WorldWideScience

Sample records for samarium 132

  1. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  2. Particle-Size-Induced Valence Changes in Samarium Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Mason, M. G.; Lee, S. -T.; Apai, G.; Davis, R. F.; Shirley, D. A.; Franciosi, A.; Weaver, J. H.

    1981-09-01

    Samarium clusters exhibit mixed-valence behavior which is sensitive to particle size. XPS and UPS data show samarium to be primarily divalent (4f{sup 6} ) at small particle size. The trivalent state (4f{sup 5} ) becomes progressively more abundant with increasing s1ze, becoming the dominant state for the bulk metal. These results are interpreted using a model in which band narrowing, due to reduced surface coordination, is more dominant than surface tension effects in establishing the valence of small samarium clusters.

  3. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  4. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel

    Energy Technology Data Exchange (ETDEWEB)

    Villarim Neto, Arthur; Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Rego, Amalia Cinthia Meneses [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Postgraduate Program in Health Sciences; Azevedo, Italo Medeiros; Medeiros, Aldo Cunha [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. of Surgery; Bernardo-Filho, Mario [State University of Rio de Janeiro, RJ (Brazil). Dept. of Biophysics and Biometry

    2009-01-15

    Purpose: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. Methods: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium) group received docetaxel (15 mg/kg) intraperitoneally in two cycles 11 days apart. The S (samarium/control) group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1 ml of samarium-153-EDTMP via orbital plexus (25 {mu} Ci. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI / g) was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland). Results: On the ninth day after the administration of the second chemotherapy cycle, the rats had a significant weight loss (314.50 +- 22.09 g) compared (p<0.5) to pre-treatment weight (353.66 {+-} 22.8). The % ATI/g in the samples of rats treated with samarium-153-EDTMP had a significant reduction in the right femur, left femur, kidney, liver and lungs of animals treated with docetaxel, compared to the control rats. Conclusion: The combination of docetaxel and samarium-153-EDTMP was associated with a lower response rate in the biodistribution of the radiopharmaceutical to targeted tissues. Further investigation into the impact of docetaxel on biodistribution of samarium-153-EDTMP would complement the findings of this study. (author)

  5. The Basis for Developing Samarium AMS for Fuel Cycle Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Buchholz, B A; Biegalski, S R; Whitney, S M; Tumey, S J; Weaver, C J

    2008-10-13

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of {sup 146}Sm, {sup 149}Sm, and {sup 151}Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  6. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    Optical characteristics of transparent samarium oxide thin films deposited by the radio-frequency sputtering technique. A A ATTA M M EL-NAHASS KHALED M ELSABAWY M M ABD EL-RAHEEM A M HASSANIEN A ALHUTHALI ALI BADAWI AMAR MERAZGA. Regular Volume 87 Issue 5 November 2016 Article ID 72 ...

  7. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3() ZnO(40-)V2O5(60) (where = 0.1–0.5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been calculated.

  8. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Optical properties of samarium doped zinc–tellurite glasses. B ERAIAH. Department of Physics, Karnatak University, Dharwad 580 003, India. Present address: Department of Physics, Bangalore University, Bangalore 560 056, India. MS received 20 March 2006; revised 13 June 2006. Abstract. Glasses with the composition, ...

  9. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: Syntheses, crystal structures, thermal analysis and luminescence study. MUHAMMAD IDIRIS SALEH, MIN YEE CHOO, TAI WEI CHAN and MOHD R RAZALI. ∗. School of Chemical Sciences, Universiti Sains Malaysia, Penang, ...

  10. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 127; Issue 12. Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: ... Muhammad Idiris Saleh1 Min Yee Choo1 Tai Wei Chan1 Mohd R Razali1. School of Chemical Sciences, Universiti Sains Malaysia, Penang, Malaysia ...

  11. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Mechanism of the electrochemical deposition of samarium-based coatings

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, Edgar J. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Ortega-Borges, Raul [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Godinez, Luis A. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Chapman, Thomas W. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Meas-Vong, Yunny [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico)]. E-mail: yunnymeas@cideteq.mx

    2006-11-12

    Samarium-based films have been shown to form from aqueous solutions on the surfaces of metallic substrates such as steel or aluminum, and their presence has been reported to decrease substantially the corresponding corrosion rate of the underlying metallic substrate. Based on previous reports on the deposition of oxides or hydroxides of the closely related element cerium, this work demonstrates that samarium films are formed following a similar mechanism, which involves as the fundamental step an increase in interfacial pH resulting from cathodic oxygen-reduction or hydrogen-evolution reactions. With cyclic voltammetry (CV), electrochemical quartz-crystal microbalance (EQCM) measurements, rotating-disk electrode (RDE) tests, and surface characterization techniques, namely, scanning electron microscopy (SEM) and X-ray surface microanalysis (EDX), the postulated mechanism was verified, and the surface morphology of the resulting films was correlated with the nature of the reduction reaction that triggers film formation.

  13. Samarium Monosulfide (SmS): Reviewing Properties and Applications

    OpenAIRE

    Sousanis, Andreas; Smet, Philippe; Poelman, Dirk

    2017-01-01

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducti...

  14. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  15. Synthesis of nano-pore samarium (III)-imprinted polymer for preconcentrative separation of samarium ions from other lanthanide ions via solid phase extraction

    Energy Technology Data Exchange (ETDEWEB)

    Shirvani-Arani, Simindokht [Center of Excellence in Electrochemistry, Department of Chemistry, University of Tehran, P.O.Box:14155-6455, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ahmadi, Seyed Javad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)], E-mail: sjahmadi@aeoi.org.ir; Bahrami-Samani, Ali [Nuclear Engineering and Physics Department, Amir Kabir University, P.O.Box: 15875-4413, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ghannadi-Maragheh, Mohammad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)

    2008-08-08

    A batch process was developed to separate samarium ions from some lanthanide ions by a novel solid phase which was prepared via the ion-imprinting technique. The samarium (III) ion-imprinted polymer (IIP) particles were synthesized by preparing the ternary complex of samarium ions with 5,7-dichloroquinoline-8-ol (DCQ) and 4-vinylpyridine (VP). Then, thermally copolymerization with styrene (functional monomer, STY) and divinylbenzene (cross-linking monomer, DVB) followed in the presence of 2-methoxy ethanol (porogen) and 2,2'-azobisisobutyronitrile (initiator, AIBN). The imprinted ion was removed by stirring the above particles with 50% (v/v) HCl to obtain the leached IIP particles. Moreover, control polymer (CP) particles were similarly prepared without the samarium ions. The unleached and leached IIP particles were characterized by X-ray diffraction (XRD), infra-red spectroscopy (IR), thermo gravimetric analysis (TGA) and scanning electron microscopy (SEM). Finally, preconcentration and selectivity studies for samarium and the other lanthanide ions were carried out. The preconcentration of the samarium (III) traces was studied during rebinding with the leached IIP particles as a function of pH, the weight of the polymer material, the preconcentration and the elution times, the eluent volume and the aqueous phase volume. These studies indicated that the samarium (III) amount as low as 1 {mu}g, present in 200 mL, could be preconcentrated into 25 mL of 1.0 M HCl.

  16. Ionization of Samarium by Chemical Releases in the Upper Atmosphere

    Science.gov (United States)

    Siefring, C. L.; Bernhardt, P. A.; Holmes, J. M.; Pedersen, T. R.; Caton, R.; Miller, D.; Groves, K. M.

    2014-12-01

    The release of Samarium vapor into the upper atmosphere was studied using during the Air Force Research Laboratory sponsored Metal Oxide Space Cloud (MOSC) rocket launches in May 2009. The Naval Research Laboratory supported these experiments with 3-D photochemical modeling of the artificial plasma cloud including (1) reactions with atomic oxygen, (2) photo excitation, (3) photoionization, (4) dissociative recombination, and (5) ion and neutral diffusion. NRL provided the experimental diagnostic instrument on the rocket which was a dual frequency radio beacon on the rocket to measure changes in total electron content. The AFRL provided ground based diagnostics of incoherent scatter radar and optical spectroscopy and imagery. The NRL Chemical Release Model (CRM) has over 600 excited states of atomic Samarium neutrals, atomic ions, along with Samarium Oxide Ions and electrons. Diffusive transport of neutrals in cylindrical geometry and ions along magnetic field lines is computed along with the reactive flow to predict the concentrations of Sm, Sm-Ion, Sm0, and SmO Ion. Comparison of the CRM with observations demonstrates that Sm release into the upper atmosphere initially produces enhanced electron densities and SmO-Ions. The diatomic ions recombine with electrons to yield neutral Sm and O. Only the photo ionization of Sm yields a stable atomic ion that does not substantially recombine. The MOSC releases in sunlight yielded long duration ion clouds that can be replicated with the CRM. The CRM predicts that Sm releases in darkness would not produce long duration plasma clouds because of the lack of photo excitation and photoionization.

  17. Reactive Materials for Evaporating Samarium (Pre-Print)

    Science.gov (United States)

    2016-04-15

    SUBJECT TERMS energetic materials, heat sources, pyrotechnic charges, easily ionized metals 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF...experiments.    Keywords:  energetic  materials, heat sources, pyrotechnic charges, easily ionized metals  1. Introduction Ejection of clouds of...results  were  negatively  affected  by  reduced  efficiency   of  release  and  ionization of samarium [8]. It is possible that not the entire charge of

  18. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  19. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  20. Luminescent solutions and powders of new samarium complexes with N,N',O,O'-chelating ligands

    Science.gov (United States)

    Kharcheva, Anastasia V.; Nikolskiy, Kirill S.; Borisova, Nataliya E.; Ivanov, Alexey V.; Reshetova, Marina D.; Yuzhakov, Viktor I.; Patsaeva, Svetlana V.

    2016-04-01

    Imaging techniques in biology and medicine are crucial tools to obtain information on structural and functional properties of living cells and organisms. To fulfill the requirements associated with application of these techniques it appears necessary to design markers with specific characteristics. Luminescent complexes of trivalent lanthanide ions with chelating ligands are of increasing importance in biomedical applications because of their millisecond luminescence lifetime, narrow emission band, high signal-to-noise ratio and minimal photodamage to biological samples. In order to extend the available emission wavelength range the luminescent samarium chelates are highly desirable. In this study the ligands with diamides of 2,2'-bipyridin-6,6'-dicarboxylic acid were used to improve photophysical characteristics of samarium complexes. We report the luminescence characteristics of samarium complexes with novel ligands. All complexes exhibited the characteristic emission of Sm (III) ion with the lines at 565, 597, 605, 645 and 654 nm, the intensity strongly depended on the ligand. Absorption and luminescence excitation spectra of Sm (III) complexes showed main peaks in the UV range demonstrating lanthanide coordination to the ligand. The absolute lumenescence quantum yield was measured for solutions in acetonitrile with excitation at 350 nm. The largest luminescence quantum yield was found for the samarium complex Bipy 6MePy Sm (3%) being much higher that for samarium complexes reported in the literature earlier. These results prove as well that samarium chelates are potential markers for multiparametric imaging techniques.

  1. Australian manufacture of Quadramet{sup TM} (Samarium-153 EDTMP)

    Energy Technology Data Exchange (ETDEWEB)

    Wood, N.R.; Whitwell, J. [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). Australian Radioisotopes

    1997-10-01

    Quadramet{sup T} (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200{mu}g/mL whereas the overseas formulation has a level of 20-46{mu}g/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet{sup TM} provides a further option in the management of these difficult cases

  2. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  3. Optical analysis of samarium doped sodium bismuth silicate glass.

    Science.gov (United States)

    Thomas, V; Sofin, R G S; Allen, M; Thomas, H; Biju, P R; Jose, G; Unnikrishnan, N V

    2017-01-15

    Samarium doped sodium bismuth silicate glass was synthesized using the melt quenching method. Detailed optical spectroscopic studies of the glassy material were carried out in the UV-Vis-NIR spectral range. Using the optical absorption spectra Judd-Ofelt (JO) parameters are derived. The calculated values of the JO parameters are utilized in evaluating the various radiative parameters such as electric dipole line strengths (Sed), radiative transition probabilities (Arad), radiative lifetimes (τrad), fluorescence branching ratios (β) and the integrated absorption cross- sections (σa) for stimulated emission from various excited states of Sm3+‡ ion. The principal fluorescence transitions are identified by recording the fluorescence spectrum. Our analysis revealed that the novel glassy system has the optimum values for the key parameters viz. spectroscopic quality factor, optical gain, stimulated emission cross section and quantum efficiency, which are required for a high performance optical amplifier. Calculated chromaticity co-ordinates (0.61, 0.38) also confirm its application potential in display devices. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Samarium Monosulfide (SmS): Reviewing Properties and Applications.

