP-AC) was synthesized by ultrasound energy as a low cost routing protocol. Subsequently, this novel material characterization and identification followed by different techniques such as scanning electron microscope(SEM), Brunauer-Emmett-Teller(BET) and transmission electron microscopy (TEM) analysis. Unique properties such as high BET surface area (>1229.55m(2)/g) and low pore size (neuro-fuzzy inference system (ANFIS), and multiple linear regression (MLR) models, have been applied for prediction of removal of 1,3,4-thiadiazole-2,5-dithiol using gold nanoparticales-activated carbon (Au-NP-AC) in a batch study. The input data are included adsorbent dosage (g), contact time (min) and pollutant concentration (mg/l). The coefficient of determination (R(2)) and mean squared error (MSE) for the training data set of optimal ANFIS model were achieved to be 0.9951 and 0.00017, respectively. These results show that ANFIS model is capable of predicting adsorption of 1,3,4-thiadiazole-2,5-dithiol using Au-NP-AC with high accuracy in an easy, rapid and cost effective way. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Corrosion inhibition performance of 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole for carbon steel in HCl solution: Gravimetric, electrochemical and XPS studies

    Science.gov (United States)

    Bouanis, M.; Tourabi, M.; Nyassi, A.; Zarrouk, A.; Jama, C.; Bentiss, F.

    2016-12-01

    Corrosion inhibition of carbon steel in normal hydrochloric acid solution at 30 °C by 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole (DAPO) has been studied by weight loss measurements and electrochemical techniques (polarization and AC impedance). The experimental results showed that DAPO acted as an efficient inhibitor against the carbon steel corrosion in 1 M HCl, and its inhibition efficiency increased with the inhibitor concentration reaching a value up to 93% at 1 mM. Polarization studies showed that the DAPO was a mixed-type inhibitor. The adsorption of this 1,3,4-oxadiazole derivative on the carbon steel surface in 1 M HCl solution followed the Langmuir adsorption isotherm and the corresponding value of the standard Gibbs free energy of adsorption (ΔG°ads) is associated to a chemisorption mechanism. Scanning Electron Microscopy (SEM) and X-Ray Photoelectron Spectroscopy (XPS) analyses were carried out to characterize the chemical composition of the inhibitive film formed on the steel surface. The surfaces studies showed that the inhibitive layer is composed of an iron oxide/hydroxide mixture where DAPO molecules are incorporated. The cytotoxicity of DAPO was also determined using cell culture system.

  4. {sup 57}Co, {sup 85}Sr and {sup 134}Cs levels in mature Chinese cabbage related to time of foliar application

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Y.H.; Lim, K.M.; Park, H.G.; Park, D.W.; Lee, W.Y. [Korea Atomic Energy Research Institute, Yusong, Taejon (Korea)

    2000-05-01

    For analyzing the direct contamination pathway of radionuclides in Chinese cabbage, a solution containing {sup 57}Co, {sup 85}Sr and {sup 134}Cs was applied to Chinese cabbage in a greenhouse via foliar spraying at 5 different times during plant growth. Interception of the applied activity by the plant showed no difference among radionuclides and increased with decreasing time intervals between RI application and harvest. The highest observed interception factor was 0.87. The fractions of the initial plant deposition that remained in the mature plant varied 10-61% for {sup 57}Co, 16-58% for {sup 85}Sr and 33-64% for {sup 134}Cs but these values decreased to 3-37%, 2-35% and 14-40%, respectively, when the 6 outmost leaves were removed. It was indicated that rain plays an important role in the weathering loss of the activity from plant. Tying the upper end of the plant just before the last application markedly reduced the radionuclide concentrations in the edible portion of mature Chinese cabbage. The present results can be referred to in predicting the radionuclide concentrations in Chinese cabbage and deciding counter-measures when an accidental release occurs during the growing season of Chinese cabbage. (author)

  5. Synthesis, characterization and anti cancer activity of some fluorinated 3,6-diaryl-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazoles

    Directory of Open Access Journals (Sweden)

    Deepak Chowrasia

    2017-05-01

    Full Text Available A series of fluorinated 3,6-diaryl-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazoles (2a–2i was synthesized by condensation of various substituted 4-amino-5-phenyl-4H-1,2,4-triazole-3-thiols (1a–1i with penta fluoro benzoic acid in good yields (60–80%. The synthesized compounds were screened for anticancer activity against three cancerous cell lines MCF7 (human breast cancer, SaOS-2 (human osteosarcoma and K562 (human myeloid leukemia. The compounds showed moderate to good antiproliferative potency against the studied cell lines. Among these, compound 2b showed higher antiproliferative activity (IC50 22.1, 19 and 15 μM against MCF7, SaOS-2 and K562, respectively while 2a exhibited least antiproliferative activity (IC50 30.2, 39 and 29.4 μM against MCF7, SaOS-2 and K562 cells, respectively. Therefore, the present study demonstrates that fluorine substituted 3,6-diaryl-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazoles would be a better prospective in the development of anticancer drugs.

  6. Synthesis and Antiviral Activity of Novel 1,4-Pentadien-3-one Derivatives Containing a 1,3,4-Thiadiazole Moiety

    Directory of Open Access Journals (Sweden)

    Lu Yu

    2017-04-01

    Full Text Available 1,4-Pentadien-3-one derivatives derived from curcumin possess excellent inhibitory activity against plant viruses. On the basis of this finding, a series of novel 1,4-pentadien-3-one derivatives containing a 1,3,4-thiadiazole moiety were designed and synthesized, and their structures confirmed by IR, 1H-NMR, and 13C-NMR spectroscopy and elemental analysis. The antiviral activities of the title compounds were evaluated against tobacco mosaic virus (TMV and cucumber mosaic virus (CMV in vivo. The assay results showed that most of compounds had remarkable antiviral activities against TMV and CMV, among which compounds 4b, 4h, 4i, 4k, 4o, and 4q exhibited good curative, protection, and inactivation activity against TMV. Compounds 4h, 4i, 4k, 4l, 4o, and 4q exhibited excellent protection activity against TMV, with EC50 values of 105.01, 254.77, 135.38, 297.40, 248.18, and 129.87 μg/mL, respectively, which were superior to that of ribavirin (457.25 µg/mL. In addition, preliminary SARs indicated that small electron-withdrawing groups on the aromatic ring were favorable for anti-TMV activity. This finding suggests that 1,4-pentadien-3-one derivatives containing a 1,3,4-thiadiazole moiety may be considered as potential lead structures for discovering new antiviral agents.

  7. Synthesis of formazans from Mannich base of 5-(4-chlorophenyl amino-2-mercapto-1,3,4-thiadiazole as antimicrobial agents

    Directory of Open Access Journals (Sweden)

    Pramilla Sah

    2014-04-01

    Full Text Available 5-(4-Chlorophenyl amino-2-mercapto-1,3,4-thiadiazole (I was refluxed with formaldehyde and ammonium chloride in ethanol yielding the Mannich base 5-(4-chloro phenyl amino-3-aminomethyl-2-mercapto-1,3,4-thiadiazole (II. Esterification with 4-chloro-(2,6-dinitro phenoxy-ethyl acetate (III under anhydrous conditions gave the intermediate (IV. Subsequent hydrazinolysis with hydrazine hydrate gave the corresponding hydrazide 3-amino methyl-5-(4-chloro phenyl amino-2-mercapto-4′-(2′,6′-dinitro phenoxy-acetyl hydrazide (V. The hydrazide was converted into the Schiff bases (VIa–b by reacting with 2-chlorobenzaldehyde and 3-methoxy-4-hydroxy benzaldehyde in presence of methanol containing 2–3 drops of acetic acid. Diazotisation with aromatic amines, sulphanilic acid and sulphur drugs gave the formazans (VIIa–g respectively. Chemical structures have been established by elemental analysis and the spectral techniques of FTIR, 1H NMR and mass. Antimicrobial activity (in vitro was evaluated against the two pathogenic bacterial strains. Escherichia coli and Salmonella typhi, three fungal strains Aspergillus niger, Penicillium species and Candida albicans. The compounds have shown moderate activity.

  8. One-pot synthesis of new triazole--Imidazo[2,1-b][1,3,4]thiadiazole hybrids via click chemistry and evaluation of their antitubercular activity.