    Science.gov (United States)

    Sousanis, Andreas; Smet, Philippe F; Poelman, Dirk

    2017-08-16

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducting and metallic states could be exploited in several applications, such as high density optical storage and memory materials, thermovoltaic devices, infrared sensors and more. We discuss the electronic, optical and magnetic properties of SmS, its switching behavior, as well as the thin film deposition techniques which have been used, such as e-beam evaporation and sputtering. Moreover, applications and possible ideas for future work on this material are presented. Our scope is to present the properties of SmS, which were mainly measured in bulk crystals, while at the same time we describe the possible deposition methods that will push the study of SmS to nanoscale dimensions, opening an intriguing range of applications for low-dimensional, pressure-induced semiconductor-metal transition compounds.

  5. Excitation induced spectroscopic study and quenching effect in cerium samarium codoped lithium aluminoborate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Parvinder; Kaur, Simranpreet [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, Gurinder Pal [Department of Physics, Khalsa College, Amritsar 143002 (India); Arora, Deepawali; Kumar, Sunil [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, D.P., E-mail: dpsinghdr@yahoo.com [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India)

    2016-08-15

    Lithium aluminium borate host has been codoped with cerium and samarium to prepare glass by conventional melt quench technique. Their structural and spectroscopic investigation has been carried out using XRD, FTIR and density measurements. The UV‐Vis absorption spectra and fluorescence spectra (λ{sub exc}.=380 nm and 400 nm) have been studied for spectroscopic analysis. The amorphous nature of the prepared samples is shown by XRD. The density is increasing with addition of cerium at the expense of aluminium, keeping other components constant. FTIR study also shows the presence of compact and stable tetrahedral BO{sub 4} units thus supporting the density results. The UV‐ Vis absorption spectra show a shift of optical absorption edge towards longer wavelength along with an increase in intensity of peaks with rising samarium concentration. The fluorescence spectra show a blue shift and subsequent suppression of cerium peaks with addition of samarium.

  6. Effect of samarium doping on the dielectric behavior of barium zircomium titanate ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Badapanda, T., E-mail: badapanda.tanmaya@gmail.com [Department of Physics, C.V. Raman College of Engineering, Bhubaneswar, Odisha-752054 (India); Sarangi, S.; Behera, B. [School of Physics, Sambalpur University, Jyoti Vihar Sambalpur, Odisha-768019 (India); Anwar, S. [Colloids and Materials Chemistry, Institute of Minerals and Materials Technology, Bhubaneswar, Odisha-751013 (India); Sinha, T. P. [Department of Physics, Bose Institute, Kolkata-700009 (India)

    2014-04-24

    Samarium doped Barium Zirconium Titanate ceramic with general formula Ba{sub 1−x}Sm{sub 2x/3}Zr{sub 0.05}Ti{sub 0.95}O{sub 3} [x=0.0,0.01,0.02,0.03,0.04] has been prepared by high energy ball milling. The X-ray diffraction (XRD) patterns confirmed that these ceramics have a single phase with perovskite-type upto x≤0.03 and a small secondary phase exist at x=0.04. The temperature dependent dielectric study shows a ferroelectric phase transition and transition temperature decreases with an increase in the Samarium content.

  7. Lithium Bromide/Water as Additives in Dearomatizing Samarium-Ketyl (Hetero)Arene Cyclizations.

    Science.gov (United States)

    Rao, Chintada Nageswara; Bentz, Christoph; Reissig, Hans-Ulrich

    2015-11-02

    New conditions for dearomatizing samarium-ketyl (hetero)arene cyclizations are reported. In many examples of these samarium diiodide-mediated reactions, lithium bromide and water can be used as additives instead of the carcinogenic and mutagenic hexamethylphosphoramide (HMPA). The best results were obtained for the cyclizations of N-acylated indole derivatives delivering the expected indolines in good yields and excellent diastereoselectivities. A new type of cyclization delivering indolyl-substituted allene derivatives is also described. The scope and limitations of the lithium bromide/water system are discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    The samarium-doped ceria (SDC) nanospheres were prepared by the one-step hydrothermal method and characterized by transmission electron microscope, scanning electron microscope, powder X-ray diffraction, X-ray photoelectron spectroscopy, energy-dispersive spectrometer and Raman spectra. According to the ...

  9. A spectroscopic comparison of samarium-doped LiYF4 and KY3F10

    NARCIS (Netherlands)

    Wells, J. P. R.; Sugiyama, A.; Han, T. P. J.; Gallagher, H. G.

    2000-01-01

    Laser selective excitation and fluorescence has been performed on LiYF4 and KY3F10 doped with samarium ions. In LiYF4, a single, tetragonal symmetry center associated with isovalent substitution of Sm3+ with lattice yttrium ions is present. By contrast, three Sm2+ centres and a single, tetragonal

  10. 7 CFR 946.132 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Reports. 946.132 Section 946.132 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements..., destination, and name and address of receiver. ...

  11. 46 CFR 132.210 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Classification. 132.210 Section 132.210 Shipping COAST... Portable and Semiportable Fire Extinguishers § 132.210 Classification. (a) Each portable fire extinguisher... Classification Type Size Halon 1211, 1301, and 1211-1301 mixtures kgs. (lbs.) Foam, liters (gallons) Carbon...

  12. 28 CFR 35.132 - Smoking.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Smoking. 35.132 Section 35.132 Judicial... SERVICES General Requirements § 35.132 Smoking. This part does not preclude the prohibition of, or the imposition of restrictions on, smoking in transportation covered by this part. ...

  13. 7 CFR 1955.132 - Pilot projects.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Pilot projects. 1955.132 Section 1955.132 Agriculture... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property General § 1955.132 Pilot projects. FmHA or its successor agency under Public Law 103-354 may conduct pilot projects to test policies and...

  14. 40 CFR 132.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 132.2 Section 132.2... FOR THE GREAT LAKES SYSTEM § 132.2 Definitions. The following definitions apply in this part. Terms... lipid) of a substance's lipid-normalized concentration in tissue of an aquatic organism to its organic...

  15. The Use of a Flexible Calix[4]arene Template to Stabilize a Cyclooctatetraindiyl Samarium-Potassium Complex

    Directory of Open Access Journals (Sweden)

    Geoffroy Guillemot

    2013-01-01

    Full Text Available A sandwich compound of cyclooctatetraendiyl (COT2− samarium-potassium was synthesized and analyzed using a flexible calix[4]arene dianion. This compound, [p-tBu-calix[4]-(OMe2(O2]arenediyl-samarium-(η8-cyclooctatetraendiyl-potassium (tetrahydrofurane3, is constructed as a linear sequence L-Sm--K-, where L, , and are specific ligands with L = O,O-dimethyl-calix[4]arene2−, = cyclo-octatetraendiyl, and = tetrahydrofurane templates.

  16. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  17. Samarium(II) iodide-mediated reductive annulations of ketones bearing a distal vinyl epoxide moiety

    Energy Technology Data Exchange (ETDEWEB)

    Molander, G.A.; Shakya, S.R. [Univ. of Colorado, Boulder, CO (United States)

    1996-08-23

    It was found that samarium (II) iodide promotes the intramolecular coupling of ketones with distal epoxy olefins while in the presence of hexamethylphosphoramide (HPMA). A number of epoxide compounds (1 a-k) fragment to form carbocycles with allylic alcohol side chains with high diastereoselectivity (2 a-k). Substituting tetramethylguanidine for HPMA reduces the diastereoselectivity. Adding Pd(0) as a catalyst reverses the diastereoselective sense. 40 refs., 1 tab.

  18. A temporal three-dimensional simulation of samarium release in the ionosphere

    Science.gov (United States)

    Zhao, Hai-Sheng; Feng, Jie; Xu, Zheng-Wen; Wu, Jian; Wu, Zhen-Sen; Xu, Bin; Xue, Kun; Xu, Tong; Hu, Yan-Li

    2016-10-01

    For understanding plasma processes of the ionosphere and magnetosphere, the alkali and alkaline-earth metals are usually released in space for artificially increasing the electron density. However, it is a limitation that these releases must be in sunlight where the photoionization can take place. In recent years, the lanthanide metals, such as samarium, have been released to produce electrons in reaction with atomic oxygen in the upper space. The reaction could proceed without sunlight so that the restriction on experimental periods is broken. Unfortunately, any sophisticated models even preliminary ones are unavailable yet in the literature. A temporal three-dimensional model is presented for the samarium release in detail with respect to various altitudes and mass. Especially, the plasma diffusion equation is remarkably extended from 2-D to 3-D by importing the influence of geomagnetic declination, which could be also useful for other chemical releases. The field-aligned terms are brought so as to the presented model can describe the diffusion along the geomagnetic field subtly. On the basis of the presented model, behaviors of radio waves propagating through the release area are simulated by using ray tracing. This model could be as the theoretical support for samarium releases, and it also helpful for the research on the generation and evolution of the ionosphere irregularities.

  19. Liquid–liquid anion exchange extraction studies of samarium(III from salicylate media using high molecular weight amine

    Directory of Open Access Journals (Sweden)

    Aniruddha M. Mandhare

    2015-07-01

    Full Text Available Liquid–liquid extraction and separation of samarium(III were carried out by using 0.025 mol dm−3 2-octylaminopyridine(2-OAP in xylene at 298 K. The extraction behavior of samarium was studied as a function of pH, weak acid concentration, extractant concentration, diluent, and equilibration time. Samarium was quantitatively extracted at pH 7.5 to 10.0 from 0.01 mol dm−3 sodium salicylate solution with 0.025 mol dm−3 2-OAP. The possible composition of the extracted species in organic phase has been determined by using model of slope analysis method and extraction mechanism was found to proceed via an anion exchange mechanism. The stripping efficiency was found to be quantitative in HNO3, HCl and CH3COOH. The robustness of the procedure was demonstrated by the average recoveries obtained (>99.6% for samarium(III extraction in the presence of several cations and anions which are commonly associated with it. The proposed method facilitates the separation and determination of samarium(III from binary and synthetic mixtures. The various thermodynamic functions like free energy (ΔG, enthalpy (ΔH and entropy (ΔS of extraction mechanism were discussed.

  20. 21 CFR 146.132 - Grapefruit juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Grapefruit juice. 146.132 Section 146.132 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... be added not more than 10 percent by volume of the unfermented juice obtained from mature hybrids of...

  1. 46 CFR 67.132 - Special legislation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Special legislation. 67.132 Section 67.132 Shipping... legislation. (a) Vessels not otherwise entitled to be operated in the coastwise trade or in the fisheries may obtain these privileges as a result of special legislation by the Congress of the United States. (b) In...

  2. 27 CFR 21.132 - Toluene.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Toluene. 21.132 Section 21... TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21.132 Toluene. (a..., Standard No. D 362-75 for industrial grade toluene; for incorporation by reference, see § 21.6(b).) When...

  3. 41 CFR 105-71.132 - Equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Equipment. 105-71.132...-Award Requirements/Changes, Property, and Subawards § 105-71.132 Equipment. (a) Title. Subject to the obligations and conditions set forth in this section, title to equipment acquired under a grant or subgrant...

  4. 31 CFR 132.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 132.2 Section 132.2 Money and Finance: Treasury Regulations Relating to Money and Finance PROHIBITION ON FUNDING OF UNLAWFUL... over-the-counter derivative instrument; (iv) Any other transaction that— (A) Is excluded or exempt from...

  5. Dicty_cDB: VHP132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP132 (Link to dictyBase) - - - Contig-U16260-1 VHP132P (Link to Original site) VHP...132F 548 VHP132Z 636 VHP132P 1164 - - Show VHP132 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-B/VHP132Q.Seq.d/ Representative seq. ID VHP...132P (Link to Original site) Representative DNA sequence >VHP132 (VHP132Q) /CSM/VH/VHP1-B/VHP...tslirqqsrsflixtpik-- - ---rr*rcqsprqchqrcsife*n*rffrwcfpmghqrrccl**kherypfqsl*chpph *chpqrwwsnhpncssctlcc*in

  6. Piomiositis Informe de 132 pacientes

    Directory of Open Access Journals (Sweden)

    S. Campbell

    1994-06-01

    Full Text Available Fundamento. La infección bacteriana del músculo estriado, acompañado por la formación de abscesos, es una situación excepcional. Evaluamos las características clínicas de la piomiositis a fin de favorecer un diagnóstico y tratamiento más tempranas. Métodos. Se estudiaron 132 pacientes afectados de piomiositis, aiendidosen los últimos 9 años. Los criterios de inclusión fueron: 1 clínica compatible; 2 demostración de un absceso mediante punción o drenaje; 3 evidencia de dolor muscular local acompañado o no de tumefacción o masa y cuya respuesta clínica favorable se deba única y exclusivamente a la oxacilina, así no se haya practicado punción o drenaje. Resultados. La edad media de los pacientes estudiados fue de 21,5 años (rango: 15 meses a 68 años. Se produjo la enfermedad en 88 varones (66,6%. El tiempo de evolución clínica previo a la consulta osciló entre 2 y 94 días, para un promedio de 11,6. La fiebre fue el síntoma predominante (98,4% mientras que la presencia de masa o tumefacción fue el signo más notorio (97,7%. El dolor se encontró en el (96,9% de los casos. El antecedente traumático aparece en 25 pacientes (18,9% y el de piodermitis en 64 (48,4%. Los músculos más afectados fueron los de los miembros inferiores (47% y, en su orden: muslos, pantorrillas y glúteos. Aunque el absceso agudo fue la forma de presentación clínica más frecuente (82,5%, se encontró que no todas las lesiones evolucionan abscesos y se identificó una forma más de presentación en tres pacientes (2,3%: el dolor muscular localizado, sin masa ni tumefacción, acompañado de fiebre. La masa dura sin absceso (10,7% y la forma blanda con supuración (4,5% fueron las otras maneras de manifestarse la enfermedad. Ctaphylococcus aureus coagulasa (+ fue el germen más frecuentemente aislado en el sitio de las lesiones (96,7%, seguido por Staphylococcus epidermidis (2,2% y Pseudomonas aeruginosa (1,1%. Las complicaciones observadas

  7. Samarium(II) iodide-mediated intramolecular conjugate additions of alpha,beta-unsaturated lactones.

    Science.gov (United States)

    Molander, Gary A; St Jean, David J

    2002-05-31

    Samarium(II) iodide, in the presence of catalytic amounts of nickel(II) iodide, has been used to promote intramolecular conjugate additions of alkyl halides onto alpha,beta-unsaturated lactones. This process has been shown to be applicable to a number of alpha,beta-unsaturated lactones, including tetrasubstituted olefins, and has been demonstrated to be quite general for the formation of saturated bicyclic and tricyclic lactones. The method presented herein provides a mild, efficient process to form structurally complex lactones from simple precursors.

  8. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  9. X-Band Microwave Reflection Properties of Samarium/Bismuth-Substituted Barium Lanthanum Titanate Ceramics

    Science.gov (United States)

    Bahel, Shalini; Pubby, Kunal; Narang, Sukhleen Bindra

    2017-03-01

    Samarium/bismuth-substituted barium lanthanum titanate ceramics with chemical composition Ba4 (La_{1 - y - z} Smy Biz )_{9.33} Ti_{18} O_{54} ( y = 0.5, 0.7; z = 0.05, 0.10, 0.15), intended as microwave reflecting materials, have been investigated in microwave X-band (8.2 GHz to 12.4 GHz) and the effect of substitution on their dielectric properties, i.e., dielectric constant and dielectric loss tangent, has been studied by vector network analyzer. Dielectric analysis showed that the dielectric constant increased with increasing samarium as well as bismuth content. Dielectric relaxation was observed for all samples in the scanned frequency range. Microwave reflection and transmission analysis of ceramic pellets of thickness 4 mm was carried out using two methods, i.e., open- and short-circuit approach, both indicating very high values of reflected power and very low values of transmitted power for all the doped materials in comparison with the base composition. The doped compositions are therefore potential microwave shielding materials for use in anechoic chambers, microwave laboratories, and radar equipment. Double-layer reflectors are also proposed, having better reflection properties (˜99% reflection) compared with single-layer reflectors.

  10. Microstructure and hysteresis curves of samarium-holmium-iron garnet synthesized by coprecipitation

    Directory of Open Access Journals (Sweden)

    Caffarena Valeska da Rocha

    2003-01-01

    Full Text Available An investigation was made into the synthesis and magnetic properties of Sm(3-xHo xFe5O12 (samarium-holmium-iron garnet ferrite, as yet absent from the literature. The material in question was synthesized by co-precipitation, starting from hydrated chlorides of rare-earth elements and ferrous sulfate, and the mixed hydroxide co-precipitate was calcined at 1000 °C. Using PVA as a binder, rectangular cross section-shaped compacts were produced by means of steel-die pressing, drying and sintering from 1200 to 1450 °C. The main conclusions of this study were that the coercive force decreases as the sintering temperature increases, and that the effect of substituting holmium for samarium in SmIG is entirely different from that provided by replacing yttrium by gadolinium in YIG, which is the most important result of this work. An in-depth investigation will be necessary to determine the correlation between microstructure/magnetic properties and ceramic processing variables.

  11. Bone-seeking radiopharmaceuticals as targeted agents of osteosarcoma: samarium-153-EDTMP and radium-223.

    Science.gov (United States)

    Anderson, Peter M; Subbiah, Vivek; Rohren, Eric

    2014-01-01

    Osteosarcoma is a cancer characterized by formation of bone by malignant cells. Routine bone scan imaging with Tc-99m-MDP is done at diagnosis to evaluate primary tumor uptake and check for bone metastases. At time of relapse the Tc-99m-MDP bone scan also provides a specific means to assess formation of bone by malignant osteosarcoma cells and the potential for bone-seeking radiopharmaceuticals to deliver radioactivity directly into osteoblastic osteosarcoma lesions. This chapter will review and compare a bone-seeking radiopharmaceutical that emits beta-particles, samarium-153-EDTMP, with an alpha-particle emitter, radium-223. The charged alpha particles from radium-223 have far more mass and energy than beta particles (electrons) from Sm-153-EDTMP. Because radium-223 has less marrow toxicity and more radiobiological effectiveness, especially if inside the bone forming cancer cell than samarium-153-EDTMP, radium-223 may have greater potential to become widely used against osteosarcoma as a targeted therapy. Radium-223 also has more potential to be used with chemotherapy against osteosarcoma and bone metastases. Because osteosarcoma makes bone and radium-223 acts like calcium, this radiopharmaceutical could possibly become a new targeted means to achieve safe and effective reduction of tumor burden as well as facilitate better surgery and/or radiotherapy for difficult to resect large, or metastatic tumors.

  12. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  13. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  14. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  15. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry in the Region of Samarium, Europium, and Gadolinium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R D; Kelley, K; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of samarium, europium and gadolinium (62 {le} Z {le} 64, 82 {le} N {le} 96).

  16. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  17. Dicty_cDB: SSG132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG132 (Link to dictyBase) - - - Contig-U16048-1 SSG132Z (Link to Original site) -...(Link to library) Clone ID SSG132 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U16048-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSG1-B/SSG132Q.Seq.d/ Representative...Representative seq. ID SSG132Z (Link to Original site) Representative DNA sequence >SSG132 (SSG132Q) /CSM/SS/SSG1-B/SSG132Q...XXXXXXXXXXTAAAGAAATTGAAGCAGGCGATGAAAACGATTTACAAAATGCTTTACTTT TAAATCCAGTCTCAGTTGCTATTGATGCTTCTCATAATAGTTTCCAACTTTACACTGCCG

  18. Effects of the atomic environment on the electron binding energies in samarium

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh., E-mail: inoyatov@jinr.ru [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Institute of Applied Physics, National University, Tashkent, Republic of Uzbekistan (Uzbekistan); Kovalík, A. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Filosofov, D.V. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Ryšavý, M.; Vénos, D. [Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Yushkevich, Yu.V.; Perevoshchikov, L.L. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Zhdanov, V.S. [Nuclear Physics Institute, Almaty, Republic of Kazakhstan (Kazakhstan)

    2016-02-15

    Highlights: • Eight different matrices (evaporated and implanted at 30 keV) used. • The greatest average difference in the binding energies amounted to 3.1 ± 0.1 eV. • The presence of trivalent and divalent Sm ions found in some implanted samples. • No significant differences in Sm natural atomic level widths were observed. - Abstract: Effects of the atomic environment on the L{sub 1}, L{sub 2}, L{sub 3}, M{sub 1}, M{sub 2}, M{sub 3}, and N{sub 1} electron binding energies in samarium generated in the electron capture decay of radioactive {sup 149}Eu were investigated by means of the internal conversion electron spectroscopy using the conversion electron spectrum of the 22.5 keV M1 + E2 nuclear transition in the daughter {sup 149}Sm. In this investigation, four pairs of {sup 149}Eu sources prepared by vacuum evaporation deposition and by ion implantation at 30 keV with the use of four different source backing materials, namely polycrystalline carbon, aluminium, gadolinium and platinum foils, were employed. The greatest average difference of (3.1 ± 0.1) eV in the L{sub 1}, L{sub 2}, L{sub 3}, and M{sub 1} subshell electron binding energies was observed between the {sup 149}Eu sources prepared by ion implantation into the aluminium and platinum substrates. On the other hand, minimal differences in the electron binding energies were generally found between samarium generated in the evaporated layer and in the bulk for the individual investigated source backings with the exception of the gadolinium foil. A doublet structure of all investigated conversion electron lines with the average values of 8.1 ± 0.2 eV and 1.5 ± 0.1 for the separation energy and the intensity ratio of the low-energy to high-energy components, respectively, was observed for the {sup 149}Eu sources prepared by ion implantation into the aluminium and carbon foils. This structure was presumably caused by the presence of both the trivalent and divalent Sm ions in the sources. No

  19. Multiphoton laser wave-mixing absorption spectroscopy for samarium using a graphite furnace atomizer

    Energy Technology Data Exchange (ETDEWEB)

    Maniaci, Michael J.; Tong, William G. E-mail: william.tong@sdsu.edu

    2004-07-30

    Nonlinear laser wave-mixing optical technique is presented as a sensitive atomic spectroscopic method for the analysis of rare earth elements using an unmodified commercially available graphite furnace (GF) atomizer. A simple nonplanar backward-scattering degenerate four-wave mixing optical arrangement offers sub-picogram detection sensitivity with sub-Doppler Lorentzian-broadened resolution. Nonlinear wave mixing is an unusually sensitive absorption-based optical method that offers both excellent detection sensitivity and sub-Doppler spectral resolution. A mass detection limit of 0.7 pg and a concentration detection limit of 70 pg/ml are determined for a rare earth element, samarium, using the 429.7-nm excitation line.

  20. Samarium Doped Cerium Oxide Clusters: a Study on the Modulation of Electronic Structure

    Science.gov (United States)

    Topolski, Josey E.; Kafader, Jared O.; Marrero-Colon, Vicmarie; Chick Jarrold, Caroline

    2017-06-01

    Cerium oxide is known for its use in solid oxide fuel cells due to its high ionic conductivity. The doping of trivalent samarium atoms into cerium oxide is known to enhance the ionic conductivity through the generation of additional oxygen vacancies. This study probes the electronic structure of Sm_{x}Ce_{y}O_{z} (x+y=3, z=2-4) anion and neutral clusters. Anion photoelectron spectra of these mixed metal clusters exhibit additional spectral features not present in the previously studied cerium oxide clusters. Density functional theory calculations have been used to aid interpretation of collected spectra. The results of this work can be used to inform the design of materials used for solid oxide fuel cells.

  1. Chelating Ligand-Mediated Hydrothermal Synthesis of Samarium Orthovanadate with Decavanadate as Vanadium Source

    Directory of Open Access Journals (Sweden)

    Quanguo Li

    2013-01-01

    Full Text Available A new ethylenediaminetetraacetic acid- (EDTA- mediated hydrothermal route to prepare chrysanthemum-shaped samarium orthovanadate (SmVO4 nanocrystals with decavanadate (K6V10O28·9H2O as vanadium source has been developed. The present hydrothermal approach is simple and reproducible and employs a relatively mild reaction temperature. The EDTA, pH value, and temperature of the reaction systems play important roles in determining the morphologies and growth process of the SmVO4 products. The products have been characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, Fourier transform infrared spectroscopy (FT-IR, photoluminescence spectra (PL, and UV-Vis spectroscopy.

  2. The Magnetocaloric Effect and Heat Capacity of Suspensions of High-Dispersity Samarium Ferrite

    Science.gov (United States)

    Korolev, V. V.; Aref'ev, I. M.; Ramazanova, A. G.