    Science.gov (United States)

    Ramprasad, Jurupula; Nayak, Nagabhushana; Dalimba, Udayakumar; Yogeeswari, Perumal; Sriram, Dharmarajan

    2015-10-01

    A new series of triazole-imidazo[2,1-b][1,3,4]thiadiazole hybrids (6a-s, 7a) were designed by a molecular hybridisation approach and the target molecules were synthesized via one pot click chemistry protocol. All the intermediates and final molecules were characterised using spectral methods and one of the target compounds (6c) was analysed by the single crystal XRD study. The derivatives were screened for their antimycobacterial activity against Mycobacterium tuberculosis H37Rv strain. Two compounds, 6f and 6n, demonstrated significant growth inhibitory activity against the bacterial strain with a MIC of 3.125 μg/mL. The presence of chloro substituent on the imidazo[2,1-b][1,3,4]thiadiazole ring and ethyl, benzyl or cyanomethylene groups on the 1,2,3-triazole ring enhance the inhibition activity of the molecules. The active compounds are not toxic to a normal cell line which signifies the lack of general cellular toxicity of these compounds. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Crystal structure of 3-{[4-(2-methoxyphenylpiperazin-1-yl]methyl}-5-(thiophen-2-yl-1,3,4-oxadiazole-2(3H-thione

    Directory of Open Access Journals (Sweden)

    Monirah A. Al-Alshaikh

    2016-02-01

    Full Text Available The title compound, C18H20N4O2S2, is a new 1,3,4-oxadiazole and a key pharmacophore of several biologically active agents. It is composed of a methyl(thiophen-2-yl-1,3,4-oxadiazole-2(3H-thione moiety linked to a 2-methoxyphenyl unit via a piperazine ring that has a chair conformation. The thiophene ring mean plane lies almost in the plane of the oxadiazole ring, with a dihedral angle of 4.35 (9°. The 2-methoxyphenyl ring is almost normal to the oxadiazole ring, with a dihedral angle of 84.17 (10°. In the crystal, molecules are linked by weak C—H...S hydrogen bonds and C—H...π interactions, forming layers parallel to the bc plane. The layers are linked via weak C—H...O hydrogen bonds and slipped parallel π–π interactions [intercentroid distance = 3.6729 (10 Å], forming a three-dimensional structure. The thiophene ring has an approximate 180° rotational disorder about the bridging C—C bond.

  10. Synthesis, Molecular Properties Prediction, and Anti-staphylococcal Activity of N-Acylhydrazones and New 1,3,4-Oxadiazole Derivatives

    Directory of Open Access Journals (Sweden)

    Petronio Filgueiras de Athayde-Filho

    2012-05-01

    Full Text Available Five new 1-(2-(5-nitrofuran-2-yl-5-(aryl-1,3,4-oxadiazol-3-(2H-yl ethanone compounds 5a–e were synthesized by cyclization of N-acylhydrazones 4a–e with acetic anhydride under reflux conditions. Their structures were fully characterized by IR, 1H-NMR, and 13C-NMR. Furthermore, evaluations of the antibacterial activity of the 1,3,4-oxadiazoles 5a–e and N-acylhydrazones 4a–e showed strong activity against several strains of Staphylococcus aureus, with MICs between 4 μg/mL to 32 μg/mL. In silico studies of the parameters of Lipinski’s Rule of Five, as well as the topological polar surface area (TPSA, absorption percentage (% ABS, drug likeness and drug score indicate that these compounds, especially 4a and 5d, have potential to be new drug candidates.

  11. 4-[3-(1-Naphthyloxymethyl-7H-1,2,4-triazolo[3,4-b][1,3,4]thiadiazin-6-yl]-3-p-tolylsydnone

    Directory of Open Access Journals (Sweden)

    Jia Hao Goh

    2010-06-01

    Full Text Available In the title sydnone compound, C24H18N6O3S {systematic name: 4-[3-(1-naphthyloxymethyl-7H-1,2,4-triazolo[3,4-b][1,3,4]thiadiazin-6-yl]-3-p-tolyl-4,5-dihydro-1,2,3-oxadiazol-3-ium-5-olate} an intramolecular C—H...O hydrogen bond generates an S(6 ring motif. The 3,6-dihydro-1,3,4-thiadiazine ring adopts a twist-boat conformation. The essentially planar 1,2,3-oxadiazole and 1,2,4-triazole rings [maximum deviations of 0.006 (1 and 0.008 (1 Å, respectively] are inclined to one another at interplanar angle of 44.11 (4°. The naphthalene unit forms an interplanar angle of 66.40 (4° with the 1,2,4-triazole ring. In the crystal packing, pairs of intermolecular C—H...O hydrogen bonds link adjacent molecules into dimers incorporating R22(12 ring motifs. Further stabilization is provided by weak C—H...π interactions.

  12. Verandering van die moreel-etiese situasie in Suid-Afrika in die lig van die kenmotief in 2 Petrus 1:3-4

    Directory of Open Access Journals (Sweden)

    D.G. Breed

    2000-08-01

    Full Text Available The change in the moral-ethical situation in South Africa, in the light of the motif of knowing in 2 Peter 1:3-4 In this article it is argued that in 2 Peter 1:3-4 a motif of knowing is present as a clearly repeated and meaningful semantic unit. An attempt is made to indicate that a profound knowledge of Jesus Christ was instrumental in giving the apostles accepted religious beliefs. These accepted beliefs enabled the apostles to act in such a manner that their behaviour reflected correct religious beliefs and attitudes. The profound knowledge of Jesus Christ also played an important role in the establishment of a covenantal relationship between God and the first readers of 2 Peter. This knowledge also enabled these readers to withstand the moral corruption in the world. In conclusion the possible significance of the motif of knowing in 2 Peter in changing the present South African moral-ethical situation is highlighted.

  13. S-nitrosylation and S-glutathionylation of Cys134 on troponin I have opposing competitive actions on Ca(2+) sensitivity in rat fast-twitch muscle fibers.

    Science.gov (United States)

    Dutka, T L; Mollica, J P; Lamboley, C R; Weerakkody, V C; Greening, D W; Posterino, G S; Murphy, R M; Lamb, G D

    2017-03-01

    Nitric oxide is generated in skeletal muscle with activity and decreases Ca(2+) sensitivity of the contractile apparatus, putatively by S-nitrosylation of an unidentified protein. We investigated the mechanistic basis of this effect and its relationship to the oxidation-induced increase in Ca(2+) sensitivity in mammalian fast-twitch (FT) fibers mediated by S-glutathionylation of Cys134 on fast troponin I (TnIf). Force-[Ca(2+)] characteristics of the contractile apparatus in mechanically skinned fibers were assessed by direct activation with heavily Ca(2+)-buffered solutions. Treatment with S-nitrosylating agents, S-nitrosoglutathione (GSNO) or S-nitroso-N-acetyl-penicillamine (SNAP), decreased pCa50 ( = -log10 [Ca(2+)] at half-maximal activation) by ~-0.07 pCa units in rat and human FT fibers without affecting maximum force, but had no effect on rat and human slow-twitch fibers or toad or chicken FT fibers, which all lack Cys134. The Ca(2+) sensitivity decrease was 1) fully reversed with dithiothreitol or reduced glutathione, 2) at least partially reversed with ascorbate, indicative of involvement of S-nitrosylation, and 3) irreversibly blocked by low concentration of the alkylating agent, N-ethylmaleimide (NEM). The biotin-switch assay showed that both GSNO and SNAP treatments caused S-nitrosylation of TnIfS-glutathionylation pretreatment blocked the effects of S-nitrosylation on Ca(2+) sensitivity, and vice-versa. S-nitrosylation pretreatment prevented NEM from irreversibly blocking S-glutathionylation of TnIf and its effects on Ca(2+) sensitivity, and likewise S-glutathionylation pretreatment prevented NEM block of S-nitrosylation. Following substitution of TnIf into rat slow-twitch fibers, S-nitrosylation treatment caused decreased Ca(2+) sensitivity. These findings demonstrate that S-nitrosylation and S-glutathionylation exert opposing effects on Ca(2+) sensitivity in mammalian FT muscle fibers, mediated by competitive actions on Cys134 of TnIf. Copyright

  14. Synthesis and characterization of thermally stable aromatic polyamides and poly(1,3,4-oxadiazole-amide)s nanoparticles containing pendant substituted bezamides.

    Science.gov (United States)

    Hassan, Hammed Ham; Elhusseiny, Amel F; Elkony, Yasmeen Ma; Mansour, El-Sayed Me

    2013-01-23

    The introduction of pendent bulky groups along the polymer backbone results in a less ordered polymer matrix and increases the solubility characteristics without affecting thermal properties. The inclusion of chromogenic chemical moieties in the chains can give rise to the luminescent converter material which permits the preparation of materials with potential applications. Aromatic polymers containing heterocyclic rings in the main chain are known for their high thermal resistance, good hydrolytic stability, low dielectric and tough mechanical properties. There is currently much research directed towards the discovery of new blue light-emitting polymers, with characteristics of high efficiency and high reliability. Herein, we describe the preparation of aromatic polyamides and poly (1,3,4-oxadiazole-amide)s nanoparticles with pendant structures comprised of m- and p-acetoxybenzamide groups, where the acetoxybenzamide groups act as signaling units due to their fluorescent and chromogenic characteristics. Aromatic polyamides and poly(1,3,4-oxadiazole-amide)s nanoparticles with pendant structures comprised of m- and p-acetoxybenzamide groups were successfully prepared and characterized using different analytical methods. Most polyamides were obtained as well-separated spherical nanoparticles while aramide containing pyridine produced aggregated particles attributed to the molecular self assembly via H-bond directed organization of molecular precursors. The thermal behavior of all polymers exhibited two major thermal decompositions due to the subsequent breakage of the acetoxy group in the lateral chain and cleavage of the main amide bonds. Photoluminescence studies revealed that the blue emissions for the polyamide derived from benzidine were blue-shifted (shifted to a lower wavelength) compared to that of polyamides containing flexible linkages. We report the synthesis of aromatic polyamides and poly(1,3,4-oxadiazole-amide)s nanoparticles with pendant structures

  15. Baseline quantity of 131I, 137Cs, 134Cs and 40K in urinary excretions from Thai people and internal exposure dose

    Science.gov (United States)

    Peekhunthod, D.; Bangvirunrak, J.; Sansakon, S.; Nukultham, A.; Pukkhaw, T.

    2017-06-01

    Today, sealed and unsealed radioactive materials have been used in Thailand for various purposes such as medical, agricultural and industrial applications. There is a growing trend in the use of radioactive materials. Moreover, neighboring countries are planning to construct and operate nuclear power plants. In case of nuclear power plant accidents, radioactive releases in environment and intakes into human body by inhalation and ingestion causing long term health effects. This research aims to determine the radiation baseline quantity of interested relevant radionuclides such as 131I, 137Cs, 134Cs as well as a natural radionuclide, 40K in urine samples of Thai people by gamma spectrometry. Two types of detectors (NaI and HpGe detectors) are calibrated by mixed radionuclide standards of 109Cd, 57Co, 133Ba, 54Mn, 137Cs and 60Co, (energy range from 88 to 1,331 keV). 720 urine samples are collected over a 24 hour period from Thai volunteers with the age older than 18 years old, who lived in eight locations of Thailand. To reduce the effect of geometric difference, 30 ml of urine samples are prepared for counting measurement and efficiency determination. The radiation baseline quantity of 131I, 137Cs, 134Cs and 40K in 30 ml of urine samples are 0.37±0.09, 0.63±0.13, 0.39±0.08 and 7.84±1.63 Bq, respectively. Based on the assumption of intake (50% of the intake by ingestion and 50% of the intake by inhalation), internal dose for members of public are assessed. The committed dose equivalent due to an intake of 131I, 137Cs, 134Cs and 40K are 2.36E-03±1.66-03, 1.15E-01±8.61E-02, 1.16E-01±7.77E-02, 9.44E-01±3.56E-01 mSv per year, respectively.

  16. Synthesis and optical properties of new 5'-aryl-substituted 2,5-bis(3-decyl-2,2'-bithiophen-5-yl-1,3,4-oxadiazoles

    Directory of Open Access Journals (Sweden)

    Anastasia S. Kostyuchenko

    2017-02-01

    Full Text Available New photoluminescent donor–acceptor–donor (DAD molecules, namely 5'-aryl-substituted 2,5-bis(3-decyl-2,2'-bithiophen-5-yl-1,3,4-oxadiazoles were prepared by palladium-catalyzed coupling from readily available compounds such as ethyl 3-decyl-2,2'-bithiophene-5-carboxylate and aryl halides. The obtained compounds feature increasing bathochromic shifts in their emission spectra with increasing aryl-substituent size yielding blue to bluish-green emissions. At the same time, their absorption spectra are almost independent from the identity of the terminal substituent with λmax values ranging from 395 to 405 nm. The observed trends are perfectly predicted by quantum chemical DFT/TDDFT calculations carried out for these new molecules.

  17. Novel photoluminescent polymers containing oligothiophene and m-phenylene-1,3,4-oxadiazole moieties: synthesis and spectroscopic and electrochemical studies

    Science.gov (United States)

    Meng; Huang

    2000-06-30

    Three conjugated polymers containing oligothiophene units (from one to three thiophene rings) and aromatic 1,3,4-oxadiazole moieties have been successfully synthesized. The polymer structures were characterized and confirmed by (1)H and (13)C NMR, FT-IR, and elemental analysis. Thermogravimetric analysis demonstrated that the polymers are highly thermal stable. Tunable absorption (from 342 to 428 nm) and fluorescence (from 411 to 558 nm) properties of polymers were observed. The electrochemical investigation indicated that the LUMO and HOMO energy levels of the new polymers could be adjusted. It was also revealed by the electrochemical analysis that the polymers have good charge injection properties for both p-type and n-type charge carriers, as well as good color tunable luminescence and film-forming properties, which makes them potentially useful for fabricating efficient light-emitting devices.

  18. Thermodynamic Property Surfaces for Adsorption of R507A, R134a, and n -Butane on Pitch-Based Carbonaceous Porous Materials

    KAUST Repository

    Chakraborty, Anutosh

    2010-10-01

    The thermodynamic property surfaces of R507A, R134a, and n-butane on pitch-based carbonaceous porous material (Maxsorb III) are developed from rigorous classical thermodynamics and experimentally measured adsorption isotherm data. These property fields enable us to compute the entropy, enthalpy, internal energy, and heat of adsorption as a function of pressure, temperature, and the amount of adsorbate. The entropy and enthalpy maps are necessary for the analysis of adsorption cooling cycle and gas storage. We have shown here that it is possible to plot an adsorption cooling cycle on the temperature-entropy (T-s) and enthalpy-uptake (h-x) maps. Copyright © Taylor and Francis Group, LLC 2010.

  19. Comparison of four inverse modelling systems applied to the estimation of HFC-125, HFC-134a, and SF6 emissions over Europe

    Science.gov (United States)

    Brunner, Dominik; Arnold, Tim; Henne, Stephan; Manning, Alistair; Thompson, Rona L.; Maione, Michela; O'Doherty, Simon; Reimann, Stefan

    2017-09-01

    Hydrofluorocarbons (HFCs) are used in a range of industrial applications and have largely replaced previously used gases (CFCs and HCFCs). HFCs are not ozone-depleting but have large global warming potentials and are, therefore, reported to the United Nations Framework Convention on Climate Change (UNFCCC). Here, we use four independent inverse models to estimate European emissions of the two HFCs contributing the most to global warming (HFC-134a and HFC-125) and of SF6 for the year 2011. Using an ensemble of inverse models offers the possibility to better understand systematic uncertainties in inversions. All systems relied on the same measurement time series from Jungfraujoch (Switzerland), Mace Head (Ireland), and Monte Cimone (Italy) and the same a priori estimates of the emissions, but differed in terms of the Lagrangian transport model (FLEXPART, NAME), inversion method (Bayesian, extended Kalman filter), treatment of baseline mole fractions, spatial gridding, and a priori uncertainties. The model systems were compared with respect to the ability to reproduce the measurement time series, the spatial distribution of the posterior emissions, uncertainty reductions, and total emissions estimated for selected countries. All systems were able to reproduce the measurement time series very well, with prior correlations between 0.5 and 0.9 and posterior correlations being higher by 0.05 to 0.1. For HFC-125, all models estimated higher emissions from Spain + Portugal than reported to UNFCCC (median higher by 390 %) though with a large scatter between individual estimates. Estimates for Germany (+140 %) and Ireland (+850 %) were also considerably higher than UNFCCC, whereas the estimates for France and the UK were consistent with the national reports. In contrast to HFC-125, HFC-134a emissions from Spain + Portugal were broadly consistent with UNFCCC, and emissions from Germany were only 30 % higher. The data suggest that the UK over-reports its HFC-134a emissions to

  20. Self-assemblies, helical ribbons and gelation tuned by solvent-gelator interaction in a bi-1,3,4-oxadiazole gelator

    Science.gov (United States)

    Zhao, Chengxiao; Bai, Binglian; Wang, Haitao; Qu, Songnan; Xiao, Guanjun; Tian, Taiji; Li, Min

    2013-04-01

    A bi-1,3,4-oxadiazole derivative (BOXDH-T12) showed intramolecular charge transition at concentrations lower than 1 × 10-5 mol/L. The self-assembling behaviors of BOXDH-T12 depended on solvents that it self-assembled into H-aggregates in alcohols and slipped packing aggregates in DMSO. FTIR, 1H NMR and TGA results revealed that strong gelator-gelator hydrogen bonding interaction induced H-aggregation of BOXDH-T12 in alcohols and the interactions between DMSO and BOXDH-T12 molecules caused a slipped stacking. BOXDH-T12 can gel the mixtures of DMSO and ethanol through a cooperative effect of the hydrogen bonding, van der Waals interaction and π-π stacking forces, furthermore, helical ribbons could be observed in DMSO/ethanol due to DMSO molecule interacting. In alcohols, solvophobic/solvophilic effect plays a critical role in gelation behaviors.