    2008-02-01

    The magnetocaloric effect and specific heat capacity of an aqueous suspension of samarium ferrite were determined calorimetrically over the temperature range 288-343 K in magnetic fields of 0-0.7 T. The data obtained were used to calculate changes in the magnetic component of the molar heat capacity and entropy of the magnetic phase and changes in the enthalpy of the process under an applied magnetic field. The magnetocaloric effect was found to increase nonlinearly as the magnetic field induction grew. The corresponding temperature dependences contained a maximum at 313 K related to the second-order magnetic phase transition at the Curie point. The field and temperature dependences of heat capacity contained a maximum in fields of 0.4 T and a minimum at the magnetic phase transition temperature.

  3. 40 CFR 152.132 - Supplemental distribution.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Supplemental distribution. 152.132... Supplemental distribution. The registrant may distribute or sell his registered product under another person's name and address instead of (or in addition to) his own. Such distribution and sale is termed...

  4. 46 CFR 132.220 - Installation.

    Science.gov (United States)

    2010-10-01

    ... Portable and Semiportable Fire Extinguishers § 132.220 Installation. (a) Each portable fire extinguisher approved under subpart 162.028 of this chapter and each semiportable fire extinguisher approved under... placement of each extinguisher must satisfy the cognizant OCMI, who may also deem added extinguishers...

  5. 28 CFR 13.2 - Policy.

    Science.gov (United States)

    2010-07-01

    ... Administration DEPARTMENT OF JUSTICE ATOMIC WEAPONS AND SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.2... involving an illegal diversion, an attempted illegal diversion, or a conspiracy to divert special nuclear material or atomic weapons. The broad scope of this program is to help guard against the loss or diversion...

  6. Preparation of hollow core/shell microspheres of hematite and its adsorption ability for samarium.

    Science.gov (United States)

    Yu, Sheng-Hui; Yao, Qi-Zhi; Zhou, Gen-Tao; Fu, Sheng-Quan

    2014-07-09

    Hollow core/shell hematite microspheres with diameter of ca. 1-2 μm have been successfully achieved by calcining the precursor composite microspheres of pyrite and polyvinylpyrrolidone (PVP) in air. The synthesized products were characterized by a wide range of techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), energy-dispersive X-ray spectroscopy (EDX), transmission electron microscopy (TEM), high-resolution TEM (HRTEM), thermogravimetric analysis (TGA) and differential scanning calorimetry (DSC), and Brunauer-Emmett-Teller (BET) gas sorptometry. Temperature- and time-dependent experiments unveil that the precursor pyrite-PVP composite microspheres finally transform into hollow core/shell hematite microspheres in air through a multistep process including the oxidation and sulfation of pyrite, combustion of PVP occluded in the precursor, desulfation, aggregation, and fusion of nanosized hematite as well as mass transportation from the interior to the exterior of the microspheres. The formation of the hollow core/shell microspheres dominantly depends on the calcination temperature under current experimental conditions, and the aggregation of hematite nanocrystals and the core shrinking during the oxidation of pyrite are responsible for the formation of the hollow structures. Moreover, the adsorption ability of the hematite for Sm(III) was also tested. The results exhibit that the hematite microspheres have good adsorption activity for trivalent samarium, and that its adsorption capacity strongly depends on the pH of the solution, and the maximum adsorption capacity for Sm(III) is 14.48 mg/g at neutral pH. As samarium is a typical member of the lanthanide series, our results suggest that the hollow hematite microspheres have potential application in removal of rare earth elements (REEs) entering the water environment.

  7. The influence of the technological parameters on the ionic conductivity of samarium doped ceria thin films

    Directory of Open Access Journals (Sweden)

    Mantas Sriubas

    2015-03-01

    Full Text Available Sm0,20Ce0,80O2 powder was used for the formation of samarium doped cerium oxide (SDC thin films using e-beam. Surface area of powder was 34.9 m2/g and particle size – 0.3-0.5 μm. Thin films were deposited using physical vapor deposition system on SiO2 and Alloy 600 substrates. 2 Å/s – 16 Å/s growth rate and 20 °C – 600 °C substrate temperature were used during the deposition. Ionic conductivity investigation revealed that the maximum ionic conductivity (1.67 S/m has the thin film deposited on 300 °C temperature substrate using 4 Å/s growth rate. Minimum ionic conductivity (0.26 S/m has thin film which was deposited on 20 °C temperature substrate using 8 Å/s growth rate. Vacancy activation energies vary in 0.87 eV – 0.97 eV range. Furthermore the calculations of crystallite size revealed that crystallite size increases with increasing substrate temperature: from 7.50 nm to 46.23 nm on SiO2 substrate and from 9.30 nm to 44.62 nm on Alloy 600 substrate. Molar concentration of samarium in initial evaporated material is 19.38 mol% and varies from 11.37 mol% to 21 mol% in formed thin films depending on technological parameters.DOI: http://dx.doi.org/10.5755/j01.ms.21.1.5700

  8. Formation of Core-Shell Nanoparticles Composed of Magnetite and Samarium Oxide in Magnetospirillum magneticum Strain RSS-1.

    Science.gov (United States)

    Shimoshige, Hirokazu; Nakajima, Yoshikata; Kobayashi, Hideki; Yanagisawa, Keiichi; Nagaoka, Yutaka; Shimamura, Shigeru; Mizuki, Toru; Inoue, Akira; Maekawa, Toru

    2017-01-01

    Magnetotactic bacteria (MTB) synthesize magnetosomes composed of membrane-enveloped magnetite (Fe3O4) or greigite (Fe3S4) particles in the cells. Recently, several studies have shown some possibilities of controlling the biomineralization process and altering the magnetic properties of magnetosomes by adding some transition metals to the culture media under various environmental conditions. Here, we successfully grow Magnetospirillum magneticum strain RSS-1, which are isolated from a freshwater environment, and find that synthesis of magnetosomes are encouraged in RSS-1 in the presence of samarium and that each core magnetic crystal composed of magnetite is covered with a thin layer of samarium oxide (Sm2O3). The present results show some possibilities of magnetic recovery of transition metals and synthesis of some novel structures composed of magnetic particles and transition metals utilizing MTB.

  9. Co-reduction of aluminium and lanthanide ions in molten fluorides: Application to cerium and samarium extraction from nuclear wastes

    Energy Technology Data Exchange (ETDEWEB)

    Gibilaro, M. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France); Massot, L. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)], E-mail: massot@chimie.ups-tlse.fr; Chamelot, P.; Taxil, P. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)

    2009-09-01

    This work concerns the method of co-reduction process with aluminium ions in LiF-CaF{sub 2} medium (79-21 mol.%) on tungsten electrode for cerium and samarium extraction. Electrochemical techniques such as cyclic and square wave voltammetries, and potentiostatic electrolyses were used to study the co-reduction of CeF{sub 3} and SmF{sub 3} with AlF{sub 3}. For each of these elements, specific peaks of Al-Ce and Al-Sm alloys formation were observed by voltammetry as well as peaks of pure cerium and aluminium, and pure samarium and aluminium respectively. The difference of potential measured between the solvent reduction and the alloy formation suggests expecting an extraction efficiency of 99.99% of each lanthanide by the process. Different intermetallic compounds were obtained for different potentiostatic electrolysis and were characterised by Scanning Electron Microscopy with EDS probe. The validity of the process was verified by carrying out cerium and samarium extractions in the form of Al-Ln alloy; the extraction efficiency was 99.5% for Ce(III) and 99.4% for Sm(III)

  10. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  11. Reference: 132 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 132 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15525647i Bertrand Claire... et al. 2005 Jan. J. Biol. Chem. 280(2):1465-73. Plant growth and development are sensitive to light. Light-re...ion initiation complex integrates light signals from enhancer-bound transcription factors re... TATA-binding protein-associated factor TAF1 (or TAF(II)250). The mutation of HAF2 induced decreases on chlo...nalysis indicated that HAF2 is involved in the pathways of both red/far-red and blue light signals. Double m

  12. 27 CFR 19.132 - Continuity of premises.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Continuity of premises. 19.132 Section 19.132 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Location and Use § 19.132 Continuity of premises...

  13. 42 CFR 410.132 - Medical nutrition therapy.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Medical nutrition therapy. 410.132 Section 410.132... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.132 Medical nutrition therapy. (a) Conditions for coverage of MNT services. Medicare Part B pays for MNT services...

  14. 50 CFR 14.132 - Food and water.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Food and water. 14.132 Section 14.132 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING..., Sea Otters, Pinnipeds, and Polar Bears) § 14.132 Food and water. A marine mammal shall not be...

  15. 7 CFR 58.132 - Basis for classification.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Basis for classification. 58.132 Section 58.132... Milk § 58.132 Basis for classification. The quality classification of raw milk for manufacturing... residue test, and quality control tests for sediment content, bacterial estimate and somatic cell count...

  16. 45 CFR 13.2 - When these rules apply.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false When these rules apply. 13.2 Section 13.2 Public... TO JUSTICE ACT IN AGENCY PROCEEDINGS General Provisions § 13.2 When these rules apply. These rules apply to adversary adjudications before the Department. ...

  17. 29 CFR 1915.132 - Portable electric tools.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Portable electric tools. 1915.132 Section 1915.132 Labor... § 1915.132 Portable electric tools. The provisions of this section shall apply to ship repairing... frames of portable electric tools and appliances, except double insulated tools approved by Underwriters...

  18. 27 CFR 22.132 - Deposit in storage tanks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Deposit in storage tanks. 22.132 Section 22.132 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU....132 Deposit in storage tanks. (a) Recovered alcohol shall be accumulated and kept in separate storage...

  19. 19 CFR 132.3 - Observation of official hours.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Observation of official hours. 132.3 Section 132.3 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY QUOTAS General Provisions § 132.3 Observation of official hours. An entry summary for consumption...

  20. X-ray Induced Luminescence Spectroscopy of Samarium Doped Barium Sulfate Prepared by Sintering Method

    Science.gov (United States)

    Kumeda, T.; Maeda, K.; Shirano, Y.; Fujiwara, K.; Sakai, K.; Ikari, T.

    2015-06-01

    X-ray induced luminescence (XL) properties of phosphor materials made of samarium doped barium sulfate have been investigated. The samples were prepared by sintering method heated at 900-1250 °C for 3 hours in air from the mixture of BaSO4 and Sm2O3. The concentration of Sm were prepared from 0.01-6 at.%. In as-prepared sample, the Sm3+ was detected by photoluminescence (PL). The PL intensity is maximum about 2 at.% with Sm, and then starts decreasing. The PL intensity showed concentration quenching. The XL observed Sm2+ and Sm3+ ions. The XL was shown from the sample sintered up to 1200 °C. The XL intensity increased with Sm concentration up to 1 at.%. The intensity was almost constant larger than 1 at.% Sm. These concentration dependences is different since the X-ray energy absorbed to the host material at once, and the energy transferred to both Sm3+ and Sm2+ ions. Sm doped BaSO4 is found a host for XL phosphor materials.

  1. High-κ Samarium-Based Metal-Organic Framework for Gate Dielectric Applications.

    Science.gov (United States)

    Pathak, Abhishek; Chiou, Guan Ru; Gade, Narsinga Rao; Usman, Muhammad; Mendiratta, Shruti; Luo, Tzuoo-Tsair; Tseng, Tien Wen; Chen, Jenq-Wei; Chen, Fu-Rong; Chen, Kuei-Hsien; Chen, Li-Chyong; Lu, Kuang-Lieh

    2017-07-05

    The self-assembly of a samarium-based metal-organic framework [Sm2(bhc)(H2O)6]n (1) in good yield was achieved by reacting Sm(NO3)3·6H2O with benzenehexacarboxylic acid (bhc) in a mixture of H2O-EtOH under hydrothermal conditions. A structural analysis showed that compound 1 crystallized in a space group of Pnmn and adopted a 3D structure with (4,8) connected nets. Temperature dependent dielectric measurements showed that compound 1 behaves as a high dielectric material with a high dielectric constant (κ = 45.1) at 5 kHz and 310 K, which is comparable to the values for some of the most commonly available dielectric inorganic metal oxides such as Sm2O3, Ta2O5, HfO2, and ZrO2. In addition, electrical measurements of 1 revealed an electrical conductivity of about 2.15 × 10-7 S/cm at a frequency of 5 kHz with a low leakage current (Ileakage = 8.13 × 10-12 Amm-2). Dielectric investigations of the Sm-based MOF provide an effective path for the development of high dielectric materials in the future.