  1. trans-Diaquabis[2,5-bis(pyridin-2-yl-1,3,4-thiadiazole]cobalt(II bis(tetrafluoridoborate

    Directory of Open Access Journals (Sweden)

    Fouad Bentiss

    2011-07-01

    Full Text Available The bidentate 1,3,4-thiadiazole ligand substituted by two 2-pyridyl rings (denoted L has been found to produce the new monomeric title complex, [Co(C12H8N4S2(H2O2](BF42. The thiadiazole and pyridyl rings surrounding the Co atom are almost coplanar [dihedral angle = 4.35 (7°]. The mean plane defined by these heterocyclic moieties makes a dihedral angle of 18.72 (6° with the non-coordinated pyridyl ring. The Co2+ cation, located at a crystallographic center of symmetry, is bonded to two ligands and two water molecules in a trans configuration in an octahedral environment. The tetrafluoridoborate ions can be regarded as free anions in the crystal lattice. Nevertheless, they are involved in an infinite two-dimensional network along the [010] and [101] directions of O—H...F hydrogen bonds.

  2. Mapping of Spinocerebellar Ataxia 13 to Chromosome 19q13.3-q13.4 in a Family with Autosomal Dominant Cerebellar Ataxia and Mental Retardation

    Science.gov (United States)

    Herman-Bert, Alexandra; Stevanin, Giovanni; Netter, Jean-Claude; Rascol, Olivier; Brassat, David; Calvas, Patrick; Camuzat, Agnès; Yuan, Qiu-ping; Schalling, Martin; Dürr, Alexandra; Brice, Alexis

    2000-01-01

    We examined a large French family with autosomal dominant cerebellar ataxia (ADCA) that was excluded from all previously identified spinocerebellar ataxia genes and loci. The patients—seven women and a 4-year-old boy—exhibited slowly progressive childhood-onset cerebellar gait ataxia associated with cerebellar dysarthria, moderate mental retardation (IQ 62–76), and mild developmental delays in motor acquisition. Nystagmus and pyramidal signs were also observed in some cases. This unique association of clinical features clearly distinguishes this new entity from other previously described ADCA. Cerebral magnetic-resonance imaging showed moderate cerebellar and pontine atrophy in two patients. We performed a genomewide search and found significant evidence for linkage to chromosome 19q13.3-q13.4, in an ∼8-cM interval between markers D19S219 and D19S553. PMID:10820125

  3. Synthesis and Antimicrobial Activities of 1,2,4-Triazole and 1,3,4-Thiadiazole Derivatives of 5-Amino-2-Hydroxybenzoic Acid

    Directory of Open Access Journals (Sweden)

    Sabir Hussain

    2008-01-01

    Full Text Available Various 4-amino-2-[4-(4-substituted phenyl-5-sulfanyl-4H-1,2,4-triazol-3-yl] phenol (4a-c, 4-amino-2-{4-amino-5-[(4-substituted phenylamino]-4H-1,2,4-triazol-3-yl} phenol (5a-c and 4-amino-2-{5-[(4-substituted phenylamino]-1,3,4-thiadiazole-2-yl} phenol (6a-g were synthesized and evaluated for their antibacterial and antifungal activity. The compounds showed significant antibacterial activity against S. aureus (gram-positive and E.coli (gram-negative bacteria and antifungal activity against A. niger fungi using cup plate technique

  4. Synthesis and development of new 2-substituted 1-[3-(4-arylpiperazin-1-yl)propyl]-pyrrolidin-2-one derivatives with antiarrhythmic, hypotensive, and alpha-adrenolytic activity.

    Science.gov (United States)

    Malawska, Barbara; Kulig, Katarzyna; Gippert, Annika; Filipek, Barbara; Sapa, Jacek; Maciag, Dorota

    2005-10-01

    A series of new 1-[3-(4-arylpiperazinyl-1-yl)-2-(N-alkylcarbamoyloxy)propyl]-pyrrolidin-2-one derivatives (4a-12a) were synthesised and tested for their electrocardiographic, antiarrhythmic and antihypertensive activity, as well as for the alpha1- and alpha2-adrenoceptor binding affinities. Of the newly synthesised derivatives, 1-{2-(N-2-methylethylcarbamoiloxy)-3-[4-(2-methoxyphenyl)piperazin-1-yl)]propyl}pyrrolidin-2-one dihydrochloride (10a) was the most active in prophylactic antiarrhythmic tests, its ED50 value equalling 2.7 mg kg(-1), and the therapeutic index being 75.2; moreover, compound 10a was also found to possess hypotensive activity. A preliminary molecular modelling study suggested that the selected alpha1-AR antagonist distances and angles between pharmacophoric features, estimated for the tested compounds, were in good agreement with the parameters evaluated for ligands.

  5. Synthesis and testing of 3-acetyl-2,5-disubstituted-2,3-dihydro-1,3,4-oxadiazole derivatives for antifungal activity against selected Candida Species

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Cledualdo S. de; Lira, Bruno F.; Athayde-Filho, Petronio F. de, E-mail: athayde-filho@quimica.ufpb.br [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Dept. de Quimica; Barbosa-Filho, Jose M.; Lorenzo, Jorge G.F.; Menezes, Camilla P. de; Santos, Jessyca M.C.G. dos; Lima, Edeltrudes de O. [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Dept. de Ciencias Farmaceuticas

    2013-01-15

    A series of 21 1,3,4-oxadiazoline derivatives was synthesized by cyclization of N-acylhydrazones with acetic anhydride and evaluated for their in vitro antifungal activity against six Candida strains: Candida albicans (ATCC 90028 and LM V-42), C. krusei (ATCC 6258 and LM 12 C) and C. tropicalis (ATCC 13803 and LM 14). The Candida strains were found to be sensitive to some of the compounds, which inhibited the growth by 50-90%, with minimum inhibitory concentration (MIC) in the range of 64-512 {mu}g mL{sup -1}. The compounds' structures were fully confirmed and characterized by Fourier transform infrared spectroscopy (FTIR), {sup 1}H and {sup 13}C nuclear magnetic resonance (NMR) and mass spectrometry (MS). (author)

  6. 3D-QSAR modeling and molecular docking studies on a series of 2,5 disubstituted 1,3,4-oxadiazoles

    Science.gov (United States)

    Ghaleb, Adib; Aouidate, Adnane; Ghamali, Mounir; Sbai, Abdelouahid; Bouachrine, Mohammed; Lakhlifi, Tahar

    2017-10-01

    3D-QSAR (comparative molecular field analysis (CoMFA)) and comparative molecular similarity indices analysis (CoMSIA) were performed on novel 2,5 disubstituted 1,3,4-oxadiazoles analogues as anti-fungal agents. The CoMFA and CoMSIA models using 13 compounds in the training set gives Q2 values of 0.52 and 0.51 respectively, while R2 values of 0.92. The adapted alignment method with the suitable parameters resulted in reliable models. The contour maps produced by the CoMFA and CoMSIA models were employed to determine a three-dimensional quantitative structure-activity relationship. Based on this study a set of new molecules with high predicted activities were designed. Surflex-docking confirmed the stability of predicted molecules in the receptor.

  7. Comparison of four inverse modelling systems applied to the estimation of HFC-125, HFC-134a, and SF6 emissions over Europe

    Directory of Open Access Journals (Sweden)

    D. Brunner

    2017-09-01

    Full Text Available Hydrofluorocarbons (HFCs are used in a range of industrial applications and have largely replaced previously used gases (CFCs and HCFCs. HFCs are not ozone-depleting but have large global warming potentials and are, therefore, reported to the United Nations Framework Convention on Climate Change (UNFCCC. Here, we use four independent inverse models to estimate European emissions of the two HFCs contributing the most to global warming (HFC-134a and HFC-125 and of SF6 for the year 2011. Using an ensemble of inverse models offers the possibility to better understand systematic uncertainties in inversions. All systems relied on the same measurement time series from Jungfraujoch (Switzerland, Mace Head (Ireland, and Monte Cimone (Italy and the same a priori estimates of the emissions, but differed in terms of the Lagrangian transport model (FLEXPART, NAME, inversion method (Bayesian, extended Kalman filter, treatment of baseline mole fractions, spatial gridding, and a priori uncertainties. The model systems were compared with respect to the ability to reproduce the measurement time series, the spatial distribution of the posterior emissions, uncertainty reductions, and total emissions estimated for selected countries. All systems were able to reproduce the measurement time series very well, with prior correlations between 0.5 and 0.9 and posterior correlations being higher by 0.05 to 0.1. For HFC-125, all models estimated higher emissions from Spain + Portugal than reported to UNFCCC (median higher by 390 % though with a large scatter between individual estimates. Estimates for Germany (+140 % and Ireland (+850 % were also considerably higher than UNFCCC, whereas the estimates for France and the UK were consistent with the national reports. In contrast to HFC-125, HFC-134a emissions from Spain + Portugal were broadly consistent with UNFCCC, and emissions from Germany were only 30 % higher. The data suggest that the UK over

  8. 5-(Adamantan-1-yl-3-[(4-benzylpiperazin-1-ylmethyl]-1,3,4-oxadiazole-2(3H-thione

    Directory of Open Access Journals (Sweden)

    Ali A. El-Emam

    2012-07-01

    Full Text Available The molecule of the title compound, C24H32N4OS, is a functionalized 1,3,4-oxadiazole-2-thione with substituted piperazine and adamantanyl substituents attached at the 3- and 5-positions, respectively, of the oxadiazole spacer with an approximately C-shaped conformation. In the crystal, molecules form dimers via C—H...S interaction. The piperazine ring has a chair conformation; the substituents S, methylene C and adamantane C of the essentially planar oxadiazole ring are approximately in the same plane, with distances of −0.046 (2, −0.085 (5 and 0.003 (4 Å, respectively. The dihedral angle between the planes of the phenyl and oxadiazole rings is 31.3 (3°.

  9. Local heat transfer coefficients during the evaporation of 1,1,1,2-tetrafluoroethane (R-134a in a plate heat exchanger

    Directory of Open Access Journals (Sweden)

    EMILA ŽIVKOVIĆ

    2009-04-01

    Full Text Available The evaporation heat transfer coefficient of the refrigerant R-134a in a vertical plate heat exchanger was investigated experimentally. The area of the plate was divided into several segments along the vertical axis. For each of the segments, the local value of the heat transfer coefficient was calculated and presented as a function of the mean vapor quality in the segment. Owing to the thermocouples installed along the plate surface, it was possible to determine the temperature distribution and vapor quality profile inside the plate. The influences of the mass flux, heat flux, pressure of system and the flow configuration on the heat transfer coefficient were also taken into account and a comparison with literature data was performed.

  10. Sustained safety and efficacy of extended-shelf-life {sup 90}Y glass microspheres: long-term follow-up in a 134-patient cohort

    Energy Technology Data Exchange (ETDEWEB)

    Lewandowski, Robert J.; Minocha, Jeet; Memon, Khairuddin; Riaz, Ahsun; Gates, Vanessa L.; Ryu, Robert K.; Sato, Kent T.; Omary, Reed; Salem, Riad [Northwestern University, Department of Radiology, Chicago, IL (United States)

    2014-03-15

    To validate our initial pilot study and confirm sustained safety and tumor response of extended-shelf-life {sup 90}Y glass microspheres. We hypothesized that for the same planned tissue dose, the increase in number of glass microspheres (decayed to the second week of their allowable shelf-life) administered for the same absorbed dose would result in better tumor distribution of the microspheres without causing additional adverse events. Between June 2007 and January 2010, 134 patients underwent radioembolization with extended-shelf-life {sup 90}Y glass microspheres; data from 84 new patients were combined with data from our 50-patient pilot study cohort. Baseline and follow-up imaging and laboratory data were obtained 1 and 3 months after therapy and every 3 months thereafter. Clinical and biochemical toxicities were prospectively captured and categorized according to the Common Terminology Criteria. Response in the index lesion was assessed using WHO and EASL guidelines. The mean delivered radiation dose was 123 Gy to the target liver tissue. The mean increase in number of microspheres with this approach compared to standard {sup 90}Y glass microsphere dosimetry was 103 %, corresponding to an increase from 3.84 to 7.78 million microspheres. Clinical toxicities included fatigue (89 patients, 66 %), abdominal pain (49 patients, 36.6 %), and nausea/vomiting (25 patients, 18.7 %). Grade 3/4 bilirubin toxicity was seen in three patients (2 %). Two (1 %) of the initial 50-patient cohort showed gastroduodenal ulcers; gastroduodenal ulcers were not seen in any of the subsequent 84 patients. According to WHO and EASL guidelines, response rates were 48 % and 57 %, respectively, and 21 % demonstrated a complete EASL response. This study showed sustained safety and efficacy of extended-shelf-life {sup 90}Y glass microspheres in a larger, 134-patient cohort. The increase in number of microspheres administered theoretically resulted in better tumor distribution of the

  11. Characterization of an apple TT2-type R2R3 MYB transcription factor functionally similar to the poplar proanthocyanidin regulator PtMYB134.

    Science.gov (United States)

    Gesell, Andreas; Yoshida, Kazuko; Tran, Lan T; Constabel, C Peter

    2014-09-01

    The apple MdMYB9 gene encodes a positive regulator of proanthocyanidin synthesis that activates anthocyanidin reductase promoters from apple and poplar via interaction with basic helix-loop-helix proteins. The regulation of proanthocyanidins (PAs, condensed tannins) is of great importance in food plants due to the many benefits of PAs in the human diet. Two candidate flavonoid MYB regulators, MdMYB9 and MdMYB11, were cloned from apple (Malus × domestica) based on their similarity to known MYB PA regulators. Transcript accumulation of both MdMYB9 and MdMYB11 was induced by high light and wounding, similar to the poplar (Populus spp) PA regulator PtMYB134. In transient activation assays with various basic helix-loop-helix (bHLH) co-regulators, MdMYB9 activated apple and poplar anthocyanidin reductase (ANR) promoters, while MdMYB11 showed no activity. Potential transcription factor binding elements were found within several ANR promoters, and the importance of the bHLH binding site (E-box) on ANR promoter activation was demonstrated via mutational analysis. The ability of MdMYB9 and PtMYB134 to reciprocally activate ANR promoters from both apple and poplar and to partner with heterologous bHLH co-factors from these plants confirms the high degree of conservation of PA regulatory complexes across species. The similarity in apple and poplar PA regulation suggests that regulatory genes from poplar could be effectively employed for metabolic engineering of the PA pathway in apple.

  12. Synthesis and antifungal activity of 2-azetidinonyl-5-(2-benzoylphenoxy)methyl-1,3,4-oxadiazoles against seed-borne pathogens of Eleusine coracana (L.) Gaertn.

    Science.gov (United States)

    Khanum, Shaukath A; Shashikanth, Sheena; Sathyanarayana, Syagadadu Giriyanna; Lokesh, Siddalingaiah; Deepak, Saligrama A

    2009-07-01

    Finger millet is a major food crop as well as feed and fodder for livestock, especially in regions of southern India. A sturdy crop to fluctuating environmental conditions, it can be cultivated in all seasons of the year. Leaf, neck and finger blast caused by Pyricularia grisea Sacc. and Bipolaris setariae (Saw.) Shoem, as well as leaf spot disease, Bipolaris nodulosa (Berk & M.A.Curtis) Shoem, are major production constraints in southern India. Apart from environmental conditions, the use of harvested seeds by farmers is a major reason for disease prevalence. Benzophenone analogues have been investigated for controlling phytopathogenic fungi. In addition, the most important applications of azetidin-2-ones are as antibiotics. Based on this information, the present study was conducted to explore the antifungal activity of integrated 2-azetidinonyl and 1,3,4-oxadiazoles moieties into a benzophenone framework. A simple high-yielding method for the integration of heterocyclic rings, namely 2-azetidinonyl, at the benzophenone nucleus has been achieved, starting from substituted 2-hydroxybenzophenones under mild conditions on a wet solid surface using microwave irradiation. In the present study, an array of newly synthesised compounds, 2-azetidinonyl-5-(2-benzoylphenoxy)methyl-1,3,4-oxadiazoles, were screened for their antifungal property against blast and leaf spot causing fungi associated with the seeds of finger millet, cv. Indof-9. Two of the newly synthesised compounds showed promising effects in depleting the incidence of seed-borne pathogenic fungi of finger millet. The suppression of Pyricularia grisea and Bipolaris setariae resulted in enhanced seed germination and seedling growth. (c) 2009 Society of Chemical Industry.

  13. Test of Internal-Conversion Theory with Precise γ- and x-ray Spectroscopy: ^134Cs^m,^ 137Ba, ^139La

    Science.gov (United States)

    Nica, N.; Hardy, J. C.; Balonek, C.; Iacob, V. E.; Goodwin, J.; Park, H. I.; Rockwell, W. E.; Trzhaskovskaya, M. B.

    2007-10-01

    We recently reported [1] a measurement of the ratio of K-shell internal conversion coefficients, αK, for two transitions; the 127.5-keV E3 in ^134Cs and the 661.7-keVM4 in ^137Ba. Previous measurements of these αK values disagreed with calculations. Our new result for the ratio, 30.01(15), disagrees with, but is a factor of three more precise than, the previous average of all experimental results and is consistent with modern Dirac-Fock calculations that include the atomic vacancy in the daughter. This confirms our earlier conclusion [2] that this approach is the best one for ^193Ir, a much heavier nucleus. In a new measurement we have now deduced the precise efficiency of our HPGe detector in the energy range of Cs-La K X-rays from the 165.9 keV, M1 transition in ^139La, for which the αK value can be reliably calculated and is nearly independent of whether the atomic vacancy is included or not. Based on this calibration, we have converted our ratio result into individual αK results for the transitions in ^134Cs and ^137Ba: viz. αK(127.5)=2.745(16) and αK(661.7)=0.0915(6). Both results are in good agreement with calculations that include the atomic vacancy. [1] N. Nica et al., Phys. Rev. C75, 024308 (2007); [2] N. Nica et al., Phys. Rev. C70, 054305 (2004).