  2. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  3. Characterization of luminescent samarium doped HfO{sub 2} coatings synthesized by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Chacon-Roa, C [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Guzman-Mendoza, J [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Aguilar-Frutis, M [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Garcia-Hipolito, M [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Alvarez-Fragoso, O [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Falcony, C [Departamento de Fisica, CINVESTAV-IPN, A. P. 14-740, 07000 Mexico D.F. (Mexico)

    2008-01-07

    Trivalent samarium (Sm{sup 3+}) doped hafnium oxide (HfO{sub 2}) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO{sub 2} monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO{sub 2} : SmCl{sub 3} films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm{sup 3+} ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed.

  4. Samarium-153 EDTMP for metastatic bone pain palliation: the impact of europium impurities.

    Science.gov (United States)

    Kalef-Ezra, J A; Valakis, S T; Pallada, S

    2015-02-01

    To evaluate the impact on the radiation protection policies of the radiocontaminants in Samarium-153 ethylenediamine tetramethylene phosphonate ((153)Sm-EDTMP). The internal contamination of patients treated with (153)Sm-EDMTP for palliation of painful disseminated multiple bone metastases due to long-lived impurities was assessed by direct measurements. These measurements were coupled with dose-rate measurements close to their bodies and spectroscopic analysis of the residual activity in post-treatment radiopharmaceutical vials. Whole-body counting carried out in six patients showed a 30-81-kBq europium -152 plus europium-154 contamination. The 0.85 mean (152)Eu- to -(154)Eu activity ratio obtained by direct counting was similar to that assessed by analysis of post-treatment residual activities in twelve radiopharmaceutical vials following radiopharmaceutical injection. The long-lived radiocontaminants in the patient's bodies and the treatment wastes require modifications of the applicable radiation protection policies. Copyright © 2014 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  5. Luminescence of trivalent samarium ions in silver and tin co-doped aluminophosphate glass

    Science.gov (United States)

    Jiménez, José A.; Lysenko, Sergiy; Liu, Huimin; Sendova, Mariana

    2011-06-01

    This work presents the spectroscopic properties of trivalent samarium ions in a melt-quenched aluminophosphate glass containing silver and tin. Addition of 4 mol% of each Ag 2O and SnO into the glass system with 2 mol% Sm 2O 3 results in Sm 3+ ions luminescence under non-resonant UV excitation owing to energy transfer from single silver ions and/or twofold-coordinated Sn centers. Assessment of luminescence spectra and decay dynamics suggest the energy transfer mechanism to be essentially of the resonant radiative type. Moreover, a connection between the luminescent and structural properties of the rare-earth doped glass system was demonstrated. Raman spectroscopy characterization revealed that no significant variation in the glass matrix is induced by Sm 3+ doping at the concentration employed. A comparison was made with a structural study performed on the Eu 3+ doped system (containing 2 mol% Eu 2O 3 along with 4 mol% of each Ag 2O and SnO) where the radiative energy transfer mechanism was previously established. The data appears consistent regarding the lack of variation in glass structure upon the Eu 3+ and Sm 3+ doping in connection with the dominance of the radiative transfer in the matrix. Thermal treatment of the material leads to precipitation of Ag nanoparticles of a broad size range inside the dielectric as observed by transmission electron microspcopy. Assessment of 4G 5/2 excited state decay in Sm 3+ ions shows no influence from the silver particles.

  6. Samarium (III) adsorption on bentonite modified with N-(2-hydroxyethyl) ethylenediamine.

    Science.gov (United States)

    Li, Dandan; Chang, Xijun; Hu, Zheng; Wang, Qihui; Li, Ruijun; Chai, Xiaoli

    2011-02-15

    A new material has been synthesized using dry process to activate bentonite followed by N-(2-hydroxyethyl) ethylenediamine connecting chlorosilane coupling agent. The synthesized new material was characterized by elemental analysis, FT-IR and thermogravimetry which proved that bentonite was successfully modified. The most interesting trait of the new material was its selective adsorption for rare earth elements. A variety of conditions of the new material were investigated for adsorption. The optimal conditions were determined with respect to pH and shaking time. Samarium (Sm) was quantitatively adsorbed at pH 4 and shaking time of 2 min onto the new material. Under these conditions the maximum static adsorption capacity of Sm(III) was found to be 17.7 mg g(-1). The adsorbed Sm(III) ion were quantitatively eluted by 2.0 mL 0.1 mol L(-1) HCl and 5% CS (NH(2))(2) solution. According to IUPAC definition, the detection limit (3σ) of this method was 0.60 ng mL(-1). The relative standard deviation (RSD) under optimum conditions was less than 3% (n=8). The new material also was applied for the preconcentration of trace Sm(III) in environmental samples with satisfactory results. Copyright © 2010 Elsevier B.V. All rights reserved.

  7. The dipole response of {sup 132}Sn

    Energy Technology Data Exchange (ETDEWEB)

    Schrock, Philipp; Aumann, Thomas; Johansen, Jacob; Schindler, Fabia [IKP, TU Darmstadt (Germany); Boretzky, Konstanze [GSI Helmholtzzentrum (Germany); Rossi, Dominic [Michigan State University (United States); Collaboration: R3B-Collaboration

    2015-07-01

    The Isovector Giant Dipole Resonance (IVGDR) is a well-known collective excitation in which all protons oscillate against all neutrons of a nucleus. In neutron-rich nuclei an additional low-lying dipole excitation occurs, often denoted as Pygmy Dipole Resonance (PDR). To study the PDR in exotic Sn-isotopes, an experiment has been successfully performed with the upgraded R{sup 3}B-LAND setup at GSI. The complete-kinematics measurement of all reaction participants allows for the reconstuction of the excitation energy and, hence, the extraction of the dipole strength. Presented are the main features of the experiment, the analysis concept and the current status of the analysis of the dipole response of the doubly-magic isotope {sup 132}Sn.

  8. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  9. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Science.gov (United States)

    Mandiwana, Vusani; Kalombo, Lonji; Venter, Kobus; Sathekge, Mike; Grobler, Anne; Zeevaart, Jan Rijn

    2015-09-01

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly( d, l-lactide- co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([153Sm]Sm2O3) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive 153Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The 153Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [153Sm]Sm2O3 loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [153Sm]Sm2O3-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  10. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  11. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 keV. This...

  12. Optical response and magnetic characteristic of samarium doped zinc phosphate glasses containing nickel nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Azmi, Siti Amlah M.; Sahar, M.R., E-mail: mrahim057@gmail.com

    2015-11-01

    A magnetic glass of composition 40ZnO–(58−x) P{sub 2}O{sub 5}–1Sm{sub 2}O{sub 3}–xNiO, with x=0.0, 1.0, 1.5 and 2.0 mol% is prepared by melt-quenching technique. The glass is characterized by X-ray diffraction, high-resolution transmission electron microscope (HRTEM), photoluminescence (PL) spectroscopy and vibrating sample magnetometer (VSM) analysis. The X-rays diffraction confirms the amorphous nature of the glass while the HRTEM analysis reveals the presence of nickel nanoparticles in the glass samples. High-resolution TEM reveals that the lattice spacing of nickel nanoparticles is 0.35 nm at (100) plane. Photoluminescence emission shows the existence of four peaks that correspond to the transition from the upper level of {sup 4}G{sub 5/2} to the lower level of {sup 6}H{sub 5/2}, {sup 6}H{sub 7/2}, {sup 6}H{sub 9/2,} and {sup 6}H{sub 11/2.} It is observed that all peaks experience significant quenching effect with the increasing concentration of nickel nanoparticles, suggesting a strong energy transfer from excited samarium ions to the nickel ions. The glass magnetization and susceptibility at 12 kOe at room temperature are found to be in the range of (3.87±0.17×10{sup −2}–7.19±0.39×10{sup −2}) emu/g and (3.24±0.16×10{sup −6}–5.99±0.29×10{sup −6}) emu/Oe g respectively. The obtained hysteresis curve indicates that the glass samples are paramagnetic materials. The studied glass can be further used towards the development of magneto-optical functional glass. - Highlights: • Sm{sup 3+} doped zinc phosphate glass embedded with Ni NPs has been prepared. • The Laue pattern and lattice spacing of Ni NPs are confirmed by HRTEM image. • The magnetic response of glasses has been studied through VSM analysis. • Enhancement factor and decay half-lifetime are investigated.

  13. Treatment of bone pain secondary to metastases using samarium-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Elba Cristina Sá de Camargo Etchebehere

    Full Text Available CONTEXT: More than 50% of patients with prostate, breast or lung cancer will develop painful bone metastases. The purpose of treating bone metastases is to relieve pain, reduce the use of steroids and to maintain motion. OBJECTIVE: To evaluate the use of samarium-153-EDTMP (153Sm-EDTMP for the treatment of bone pain secondary to metastases that is refractory to clinical management. TYPE OF STUDY: Retrospective. SETTING: Division of Nuclear Medicine, Universidade Estadual de Campinas (Unicamp. METHODS: Fifty-eight patients were studied (34 males with mean age 62 years; 31 patients had prostate cancer, 20 had breast cancer, three had lung cancer, one had lung hemangioendothelioma, one had parathyroid adenocarcinoma, one had osteosarcoma and one had an unknown primary tumor. All patients had multiple bone metastases demonstrated by bone scintigraphy using 99mTc-MDP,and were treated with 153Sm-EDTMP. Response to treatment was graded as good (pain reduction of 50-100%, intermediate (25-49% and poor (0-24%. RESULTS: All patients showed good uptake of 153Sm-EDTMP by bone metastases. Among the patients with prostate cancer, intermediate or good response to therapy occurred in 80.6% (25 patients and poor response in 19.4% (6. Among the patients with breast cancer, 85% (17 showed intermediate or good response to therapy while 15% (3 showed poor response. All three patients with lung cancer showed poor response to treatment. The lung hemangioendothelioma and unknown primary lesion patients showed intermediate response to treatment; the osteosarcoma and parathyroid adenocarcinoma patients showed good response to treatment. No significant myelotoxicity occurred. DISCUSSION: Pain control is important for improving the quality of life of patients with advanced cancers. The mechanism by which pain is relieved with the use of radionuclides is still not yet completely understood, however, the treatment is simple and provides a low risk of mielotoxicity

  14. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  15. 9 CFR 590.132 - Access to plants.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Access to plants. 590.132 Section 590... Service § 590.132 Access to plants. Access shall not be refused to any representative of the Secretary to any plant, place of business, or transport vehicle subject to inspection under the provisions of this...

  16. 7 CFR 15.132 - Record for decision.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Record for decision. 15.132 Section 15.132 Agriculture Office of the Secretary of Agriculture NONDISCRIMINATION Rules of Practice and Procedure for Hearings... decision. The transcript of testimony, exhibits, affidavits, depositions, briefs, memoranda of law, and all...

  17. 42 CFR 480.132 - Disclosure of information about patients.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Disclosure of information about patients. 480.132... (QIOs) Disclosure of Confidential Information § 480.132 Disclosure of information about patients. (a...) Disclose patient identified information in its possession to the identified patient or the patient's...

  18. 50 CFR 300.132 - Lobster harvest limitations.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Lobster harvest limitations. 300.132... FISHERIES REGULATIONS Vessels of the United States Fishing in Colombian Treaty Waters § 300.132 Lobster harvest limitations. (a) Berried lobsters. A berried (egg-bearing) lobster in treaty waters may not be...

  19. 46 CFR 132.240 - Stowage of semiportable fire extinguishers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Stowage of semiportable fire extinguishers. 132.240... FIRE-PROTECTION EQUIPMENT Portable and Semiportable Fire Extinguishers § 132.240 Stowage of semiportable fire extinguishers. The frame or support of each semiportable fire extinguisher of size III, IV...

  20. 27 CFR 28.132 - Responsibility for return of wine.

    Science.gov (United States)

    2010-04-01

    ... of wine. 28.132 Section 28.132 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Withdrawal of Wine Without... Customs Bonded Warehouse, or Transportation to a Manufacturing Bonded Warehouse Return of Wines to Bonded...

  1. 40 CFR 60.132 - Standard for particulate matter.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for particulate matter. 60.132... and Bronze Production Plants § 60.132 Standard for particulate matter. (a) On and after the date on... reverberatory furnace any gases which: (1) Contain particulate matter in excess of 50 mg/dscm (0.022 gr/dscf...

  2. From osp(1|32)⊕osp(1|32) to the M-theory superalgebra: a contraction procedure

    Energy Technology Data Exchange (ETDEWEB)

    Fernández, J. J., E-mail: julio.j.fernandez@hotmail.es; Izquierdo, J. M., E-mail: izquierd@fta.uva.es; Olmo, M. A. del, E-mail: olmo@fta.uva.es [Universidad de Valladolid, Departamento de Física Teórica and IMUVA (Spain)

    2017-03-15

    We show the impossibility to obtain the D’auria–Fré-type superalgebras that allow for an underlying gauge theoretical structure of D = 11 supergravity from the superalgebra osp(1|32)⊕osp(1|32)−, by means of aWeimar-Woods contraction.