  14. The crystal structures of two isomers of 5-(phenyl-iso-thia-zol-yl)-1,3,4-oxa-thia-zol-2-one.

    Science.gov (United States)

    Zhu, Shuguang; Schriver, Melbourne J; Hendsbee, Arthur D; Masuda, Jason D

    2017-11-01

    The syntheses and crystal structures of two isomers of phenyl iso-thia-zolyl oxa-thia-zolone, C11H6N2O2S2, are described [systematic names: 5-(3-phenyl-iso-thia-zol-5-yl)-1,3,4-oxa-thia-zol-2-one, (I), and 5-(3-phenyl-iso-thia-zol-4-yl)-1,3,4-oxa-thia-zol-2-one, (II)]. There are two almost planar (r.m.s. deviations = 0.032 and 0.063 Å) mol-ecules of isomer (I) in the asymmetric unit, which form centrosymmetric tetra-mers linked by strong S⋯N [3.072 (2) Å] and S⋯O contacts [3.089 (1) Å]. The tetra-mers are π-stacked parallel to the a-axis direction. The single mol-ecule in the asymmetric unit of isomer (II) is twisted into a non-planar conformation by steric repulsion [dihedral angles between the central iso-thia-zolyl ring and the pendant oxa-thia-zolone and phenyl rings are 13.27 (6) and 61.18 (7)°, respectively], which disrupts the π-conjugation between the heteroaromatic iso-thia-zoloyl ring and the non-aromatic oxa-thia-zolone heterocycle. In the crystal of isomer (II), the strong S⋯O [3.020 (1) Å] and S⋯C contacts [3.299 (2) Å] and the non-planar structure of the mol-ecule lead to a form of π-stacking not observed in isomer (I) or other oxa-thia-zolone derivatives.

  15. Convergent synthesis of new N -substituted 2-{[5-(1H -indol-3-ylmethyl-1,3,4-oxadiazol-2-yl]sulfanyl}acetamides as suitable therapeutic agents

    Directory of Open Access Journals (Sweden)

    Kaniz Rubab

    2015-12-01

    Full Text Available abstract A series of N-substituted 2-{[5-(1H-indol-3-ylmethyl-1,3,4-oxadiazol-2-yl]sulfanyl}acetamides (8a-w was synthesized in three steps. The first step involved the sequential conversion of 2-(1H-indol-3-ylacetic acid (1 to ester (2 followed by hydrazide (3 formation and finally cyclization in the presence of CS2 and alcoholic KOH yielded 5-(1H-indole-3-yl-methyl-1,3,4-oxadiazole-2-thiol (4. In the second step, aryl/aralkyl amines (5a-w were reacted with 2-bromoacetyl bromide (6 in basic medium to yield 2-bromo-N-substituted acetamides (7a-w. In the third step, these electrophiles (7a-w were reacted with 4 to afford the target compounds (8a-w. Structural elucidation of all the synthesized derivatives was done by 1H-NMR, IR and EI-MS spectral techniques. Moreover, they were screened for antibacterial and hemolytic activity. Enzyme inhibition activity was well supported by molecular docking results, for example, compound 8q exhibited better inhibitory potential against α-glucosidase, while 8g and 8b exhibited comparatively better inhibition against butyrylcholinesterase and lipoxygenase, respectively. Similarly, compounds 8b and 8c showed very good antibacterial activity against Salmonella typhi, which was very close to that of ciprofloxacin, a standard antibiotic used in this study. 8c and 8l also showed very good antibacterial activity against Staphylococcus aureus as well. Almost all compounds showed very slight hemolytic activity, where 8p exhibited the least. Therefore, the molecules synthesized may have utility as suitable therapeutic agents.

  16. Crystal structure of 3-[(4-benzylpiperazin-1-ylmethyl]-5-(thiophen-2-yl-2,3-dihydro-1,3,4-oxadiazole-2-thione

    Directory of Open Access Journals (Sweden)

    Fatmah A. M. Al-Omary

    2015-03-01

    Full Text Available The title 1,3,4-oxadiazole-2-thione derivative, C18H20N4OS2, crystallized with two independent molecules (A and B in the asymmetric unit. The 2-thienyl rings in both molecules are rotationally disordered over two orientations by approximately 180° about the single C—C bond that connects it to the oxadiazole thione ring; the ratios of site occupancies for the major and minor components were fixed in the structure refinement at 0.8:0.2 and 0.9:0.1 in molecules A and B, respectively. The 1,3,4-oxadiazole-2-thione ring forms dihedral angles of 7.71 (16, 10.0 (11 and 77.50 (12° (molecule A, and 6.5 (3, 6.0 (9 and 55.30 (12° (molecule B with the major and minor parts of the disordered thiophene ring and the mean plane of the adjacent piperazine ring, respectively, resulting in approximately V-shaped conformations for the molecules. The piperazine ring in both molecules adopts a chair conformation. The terminal benzene ring is inclined towards the mean plane of the piperazine ring with N—C—C—C torsion angles of −58.2 (3 and −66.2 (3° in molecules A and B, respectively. In the crystal, no intermolecular hydrogen bonds are observed. The crystal packing features short S...S contacts [3.4792 (9 Å] and π–π interactions [3.661 (3, 3.664 (11 and 3.5727 (10 Å], producing a three-dimensional network.

  17. Differing effects of PTH 1-34, PTH 1-84 and zoledronic acid on bone microarchitecture and estimated strength in postmenopausal women with osteoporosis. An 18 month open-labeled observational study using HR-pQCT

    DEFF Research Database (Denmark)

    Hansen, Stinus; Hauge, Ellen Margrethe; Jensen, Jens-Erik Beck

    2012-01-01

    Whereas the beneficial effects of intermittent treatment with parathyroid hormone (PTH) (intact PTH 1-84 or fragment PTH 1-34, teriparatide) on vertebral strength is well documented, treatment may not be equally effective in the peripheral skeleton. We used high resolution peripheral quantitative...... computed tomography (HR-pQCT) to detail effects on compartmental geometry, density and microarchicture as well as finite element (FE) estimated integral strength at the distal radius and tibia in postmenopausal osteoporotic women treated with PTH 1-34 (20 µg sc. daily, n=18) or PTH 1-84 (100 µg sc. daily......, n=20) for 18 month in an open label, non-randomized study. A group of postmenopausal osteoporotic women receiving zoledronic acid (5 mg infusion once yearly, n=33) was also included. Anabolic therapy increased cortical porosity in radius (PTH 1-34 32±37%, PTH 1-84 39±32%, both p...

  18. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    2016-10-07

    Oct 7, 2016 ... 1Department of Physics, Faculty of Science, Taif University, Taif 888, Saudi Arabia. 2Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo, Egypt. 3Materials Science Unit, Department of Chemistry, Faculty of Science, Tanta University, 31725 Tanta, Egypt. 4Department of ...

  19. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    The optical properties of a new family of Sm2O3–(40–)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at ... The refractive index, molar refraction and polarizability of oxide ions have been calculated by using Lorentz–Lorentz relations. The non-linear variations of the above optical ...

  20. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. The optical properties of a new family of xSm2O3–(40–x)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at room temperature in the UV-visible region. From the absorption edge studies, the values of optical bandgap energies have been evaluated. The refractive index, molar ...

  1. Measurement of radiative lifetime in atomic samarium using ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... In this paper, we report the investigations of lifetime measurement of odd-parity energy level 19009.52 cm. −1 .... introduced by an electronic delay generator between the two Q-switch pulses of Nd-YAG laser. The slope of the .... Our values of the lifetimes are free from the common systematic errors. Thus ...

  2. A novel samarium complex with interesting photoluminescence and ...

    African Journals Online (AJOL)

    The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

  3. Lithium samarium polyphosphate, LiSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-02-01

    Full Text Available The mixed-metal rare-earth polyphosphate LiSm(PO34 consists of a three-dimensional framework in which zigzag [(PO3n]n− chains with a periodicity of four PO4 tetrahedra are connected through Li+ and Sm3+ ions (both with 2. symmetry.

  4. Sodium samarium tetrakis(polyphosphate, NaSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-07-01

    Full Text Available NaSm(PO34 has been prepared by solid state reactions. It belongs to type II of the structural family of MILnIII(PO34 compounds (MI = alkali metal and LnIII = rare earth metal and is composed of ∞(PO3n]n− polyphosphate chains with a repeating unit of four PO4 tetrahedra. The chains extend parallel to [100] and share O atoms with irregular SmO8 polyhedra, forming a three-dimensional framework which delimits tunnels occupied by Na+ cations in a distorted octahedral environment.

  5. Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

    Energy Technology Data Exchange (ETDEWEB)

    Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-08

    The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

  6. Synthesis of copper, silver, and samarium chalcogenides by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Ohtani, T.; Maruyama, K.; Ohshima, K. [Okayama Univ. of Science (Japan). Lab. for Solid State Chemistry

    1997-03-01

    CuInX{sub 2} (X = S, Se, Te), Ag{sub 2}S, Ag{sub 2}Se, Ag{sub 3}Te{sub 2}, Ag{sub 1.9}Te, AgCuSe, Sm{sub 3}Se{sub 4}, Sm{sub 2}Se{sub 3}, and SmTe were synthesized by a mechanical alloying method, using a high-energy planetary ball mill. The compounds were obtained by milling mixtures of the elements with desired ratios in agate or Cu-Be vials for 60--180 min.

  7. Oriented growth of thin films of samarium oxide by MOCVD

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Thin films of Sm2O3 have been grown on Si(100) and fused quartz by low-pressure chemical va- pour deposition using an adducted β-diketonate precursor. The films on quartz are cubic, with no preferred orientation at lower growth temperatures (~ 550°C), while they grow with a strong (111) orientation as the.

  8. 150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

    Science.gov (United States)

    1978-12-01

    considerable hand labor. Addition of a provision for suitable electrical connection by the SCR manufacturer wou;d be desirable for production runs. Predicted...licen- sing the holder or any other person or corporation, or conveying any rights or permission to manufacture , use, or sell any patented invent,’n...tesile strength to contain the magnets and pole pieces up through the overspeed rating of the rotor. The cho.;en process uses maraging steel as the

  9. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Glasses with the composition, (Sm2O3)(ZnO)(40–)(TeO2)(60), were prepared by conventional melt quenching method. The density, molar volume, and optical energy band gap of these glasses have been measured. The refractive index, molar refraction and polarizability of oxide ion have been calculated by using ...

  10. The time goes by: R 134a and R 32, important substances for the substitution of CFC and HCFC; On the production technology and marketing strategy of ICI. The time goes by: R 134a und R 32, bedeutsamste Stoffe fuer den FCKW- und HFCKW-Ausstieg; Ein Fachgespraech zu Produktionstechnologie und Weltmarktstrategie von ICI

    Energy Technology Data Exchange (ETDEWEB)

    Beckitt, J.W.; Harris, M.R.; Weissenborn, P.

    1993-11-01

    In this article an interview with representatives of a world-wide leading producer of refrigerants is given. Already five or six years ago they took the decision - which has already today proven to be correct - to find substituents which have a low toxicity, a low greenhouse potential and which do not deplete the ozone layer. R 134a turned out to be a promising substance. On the part of the producers it was stressed that tight regulations play an important role in the phase-out of CFC as only legal pressure will force the users to act. Also the establishment of an effective recycling system contributes to a better acceptance. (BWI)

  11. Human safety and pharmacokinetics of the CFC alternative propellants HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3, 3-heptafluoropropane) following whole-body exposure.

    Science.gov (United States)

    Emmen, H H; Hoogendijk, E M; Klöpping-Ketelaars, W A; Muijser, H; Duistermaat, E; Ravensberg, J C; Alexander, D J; Borkhataria, D; Rusch, G M; Schmit, B

    2000-08-01

    HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3, 3-heptafluoropropane) are used to replace chlorofluorocarbons (CFCs) in refrigerant and aerosol applications, including medical use in metered-dose inhalers. Production and consumption of CFCs are being phased out under the Montreal Protocol on Substances that Deplete the Ozone Layer. The safety and pharmacokinetics of HFC 134a and HFC 227 were assessed in two separate double-blind studies. Each HFC (hydrofluorocarbon) was administered via whole-body exposure as a vapor to eight (four male and four female) healthy volunteers. Volunteers were exposed, once weekly for 1 h, first to air and then to ascending concentrations of HFC (1000, 2000, 4000, and 8000 parts per million (ppm)), interspersed with a second air exposure and two CFC 12 (dichlorodifluoromethane) exposures (1000 and 4000 ppm). Comparison of either HFC 134a or HFC 227 to CFC 12 or air gave no clinically significant results for any of the measured laboratory parameters. There were no notable adverse events, there was no evidence of effects on the central nervous system, and there were no symptoms of upper respiratory tract irritation. HFC 134a, HFC 227, and CFC 12 blood concentrations increased rapidly and in an exposure-concentration-dependent manner, although not strictly proportionally, and approached steady state. Maximum blood concentrations (C(max)) tended to be higher in males than females; in the HFC 227 study, these were statistically significantly (P CFC 12 exposure level. In the HFC 134a study, the gender difference in C(max) was only statistically significant (P CFC 12 at 4000 ppm and HFC 134a at 8000 ppm. Following the end of exposure, blood concentrations declined rapidly, predominantly biphasically and independent of exposure concentration. For the HFC 134a study, the t(1/2)alpha (alpha elimination half-life) was short for both CFC 12 and HFC 134a (CFC 12 and HFC 134a, respectively. Mean residence time (MRT) was an overall mean

  12. Poly(2,5-dimercapto-1,3,4-thiadiazole) as a Cathode for Rechargeable Lithium Batteries with Dramatically Improved Performance

    KAUST Repository

    Gao, Jie

    2012-05-29

    Organosulfur compounds with multiple thiol groups are promising for high gravimetric energy density electrochemical energy storage. We have synthesized a poly(2,5-dimercapto-1,3,4-thiadiazole) (PDMcT)/poly(3,4-ethylenedioxythiophene) (PEDOT) composite cathode for lithium-ion batteries with a new method and investigated its electrochemical behavior by charge/discharge cycles and cyclic voltammetry (CV) in an ether-based electrolyte. Based on a comparison of the electrochemical performance with a carbonate-based electrolyte, we found a much higher discharge capacity, but also a very attractive cycling performance of PDMcT by using a tetra(ethylene glycol) dimethyl ether (TEGDME)-based electrolyte. The first discharge capacity of the as-synthesized PDMcT/PEDOT composite approached 210 mAh g -1 in the TEGDME-based electrolyte. CV results clearly show that the redox reactions of PDMcT are highly reversible in this TEGDME-based electrolyte. The reversible capacity remained around 120 mAh g -1 after 20 charge/discharge cycles. With improved cycling performance and very low cost, PDMcT could become a very promising cathode material when combined with a TEGDME-based electrolyte. The poor capacity in the carbonate-based electrolyte is a consequence of the irreversible reaction of the DMcT monomer and dimer with the solvent, emphasizing the importance of electrolyte chemistry when studying molecular-based battery materials. The nature of the electrolyte has a dramatic effect on the performance of poly(2,5-dimercapto-1,3,4-thiadiazole) (PDMcT) as a cathode material in lithium-ion batteries. Whereas the use of an ethylene/diethyl carbonate (EC/DEC)-based electrolyte resulted in very poor performance, the use of a tetra(ethylene glycol) dimethyl ether (TEGDME)-based electrolyte dramatically improved the performance in terms of both the discharge capacity and capacity retention (see scheme). Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Effects of direct-fed Bacillus pumilus 8G-134 on feed intake, milk yield, milk composition, feed conversion, and health condition of pre- and postpartum Holstein cows.

    Science.gov (United States)

    Luan, S; Duersteler, M; Galbraith, E A; Cardoso, F C

    2015-09-01

    The usage of direct-fed microbials (DFM) has become common in the dairy industry, but questions regarding choice of strain, mode of action, and efficacy remain prevalent. The objective of this study was to evaluate the effects of a DFM (Bacillus pumilus 8G-134) on pre- and postpartum performance and incidence of subclinical ketosis in early lactation. Forty-three multiparous Holstein cows were assigned to 2 treatments in a randomized complete block design; cows in the direct-fed microbial treatment (DFMt, n=21) received 5.0×10(9) cfu/cow of B. pumilus in 28 g of a maltodextrin carrier, whereas cows in the control treatment (CON, n=22) received 28 g of maltodextrin carrier alone. Treatments were top-dressed on the total mixed ration daily. Treatments were applied from 21 d before expected calving date to 154 d after calving. Cows on treatment DFMt tended to have lower serum haptoglobin concentration than CON cows on d 14. Cows on treatment DFMt had higher IgA concentrations in milk than CON cows during the first week after calving. Cows fed DFMt had higher yields of milk, fat-corrected milk, energy-corrected milk, milk fat, and milk protein during the second week of lactation than CON; however, we found no differences between treatments on milk yield and milk components overall. Cows on DFMt tended to have higher feed conversion and to have lower prevalence of subclinical ketosis (beta-hydroxybutyrate >1.2 mmol/L) on d 5 than cows fed CON. Dry matter intake, body weight, and body condition score were not affected by DFMt supplementation. Milk production efficiencies (calculated based on fat-corrected milk and energy-corrected milk) were higher by 0.1 kg of milk per kilogram of dry matter intake in cows that received DFMt compared with cows that received CON. In conclusion, cows receiving DFMt tended to have lower incidence of subclinical ketosis than cows receiving CON. Cows fed DFMt tended to have higher feed conversion and evidence for greater immunity than CON