  3. Effect of Current Density on Thermodynamic Properties of Nanocrystalline Palladium Capped Samarium Hydride Thin Film Switchable Mirrors

    Directory of Open Access Journals (Sweden)

    Pushpendra Kumar

    2007-01-01

    Full Text Available A 55 nm samarium film capped with a 10 nm palladium overlayer switched from a metallic reflecting to a semiconducting, transparent in visible state during ex-situ hydrogen loading via electrochemical means in 1 M KOH electrolytic aqueous solution at room temperature. The switching between metal to semiconductor was accompanied by measurement of transmittance during hydrogen loading/unloading. The effect of current density on switching and thermodynamic properties was studied between dihydride state (FCC phase and trihydride state (hexagonal phase. From the plateau of partial pressure of hydrogen at x=2.6, enthalpy of formation was calculated at different current densities. The diffusion coefficients and switching kinetics are shown to depend on applied current density.

  4. Targeted bone marrow radioablation with 153Samarium-lexidronam promotes allogeneic hematopoietic chimerism and donor-specific immunologic hyporesponsiveness.

    Science.gov (United States)

    Inverardi, Luca; Linetsky, Elina; Pileggi, Antonello; Molano, R Damaris; Serafini, Aldo; Paganelli, Giovanni; Ricordi, Camillo

    2004-03-15

    Transplantation tolerance, defined as acceptance of a graft by an otherwise fully immunocompetent host, has been an elusive goal. Although robust tolerance has been achieved by the induction of stable hematopoietic chimerism after bone marrow transplantation, lethal or sublethal radiation conditioning used to induce long-term chimerism precludes its clinical use. We studied whether targeted delivery of radiation to bone marrow could allow for bone marrow cell (BMC) engraftment, chimerism, and donor-specific tolerance in the absence of the side effects associated with external irradiation. We administered a radioactive bone-seeking compound (Samarium-Lexidronam, Quadramet, Berlex Laboratories, Wayne, NJ) together with transient T-cell costimulatory blockade to recipient mice. Allogeneic BMCs were given 7 or 14 days after preconditioning. Costimulatory blockade was obtained by the use of an anti-CD154 antibody for 4 weeks. Chimerism was assessed by flow cytometry. Mice then received donor-specific and third-party skin grafts. Graft survival was analyzed with mechanisms of donor-specific hyporesponsiveness. High levels of stable chimerism across an allogeneic barrier were achieved in mice by a single administration of Samarium-Lexidronam, transient T-cell costimulatory blockade, and BMC transplantation. A large percentage of chimeric animals retained donor-derived skin grafts for more than 120 days without requiring additional immunosuppression, suggesting that harsh cytotoxic preconditioning is not necessary to achieve stable chimerism and donor specific hyporesponsiveness. Analysis of the T-cell repertoire in chimeras indicates T-cell deletional mechanisms. These data broaden the potential use of BMC transplantation for tolerance induction and argue for its potential in treating autoimmune diseases.

  5. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  6. 31 CFR 132.5 - Policies and procedures required.

    Science.gov (United States)

    2010-07-01

    ... excluded from the definition of “unlawful Internet gambling” in the Act as an intrastate transaction, an... FUNDING OF UNLAWFUL INTERNET GAMBLING § 132.5 Policies and procedures required. (a) All non-exempt...

  7. [Apoptosis induced by MG-132 in Tca-8113 cells].

    Science.gov (United States)

    Liu, Xian-bin; Chen, Shuang-feng; Chen, Hai-ying; Zhang, Bin

    2011-02-01

    To explore the apoptotic effect of ubiquitin-proteasome inhibitor (PI) MG-132 on human tongue squamous cell carcinoma cell line (Tca-8113 cell) through endoplasmic reticulum stress. Tca-8113 cells were cultured in RPMI 1640 medium supplemented with 10% fetal calf serum, the exponential cells were divided into 5 groups.The cell culture medium was added to 1640 (negative control group), thapsigargin 5 μmol/L (positive control group), and 10,20,30 μmol/L (MG-132 group). After 24 h, the following experiments were carried out: morphological change of apoptotic cells was observed by Hoechst 33258 fluorescent staining under fluorescent microscope, apoptotic rate of cells was determined with annexin V-FITC/PI double staining by flow cytometry, the GRP78 mRNA level was determined by RT-PCR, the expression of caspase-12 protein was evaluated by Western blot, the human ubiquitin-protein ligase E3 concentration was detected by ELISA. The data was analyzed using SPSS16.0 software package. Typical morphological change of apoptosis in Tca-8113 cells was observed 24 hours after treating with 10.0, 20.0, 30.0 μmol/L MG-132 and positive control group; The apoptotic rate of MG-132 groups gradually increased with MG-132 concentration; The GRP78 mRNA level was up-regulated; The expression of caspase-12 increased was demonstrated by Western blot; The expression of the human ubiquitin-protein ligase E3 in MG-132 groups was 28.75 ± 2.28, 18.16 ± 0.65 and 8.85 ± 0.72. MG-132 can induce apoptosis of Tca-8113 cells through endoplasmic reticulum stress; MG-132 can inhibit the expression of human ubiquitin ligase E3.

  8. MG-132 reduces virus release in Bovine herpesvirus-1 infection

    OpenAIRE

    Fiorito, Filomena; Iovane, Valentina; Cantiello, Antonietta; Marullo, Annarosaria; Martino, Luisa De; Iovane, Giuseppe

    2017-01-01

    Bovine herpesvirus 1 (BoHV-1) can provoke conjunctivitis, abortions and shipping fever. BoHV-1 infection can also cause immunosuppression and increased susceptibility to secondary bacterial infections, leading to pneumonia and occasionally to death. Herein, we investigated the influence of MG-132, a proteasome inhibitor, on BoHV-1 infection in bovine kidney (MDBK) cells. Infection of MDBK cells with BoHV-1 induces apoptotic cell death that enhances virus release. Whereas, MG-132 inhibited vir...

  9. Crystal growth of semiorganic complex- samarium chloride coordinated thiourea-L-tartaric acid and its studies on structure and optical characteristics

    Science.gov (United States)

    Slathia, Goldy; Singh, Harjinder; Ramya, E.; Rao, D. Narayana; Bamzai, K. K.

    2017-05-01

    The semi-organic complex of samarium chloride coordinated thiourea-L-tartaric acid (SCTLT) has been grown as a single crystal by slow evaporation technique at room temperature. For structural studies, the grown crystal was subjected to single crystal X-ray diffraction and Fourier transform infra-red (FTIR) spectroscopy. Low cut off wavelength and transparent characteristics were explored by UV-VIS optical characterization. Third-order nonlinear optical properties of grown crystal were investigated by Z-scan technique.

  10. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J.C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  11. Trace amounts of rare earth elements in high purity samarium oxide by sector field inductively coupled plasma mass spectrometry after separation by HPLC

    Energy Technology Data Exchange (ETDEWEB)

    Pedreira, W.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil) and Fundacao Jorge Duprat Figueiredo de Seguranca e Medicina do Trabalho (FUNDACENTRO), 05409-002 Sao Paulo, SP (Brazil)]. E-mail: walter.pedreira@fundacentro.gov.br; Queiroz, C.A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Abrao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Rocha, S.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Vasconcellos, M.E. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Boaventura, G.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil); Pimentel, M.M. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil)

    2006-07-20

    Today there is an increasing need for high purity rare earth compounds in various fields, the optical, the electronics, the ceramic, the nuclear and geochemistry. Samarium oxide has special uses in glass, phosphors, lasers and thermoelectric devices. Calcium chloride crystals treated with samarium have been employed in lasers, which produce light beams intense enough to burn metal. In general, the inductively coupled plasma mass spectrometry (ICP-MS) presents some advantages for trace element analysis, due to high sensitivity and resolution, when compared with other analytical techniques such as ICP optical emission spectrometry (ICP-OES). In this work, sector field inductively coupled plasma mass spectrometry was used. Sixteen elements (Sc, Y and 14 lanthanides) were determined selectively with the ICP-MS system using a concentration gradient method. The detection limits with the ICP-MS system were about 0.2 (La) pg mL{sup -1} to 8 (Gd) pg mL{sup -1}. The %R.S.D. of the methods varying between 0.9 and 1.5% for a set of five (n = 5) replicates was found for the IPEN's material and for the certificate reference sample. Determination of trace REEs in two high pure samarium oxides samples (IPEN and JMC) was performed. IPEN's material is highly pure (>99.99%) and was successfully analyzed without spectral interference (MO{sup +} and MOH{sup +})

  12. Phenotype abnormality: 132 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 132 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u638i decreased efficiency...atment http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u38i ... decreased efficiency ... organ development ...

  13. BUTYL-1,3,2-DIAZABORACYCLOPENTANE RING SYSTEM

    African Journals Online (AJOL)

    cyclic trimers. We have now extended this work by using -(CH,),- as the bridging unit and report new mono- and di-substituted 1,3,2-diazaboracyclopentane prepolymer compounds. EXPERIMENTAL. General. The following reagents were obtained from commercial sources and used without. purification: nBuLi (Aldrich), BCI, ...

  14. 36 CFR 13.2 - Applicability and scope.

    Science.gov (United States)

    2010-07-01

    ... NATIONAL PARK SYSTEM UNITS IN ALASKA Administrative Provisions § 13.2 Applicability and scope. (a) The... applicable to authorized visitor service providers operating within certain park areas. The regulations in... State of Alaska; or (2) Conveyed by an interim conveyance to a Native corporation. ...

  15. 26 CFR 1.132-3 - Qualified employee discounts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Qualified employee discounts. 1.132-3 Section 1... employee discounts. (a) In general—(1) Definition. Gross income does not include the value of a qualified employee discount. A “qualified employee discount” is any employee discount with respect to qualified...

  16. 33 CFR 157.132 - Cargo tanks: Hydrocarbon vapor emissions.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Cargo tanks: Hydrocarbon vapor... § 157.132 Cargo tanks: Hydrocarbon vapor emissions. Each tank vessel having a COW system under § 157.10a... must have— (a) A means to discharge hydrocarbon vapors from each cargo tank that is ballasted to a...

  17. Phenotype-gene: 132 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 132 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1130i decreased incidence.... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17704216i decreased incidence in organ named sto

  18. Effectiveness of radiation synovectomy with samarium-{sup 153} particulate hydroxyapatite in rheumatoid arthritis patients with knee synovitis: a controlled randomized double-blind trial

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Marla Francisca dos; Furtado, Rita Nely Vilar; Konai, Monique Sayuri; Natour, Jamil, E-mail: jnatour@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Reumatologia; Castiglioni, Mario Luiz Vieira; Marchetti, Renata Rosa [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Medicina Nuclear

    2009-07-01

    Objectives: the aim of the present study was to investigate the effectiveness of Samarium{sup 153}-particulate hydroxyapatite radiation synovectomy in rheumatoid arthritis patients with chronic knee synovitis. Methods: fifty-eight rheumatoid arthritis patients (60 knees) with chronic knee synovitis participated in a controlled double-blinded trial. Patients were randomized to receive either an intra-articular injection with 40 mg triamcinolone hexacetonide alone (TH group) or 40 mg triamcinolone hexacetonide combined with 15 mCi Samarium{sup 153}-particulate hydroxyapatite (Sm/TH group). Blinded examination at baseline (T0) and at 1 (T1), 4 (T4), 12 (T12), 32 (T32), and 48 (T48) weeks post-intervention were performed on all patients and included a visual analog scale for joint pain and swelling as well as data on morning stiffness, flexion, extension, knee circumference, Likert scale of improvement, percentage of improvement, SF-36 generic quality of life questionnaire, Stanford Health Assessment Questionnaire (HAQ), Lequesne index, use of non-steroidal anti-inflammatory drugs or oral corticosteroids, events and adverse effects, calls to the physician, and hospital visits. Results: the sample was homogeneous at baseline, and there were no withdrawals. Improvement was observed in both groups in relation to T0, but no statistically significant differences between groups were observed regarding all variables at the time points studied. The Sm/TH group exhibited more adverse effects at T1 (p<0.05), but these were mild and transitory. No severe adverse effects were reported during follow-up. Conclusion: intra-articular injection of Samarium{sup 153}-particulate hydroxyapatite (15 mCi) with 40 mg of triamcinolone hexacetonide is not superior to triamcinolone hexacetonide alone for the treatment of knee synovitis in patients with rheumatoid arthritis at 1 y of follow-up. (author)

  19. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  20. Neutron Activated Samarium-153 Microparticles for Transarterial Radioembolization of Liver Tumour with Post-Procedure Imaging Capabilities

    Science.gov (United States)

    Hashikin, Nurul Ab. Aziz; Yeong, Chai-Hong; Abdullah, Basri Johan Jeet; Ng, Kwan-Hoong; Chung, Lip-Yong; Dahalan, Rehir; Perkins, Alan Christopher

    2015-01-01

    Introduction Samarium-153 (153Sm) styrene divinylbenzene microparticles were developed as a surrogate for Yttrium-90 (90Y) microspheres in liver radioembolization therapy. Unlike the pure beta emitter 90Y, 153Sm possess both therapeutic beta and diagnostic gamma radiations, making it possible for post-procedure imaging following therapy. Methods The microparticles were prepared using commercially available cation exchange resin, Amberlite IR-120 H+ (620–830 μm), which were reduced to 20–40 μm via ball mill grinding and sieve separation. The microparticles were labelled with 152Sm via ion exchange process with 152SmCl3, prior to neutron activation to produce radioactive 153Sm through 152Sm(n,γ)153Sm reaction. Therapeutic activity of 3 GBq was referred based on the recommended activity used in 90Y-microspheres therapy. The samples were irradiated in 1.494 x 1012 n.cm-2.s-1 neutron flux for 6 h to achieve the nominal activity of 3.1 GBq.g-1. Physicochemical characterisation of the microparticles, gamma spectrometry, and in vitro radiolabelling studies were carried out to study the performance and stability of the microparticles. Results Fourier Transform Infrared (FTIR) spectroscopy of the Amberlite IR-120 resins showed unaffected functional groups, following size reduction of the beads. However, as shown by the electron microscope, the microparticles were irregular in shape. The radioactivity achieved after 6 h neutron activation was 3.104 ± 0.029 GBq. The specific activity per microparticle was 53.855 ± 0.503 Bq. Gamma spectrometry and elemental analysis showed no radioactive impurities in the samples. Radiolabelling efficiencies of 153Sm-Amberlite in distilled water and blood plasma over 48 h were excellent and higher than 95%. Conclusion The laboratory work revealed that the 153Sm-Amberlite microparticles demonstrated superior characteristics for potential use in hepatic radioembolization. PMID:26382059

  1. 7 CFR 42.132 - Determining cumulative sum values.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Determining cumulative sum values. 42.132 Section 42... Determining cumulative sum values. (a) The parameters for the on-line cumulative sum sampling plans for AQL's... 3 1 2.5 3 1 2 1 (b) At the beginning of the basic inspection period, the CuSum value is set equal to...

  2. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  3. Ionized gas, molecules and dust in Sh2-132

    Science.gov (United States)

    Vasquez, J.; Cappa, C. E.; Pineault, S.; Duronea, N. U.

    2010-07-01

    We analyse the various interstellar components of the HII region Sh2-132. The main stellar source is the double binary system that includes the Wolf-Rayet star WR153ab. We use radio continuum images at 408 and 1420 MHz, and HI 21-cm line data taken from the Canadian Galactic Plane Survey, molecular observations of the 12CO(1-0) line at 115GHz from the Five College Radio Astronomy Observatory, and available mid- and far-infrared observations obtained with the MSX and IRAS satellites, respectively. Sh2-132 is composed of two shells showing radio continuum counterparts at both frequencies. The emission is thermal in nature. The estimated rms electron density and ionized mass of the nebula are ne ~= 20cm-3 and . The distribution of the CO emission shows molecular gas bordering the ionized nebula and interacting with it. The velocities of the molecular gas is in the range -38 to -53kms-1, similar to the velocity of the ionized gas. The emission at 8.3μm reveals a ring-like feature of about 15arcmin that encircles the bright optical regions. This emission is due to the polycyclic aromatic hydrocarbons and marks the location of photodissociation regions. The gas distribution in the environs of Sh2-132 can be explained in a scenario where the massive stars in the region photodissociated, ionized and swept up the dense molecular material from the parental cloud through their strong stellar winds and intense ultraviolet (UV) photon flux.

  4. 42 CFR 423.132 - Public disclosure of pharmaceutical prices for equivalent drugs.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Public disclosure of pharmaceutical prices for equivalent drugs. 423.132 Section 423.132 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT... BENEFIT Benefits and Beneficiary Protections § 423.132 Public disclosure of pharmaceutical prices for...

  5. 24 CFR 1000.132 - Are utilities considered a part of rent or homebuyer payments?

    Science.gov (United States)

    2010-04-01

    ... rent or homebuyer payments? 1000.132 Section 1000.132 Housing and Urban Development Regulations... Activities § 1000.132 Are utilities considered a part of rent or homebuyer payments? Utilities may be considered a part of rent or homebuyer payments if a recipient decides to define rent or homebuyer payments...

  6. 10 CFR 63.132 - Confirmation of geotechnical and design parameters.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Confirmation of geotechnical and design parameters. 63.132 Section 63.132 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Performance Confirmation Program § 63.132 Confirmation of geotechnical and design parameter...

  7. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  8. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints.

    Science.gov (United States)

    Najeeb Al Hallak, Mohammed; McCurdy, Matt; Zouain, Nicolas; Hayes, Justin

    2009-08-28

    (153)Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate) and Samarium-153 [1]. (153)Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of (153)Sm-EDTMP leads to contamination with (154)Eu (Europium-154) [2]. A previous study only alluded to the retention of (154)Eu in the bones after receiving treatment with (153)Sm-EDTMP [2]. Activation of the alarm at security checkpoints after (153)Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received (153)Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA) activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing the American-Canadian border. We assume that the (154)Eu which remained in the patients' bones activated the sensors. METHODS: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received (153)Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. RESULTS: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of (154)Eu emissions. CONCLUSION: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of (154)Eu retained in patients who received (153)Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of (153)Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with (153)Sm-EDTMP at Roger Maris Cancer

  9. Ultra Fast Timing Measurements at $^{78}$Ni and $^{132}$Sn

    CERN Multimedia

    2002-01-01

    We propose to measure level lifetimes in the exotic nuclei of $^{81}$Ga and $^{80}$Ga in the vicinity of $^{78}$Ni and of $^{135}$Sb and $^{134}$Sb above $^{132}$Sn by the time-delayed technique. These are relatively simple nuclear systems with a few particles and/or holes outside of the doubly-magic core thus can be treated rather precisely within the shell model. The anticipated new structure information on these nuclei, and in particular the lifetime results will put constraints on the model parameters and will serve to verify their predictions. The selected nuclei are some of the most exotic ones just above $^{78}$Ni or $^{132}$Sn, where the transition rates can be studied at present. Of the strongest interest is the nucleus of $^{81}$Ga, which has only 3 valence protons outside of $^{78}$Ni with the lowest proton orbits being $p_{3/2}$ and $f_{5/2}$. The Ml transition between these states, although allowed by the selection rules, should be $\\textit{l}$-forbidden thus very slow. This should give rise to a...

  10. High Energy Transitions in the Decay of 132I

    DEFF Research Database (Denmark)

    Johnson, N.; Wilsky, K.; Gregers Hansen, P.

    1965-01-01

    A study of the high-energy gamma rays of 132I with a three-crystal pair spectrometer has disclosed the presence of several new transitions. In addition, it has permitted more precise energy assignments for the previously observed gamma rays. Gamma rays having energies greater than the pair......-ray spectrometer covering the energy range of 100–2200 keV. Electron lines were observed corresponding to transitions at 147.4±0.9, 263.0±0.9, 285.5±1.1, 523.0±1.2, 631.5±1.4, 669.0±1.2 (complex), 728.8±1.7, 773.8±1.6, 954.9±1.9 and 1395±8 keV. A careful study of the end-point region of the beta spectrum has shown...... thet the maximum energy beta ray of 132I is at 2118±15 keV....

  11. Charge radii and nuclear moments around {sup 132}Sn

    Energy Technology Data Exchange (ETDEWEB)

    Le Blanc, F.; Cabaret, L.; Cottereau, E.; Crawford, J.E.; Essabaa, S.; Genevey, J.; Horn, R.; Huber, G.; Lassen, J.; Lee, J.K.P.; Le Scornet, G.; Obert, J.; Oms, J.; Ouchrif, A.; Pinard, J.; Roussiere, B.; Sauvage, J.; Verney, D

    2004-04-05

    Laser spectroscopy measurements have been carried out on the very neutron-rich tin isotopes with the COMPLIS experimental setup. Using the 5s{sup 2}5p{sup 23}P{sub 0} {yields} 5s{sup 2}5p6s {sup 3}P{sub 1} optical transition, hyperfine spectra of {sup 126-132}Sn and {sup 125m,127m,129m-131m}Sn where recorded for the first time. The variation of the mean square charge radius ({delta} < r{sup 2} >) between these nuclei and the nuclear moments of the isomers and the odd isotopes were thus measured. From the quadrupole moments values, all these nuclei appear to be spherical. The experimental magnetic moments are thus compared with the Schmidt values calculations. Moreover, the measured {delta} < r{sup 2} > are compared with several mean field calculations.

  12. #RevueltasEstéticas: Del #yosoy132 a #Ayotzinapa

    OpenAIRE

    Córdova Rojas, Alba Citlali

    2016-01-01

    El objetivo de este artículo es situar en las estéticas de protesta los dispositivos que se despliegan en manifestaciones sociales como prácticas artísticas contemporáneas. En dos casos en México, el movimiento “yo soy 132” y las manifestaciones por los 43 estudiantes desaparecidos de Ayotzinapa. Se aborda la relación entre política y estética desde el planteamiento de que el arte contribuye a la formación de subjetividades políticas, y la forma en que estas prácticas críticas se han desplega...

  13. High spin states in odd-odd {sup 132}Cs

    Energy Technology Data Exchange (ETDEWEB)

    Hayakawa, Takehito [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Lu, J.; Furuno, K. [and others

    1998-03-01

    Excited states with spin larger than 5 {Dirac_h} were newly established in the {sup 132}Cs nucleus via the {sup 124}Sn({sup 11}B,3n) reaction. Rotational bands built on the {nu}h{sub 11/2} x {pi}d{sub 5/2}, {nu}h{sub 11/2} x {pi}g{sub 7/2} and {nu}h{sub 11/2} x {pi}h{sub 11/2} configurations were observed up to spin I {approx} 16 {Dirac_h}. The {nu}h{sub 11/2} x {pi}h{sub 11/2} band shows inverted signature splitting below I < 14 {Dirac_h}. A dipole band was firstly observed in doubly odd Cs nuclei. (author)

  14. Rotational band structure in odd-odd /sup 132/La

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, J. R. B.; Emediato, L. G. R.; Rizzutto, M. A.; Ribas, R. V.; Seale, W. A.; Rao, M. N.; Medina, N. H.; Botelho, S.; Cybulska, E. W.

    1989-06-01

    The level scheme of /sup 132/La was obtained with in-beam gamma spectroscopy techniques using fusion evaporation reactions with /sup 10,11/B, /sup 14/N beams and isotopic targets of Te and Sn. Two rotational band structures were seen. One band, assigned to the ..pi../ital h//sub 11/2//direct product/..nu..h/sub 11/2/, shows a smaller signature splitting as compared to the isotones /sup 134/Pr and /sup 136/Pm, indicating a slight reduction of triaxiality. The other band has been tentatively assigned the ..pi..(422)3/2/sup +//direct product/..nu..h/sub 11/2/ configuration, and shows no signature splitting indicating a near prolate shape.

  15. [Endoscopic internal urethrotomy. Retrospective studies of 132 cases].

    Science.gov (United States)

    Benizri, E; Chevallier, D; Quintens, H; Fabiani, P; Degraeve, B; Amiel, J; Raymond, G; Toubol, J

    1992-01-01

    The authors report a series of 132 patients with urethral stricture all treated by the same surgical technique between 1979 and 1984: direct vision internal urethrotomy. 62% of good results were obtained after a single operation with a follow-up ranging between 18 months and 5 years. There was no mortality and the morbidity was considered to be 5%. The authors indicate that the results were more favourable when the operation was performed in a solitary, short (less than 2 cm) non-infected stricture of the proximal urethra. The duration of postoperative catheterization was 10 days; catheterization for a longer period did not provide any significant advantage. The poor results (38%) were reported in cases of extensive strictures situated in the distal urethra or in patients with a history of urethral surgery. These cases were treated by repeated internal urethrotomy; 32% were cured after a second urethrotomy, while the others required maintenance sessions of urethral dilatation or even a urethroplasty procedure.