  14. Facile Synthesis, Characterization of Poly-2-mercapto-1,3,4-thiadiazole Nanoparticles for Rapid Removal of Mercury and Silver Ions from Aqueous Solutions

    Directory of Open Access Journals (Sweden)

    Shaojun Huang

    2018-02-01

    Full Text Available Industrial pollution by heavy metal ions such as Hg2+ and Ag+ is a universal problem owing to the toxicity of heavy metals. In this study, a novel nano-adsorbent, i.e., poly-2-mercapto-1,3,4-thiadiazole (PTT, was synthesized and used to selectively adsorb mercury and silver ions from aqueous solutions. PTT nanoparticles were synthesized via chemical oxidative dehydrogenation polymerization under mild conditions. Oxidant species, medium, monomer concentration, oxidant/monomer molar ratio, and polymerization temperature were optimized to obtain optimum yields. The molecular structure and morphology of the nanoparticles were analyzed by ultraviolet-visible (UV-Vis, Fourier transform infrared (FT-IR, matrix-assisted laser desorption/ionization/time-of-flight (MALDI/TOF mass and X-ray photoelectron (XPS spectroscopies, wide-angle X-ray diffraction (WAXD, theoretical calculations and transmission electron microscopy (TEM, respectively. It was found that the polymerization of 2-mercapto-1,3,4-thiodiazole occurs through head-to-tail coupling between the S(2 and C(5 positions. The PTT nanoparticles having a peculiar synergic combination of four kinds of active groups, S–, –SH, N–N, and =N– with a small particle size of 30–200 nm exhibit ultrarapid initial adsorption rates of 1500 mg(Hg·g−1·h−1 and 5364 mg(Ag·g−1·h−1 and high adsorption capacities of up to 186.9 mg(Hg·g−1 and 193.1 mg(Ag·g−1, becoming ultrafast chelate nanosorbents with high adsorption capacities. Kinetic study indicates that the adsorption of Hg2+ and Ag+ follows the pseudo-second-order model, suggesting a chemical adsorption as the rate-limiting step during the adsorption process. The Hg2+ and Ag+-loaded PTT nanoparticles could be effectively regenerated with 0.1 mol·L−1 EDTA or 1 mol·L−1 HNO3 without significantly losing their adsorption capacities even after five adsorption–desorption cycles. With these impressive properties, PTT nanoparticles are

  15. TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells

    DEFF Research Database (Denmark)

    Reichwald, Kirsten; Jørgensen, Tina Z.; Skov, Søren

    2014-01-01

    together with IL-12, IL-15 and IL-18 increases expression of the co-stimulatory molecules CD154 (CD40 ligand) and CD134 (OX40) on previously activated CD4+ T cells. This indicates that TL1A functions as a co-stimulatory molecule, decreasing the activation threshold of T-cells. We have previously shown...

  16. CERN celebrated the first year in space for the Alpha Magnetic Spectrometer (AMS) with a visit from the crew of the shuttle mission, STS-134, who successfully delivered AMS to the International Space Station (ISS) last year.

    CERN Multimedia

    Laurent Egli

    2012-01-01

    During the celebrations at CERN, the astronauts unveiled a commemorative plaque on the lawn outside the POCC to mark the occasion and later gave a public lecture at CERN. Picture 28 : STS-134 astronauts (left to right) Andrew Feustel, Gregory Chamitoff, Gregory Johnson, Michael Fincke and Mark Kelly in the AMS Payload Operations Centre at CERN.

  17. Human safety and pharmacokinetics of the CFC alternative propellants HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3,3-heptafluoropropane) following whole-body exposure

    NARCIS (Netherlands)

    Emmen, H.H.; Hoogendijk, E.M.G.; Klöpping-Ketelaars, W.A.A.; Muijser, H.; Duistermaat, E.; Ravensberg, J.C.; Alexander, D.J.; Borkhataria, D.; Rusch, G.M.; Schmit, B.

    2000-01-01

    HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3,3-heptafluoropropane) are used to replace chlorofluorocarbons (CFCs) in refrigerant and aerosol applications, including medical use in metered-dose inhalers. Production and consumption of CFCs are being phased out under the Montreal

  18. On-road performance analysis of R134a/R600a/R290 refrigerant mixture in an automobile air-conditioning system with mineral oil as lubricant

    Energy Technology Data Exchange (ETDEWEB)

    Ravikumar, T.S.; Mohan Lal, D. [Department of Mechanical Engineering, College of Engineering, Anna University, Chennai 600 025 (India)

    2009-08-15

    R134a has been accepted as the single major refrigerant in the automobile industry and it has been used worldwide. But, the problem associated with it is the use of the PAG oil as the lubricant. Unlike the conventional mineral oil, the synthetic PAG oil used with R134a is highly hygroscopic in nature. The PAG lubricants come with different additives unique for different compressors. This leads to serious service issues. Therefore, a refrigerant, which will be readily available to replace R12, and also compatible with mineral oil, is needed. In the present study the readily available R134a is used in place of R12. However, to avoid PAG oil and to use the conventional mineral oil as lubricant, R134a is mixed with the commercially available hydrocarbon blend, (45.2% R290 and 56.8% R600a) in the proportion of 91% and 9%, respectively by mass. The quantity of hydrocarbons used is well below the lower flammable limit. This new mixture R134a/R600a/R290 is tested in the air-conditioning system of a passenger car 'on road' in the true running conditions and compared with the results that has been obtained with R12. The cool down performance under varying speed and varying ambient conditions, system performance under severe accelerating conditions and bumper-to-bumper traffic conditions is studied. The test results show that the new blend can be a promising substitute for the existing R12 systems and it can eliminate the use of hygroscopic PAG oil. (author)

  19. Synthesis, characterization, quantum chemical calculations and evaluation of antioxidant properties of 1,3,4-thiadiazole derivatives including 2- and 3-methoxy cinnamic acids

    Science.gov (United States)

    Gür, Mahmut; Muğlu, Halit; Çavuş, M. Serdar; Güder, Aytaç; Sayıner, Hakan S.; Kandemirli, Fatma

    2017-04-01

    A series of 1,3,4-thiadiazole derivatives including 2- and 3-methoxy cinnamic acids were synthesized, and their structures were elucidated by the UV, IR, 1H NMR, 13C NMR spectroscopies and elemental analysis. The UV and IR calculations of the molecules were performed by using B3LYP, HF and MP2 methods with selected 6-311++G(2d,2p), 6-311++G(3df,3pd) and cc-pvtz basis sets. Dipole moment, polarizability, chemical hardness/softness and electronegativity were also calculated and analyzed. Experimental FT-IR spectra and UV-Vis spectrum of the compounds were compared with theoretical data. Furthermore, antioxidant activities of the compounds were practised via different test methods such as 2,2-diphenyl-1-picryl-hydrazyl (DPPHrad), N,N-dimethyl-p-phenylenediamine (DMPDrad +), and 2,2‧-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid) (ABTSrad +) scavenging activity assays. When compared with standards (BHA-Butylated hydroxyanisole, RUT-Rutin, and TRO-Trolox), it was observed that especially XIII and XIV which include methoxy groups at the o- and m-positions, respectively, had effective activities.

  20. Photochemical stability and photostabilizing efficiency of poly(methyl methacrylate based on 2-thioacetic acid-5-phenyl-1,3,4-oxadiazole complexes

    Directory of Open Access Journals (Sweden)

    Emad Yousif

    2016-09-01

    Full Text Available The photostabilization of poly(methyl methacrylate (PMMA films by new types of 2-thioacetic acid-5-phenyl-1,3,4-oxadiazole with Sn(II, Ni(II, Zn(II, and Cu(II complexes was investigated. The PMMA films containing concentration of complexes 0.5% by weight were produced by the casting method from chloroform solvent. The photostabilization activities of these compounds were determined by monitoring the hydroxyl index with irradiation time. The changes in viscosity average molecular weight of PMMA with irradiation time were also tracked (using benzene as a solvent. The quantum yield of the chain scission (Φcs of these complexes in PMMA films was evaluated and found to range between 5.22 × 10−5 and 7.75 × 10−5. Results obtained showed that the rate of photostabilization of PMMA in the presence of the additive followed the trend: Ni(L2>Ni(L2>Zn(L2>Sn(L2 According to the experimental results obtained, several mechanisms were suggested depending on the structure of the additive. Among them, UV absorption, peroxide decomposer and radical scavenger for photostabilizer mechanisms were suggested.