  16. Formation of a new adduct based on fullerene tris-malonate samarium salt C60-[C60(=C(COO)2)3]Sm2

    Science.gov (United States)

    Petrov, A. A.; Keskinov, V. A.; Semenov, K. N.; Charykov, N. A.; Letenko, D. G.; Nikitin, V. A.

    2017-03-01

    Gram quantities of a new adduct based on light fullerene tris-malonate samarium salt C60 [C60(=C(COO)2)3]Sm2 are obtained via the reaction of ion exchange. The obtained adduct is studied by means of electron and infrared spectroscopy, X-ray and elemental analysis, electron microscopy, and thermogravimetry. The polythermal solubility of [C60(=C(COO)2)3]Sm2 in water is determined in ampoules via saturation within 20-70°C. The composition of crystalline hydrate [C60(=C(COO)2)3]Sm2 · 36H2O, which exists in equilibrium with the saturated solution, is estimated.

  17. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  18. Marrow irradiation with high-dose 153Samarium-EDTMP followed by chemotherapy and hematopoietic stem cell infusion for acute myelogenous leukemia.

    Science.gov (United States)

    Rodriguez, Vilmarie; Anderson, Peter M; Litzow, Mark R; Erlandson, Linda; Trotz, Barbara A; Arndt, Carola A S; Khan, Shakila P; Wiseman, Gregory A

    2006-08-01

    In four patients, aged 15 - 20 years, with high-risk acute myeloid leukemia (AML), high-dose samarium 153-labelled ethylenediaminetetramethylenephosphonate (153Sm-EDTMP) was used for targeted marrow irradiation before preparative chemotherapy conditioning regimens and allogeneic (three patients) or autologous (one patient) hematopoietic stem cell transplantation. The dose of 153Sm-EDTMP was 703 MBq/kg (n = 1) or 1110 MBq/kg (n = 3). No side-effects occurred during the 30-min infusion of 153Sm-EDTMP. Samarium - melphalan regimens were given to three patients; one had 153Sm-EDTMP - busulfan + cyclophosphamide. Total body radioactivity was below the 133 MBq safe limit before infusion of stem cells (day 14 after 153Sm-EDTMP). No hemorrhagic cystitis, nephrotoxicity or serious infections occurred. Leukocyte engraftment (white blood cell count >0.5 x 10(9)/l) occurred between 12 and 23 days after stem cell infusion (mean of 17 days). Complete cytogenetic and morphologic remission of AML was evident on follow-up marrow aspirate and biopsy specimens from all patients. In two of the four study patients, the disease remains in complete remission and the patients have an excellent quality of life (Eastern Cooperative Oncology Group performance status 0; no medications) and no organ toxicity more than 2 years and more than 4 years, respectively, after their blood and bone marrow transplantations. Thus, in adolescents and adults, 153Sm-EDTMP may provide a relatively simple and effective means for using irradiation to eliminate AML within the marrow.

  19. Downregulation of ZNF132 in prostate cancer is associated with aberrant promoter hypermethylation and poor prognosis

    DEFF Research Database (Denmark)

    Abildgaard, Mette Opstrup; Borre, Michael; Mørck Mortensen, Martin

    2012-01-01

    immunoreactivity was significantly associated with high Gleason score and advanced T stage in both PC patient cohorts. By univariate analysis, no/weak ZNF132 staining was a significant adverse predictor of PSA recurrence after RP (p = 0.024) and cancer-specific death following conservative treatment (p = 0......, our results show that downregulation of ZNF132 is associated with aggressive PC and furthermore identify ZNF132 as a new candidate methylation marker for PC....

  20. MicroRNA-132 targets PEA-15 and suppresses the progression of astrocytoma in vitro.

    Science.gov (United States)

    Geng, Fei; Wu, Jian-Lin; Lu, Gui-Feng; Liang, Zhi-Ping; Duan, Zhuo-Li; Gu, Xi

    2016-09-01

    Gliomas are highly malignant tumors, the most common of which are astrocytomas. A growing number of studies suggest that dysregulation of miRNAs is a frequent event contributing to the pathogenesis of gliomas. In this study, we found that over-expression of miR-132 inhibited cell proliferation and migration and triggered apoptosis, while knockdown of miR-132 showed opposite effects. PEA-15 was identified as a direct target of miR-132. Reintroduction of PEA-15 without 3'UTR region reversed the inhibitory effects of miR-132 on cell proliferation, migration, and apoptosis. MiR-132 was inversely correlated with the PEA-15 expression. CREB (cAMP response element binding protein) and KLF (Krüppel-like factor 8) were conformed as transcription factors of miR-132, which bidirectionally regulate the expression of miR-132. Our study suggests that miR-132 is an important tumor suppressor of astrocytoma progression by targeting PEA-15, while CREB and KLF can modulate the expression of miR-132, thus providing new insight into the molecular mechanisms underlying astrocytoma progression in vitro.

  1. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  2. [Laparoscopic liver resection: lessons learned after 132 resections].

    Science.gov (United States)

    Robles Campos, Ricardo; Marín Hernández, Caridad; Lopez-Conesa, Asunción; Olivares Ripoll, Vicente; Paredes Quiles, Miriam; Parrilla Paricio, Pascual

    2013-10-01

    After 20 years of experience in laparoscopic liver surgery there is still no clear definition of the best approach (totally laparoscopic [TLS] or hand-assisted [HAS]), the indications for surgery, position, instrumentation, immediate and long-term postoperative results, etc. To report our experience in laparoscopic liver resections (LLRs). Over a period of 10 years we performed 132 LLRs in 129 patients: 112 malignant tumours (90 hepatic metastases; 22 primary malignant tumours) and 20 benign lesions (18 benign tumours; 2 hydatid cysts). Twenty-eight cases received TLS and 104 had HAS. 6 right hepatectomies (2 as the second stage of a two-stage liver resection); 6 left hepatectomies; 9 resections of 3 segments; 42 resections of 2 segments; 64 resections of one segment; and 5 cases of local resections. There was no perioperative mortality, and morbidity was 3%. With TLS the resection was completed in 23/28 cases, whereas with HAS it was completed in all 104 cases. Transfusion: 4,5%; operating time: 150min; and mean length of stay: 3,5 days. The 1-, 3- and 5-year survival rates for the primary malignant tumours were 100, 86 and 62%, and for colorectal metastases 92, 82 and 52%, respectively. LLR via both TLS and HAS in selected cases are similar to the results of open surgery (similar 5-year morbidity, mortality and survival rates) but with the advantages of minimally invasive surgery. Copyright © 2012 AEC. Published by Elsevier Espana. All rights reserved.

  3. Calibration of PCB-132 Sensors in a Shock Tube

    Science.gov (United States)

    Berridge, Dennis C.; Schneider, Steven P.

    2012-01-01

    While PCB-132 sensors have proven useful for measuring second-mode instability waves in many hypersonic wind tunnels, they are currently limited by their calibration. Until now, the factory calibration has been all that was available, which is a single-point calibration at an amplitude three orders of magnitude higher than a second-mode wave. In addition, little information has been available about the frequency response or spatial resolution of the sensors, which is important for measuring high-frequency instability waves. These shortcomings make it difficult to compare measurements at different conditions and between different sensors. If accurate quantitative measurements could be performed, comparisons of the growth and breakdown of instability waves could be made in different facilities, possibly leading to a method of predicting the amplitude at which the waves break down into turbulence, improving transition prediction. A method for calibrating the sensors is proposed using a newly-built shock tube at Purdue University. This shock tube, essentially a half-scale version of the 6-Inch shock tube at the Graduate Aerospace Laboratories at Caltech, has been designed to attain a moderate vacuum in the driven section. Low driven pressures should allow the creation of very weak, yet still relatively thin shock waves. It is expected that static pressure rises within the range of second-mode amplitudes should be possible. The shock tube has been designed to create clean, planar shock waves with a laminar boundary layer to allow for accurate calibrations. Stronger shock waves can be used to identify the frequency response of the sensors out to hundreds of kilohertz.

  4. 27 CFR 31.132 - Change in name or style of business.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Change in name or style of business. 31.132 Section 31.132 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... at a given location must complete an amended registration, and submit it on or before the next July 1...

  5. 7 CFR 1703.132 - Nonapproved purposes for a combination loan and grant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Nonapproved purposes for a combination loan and grant. 1703.132 Section 1703.132 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine...

  6. 40 CFR Appendix B to Part 132 - Great Lakes Water Quality Initiative

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Great Lakes Water Quality Initiative B... WATER QUALITY GUIDANCE FOR THE GREAT LAKES SYSTEM Pt. 132, App. B Appendix B to Part 132—Great Lakes Water Quality Initiative Methodology for Deriving Bioaccumulation Factors Great Lakes States and Tribes...

  7. 46 CFR 132.310 - Fixed fire-extinguishing systems for paint lockers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fixed fire-extinguishing systems for paint lockers. 132... VESSELS FIRE-PROTECTION EQUIPMENT Miscellaneous § 132.310 Fixed fire-extinguishing systems for paint... system or another approved fixed fire-extinguishing system must be installed in each paint locker. (b) No...

  8. 42 CFR 137.132 - How does the Indian Tribe submit a final offer?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false How does the Indian Tribe submit a final offer? 137.132 Section 137.132 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Final Offer § 137...

  9. 11 CFR 100.132 - News story, commentary, or editorial by the media.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false News story, commentary, or editorial by the media. 100.132 Section 100.132 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND... media. Any cost incurred in covering or carrying a news story, commentary, or editorial by any...

  10. 50 CFR 86.132 - What are the advantages to doing a plan?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What are the advantages to doing a plan? 86.132 Section 86.132 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF... advantages to doing a plan? Plans provide the information necessary to fully understand the needs of boaters...

  11. Neuronal activity rapidly induces transcription of the CREB-regulated microRNA-132, in vivo

    DEFF Research Database (Denmark)

    Nudelman, Aaron Samuel; DiRocco, Derek P; Lambert, Talley J

    2010-01-01

    , olfactory bulb, and striatum by contextual fear conditioning, odor-exposure, and cocaine-injection, respectively, also increased pri-miR-132. Induction kinetics of pri-miR-132 were monitored and found to parallel those of immediate early genes, peaking at 45 min and returning to basal levels within 2 h...

  12. IDH-1R132H mutation status in diffuse glioma patients: implications for classification.

    Science.gov (United States)

    Wang, Peng-Fei; Liu, Ning; Song, Hong-Wang; Yao, Kun; Jiang, Tao; Li, Shou-Wei; Yan, Chang-Xiang

    2016-05-24

    WHO2007 grading of diffuse gliomas in adults is well-established. However, IDH mutations make classification of gliomas according to the WHO2007 edition controversial. Here, we characterized IDH-1R132H mut status in a cohort of 670 adult patients with different WHO2007 grades of diffuse glioma. Patient characteristics, clinical data and prognoses were obtained from medical records. Patients with IDH-1R132H mut were younger and had better clinical outcomes than those without mutations. Differences in age among patients with astrocytomas of different WHO2007 grades were eliminated after patients were grouped based on IDH-1R132H status. IDH-1R132H mut was present more often in patients with lower Ki-67 and MGMT protein levels and higher mutant p53 levels. Ki-67 was also strongly associated with WHO2007 grade independently of IDH-1R132H mut status. Moreover, patients with Ki-67IDH-1R132H mut status. Patients in the IDH-1R132H mut group with lower MGMT protein levels also had better clinical outcomes than those in other groups. Our results indicate that to better treat gliomas, IDH mutation status should be included when determining WHO2007 grade in glioma patients.

  13. Luteolin induces microRNA-132 expression and modulates neurite outgrowth in PC12 cells.

    Directory of Open Access Journals (Sweden)

    Lian-Fang Lin

    Full Text Available Luteolin (3',4',5,7-tetrahydroxyflavone, a food-derived flavonoid, has been reported to exert neurotrophic properties that are associated with its capacity to promote neuronal survival and neurite outgrowth. In this study, we report for the first time that luteolin induces the persistent expression of microRNA-132 (miR-132 in PC12 cells. The correlation between miR-132 knockdown and a decrease in luteolin-mediated neurite outgrowth may indicate a mechanistic link by which miR-132 functions as a mediator for neuritogenesis. Furthermore, we find that luteolin led to the phosphorylation and activation of cAMP response element binding protein (CREB, which is associated with the up-regulation of miR-132 and neurite outgrowth. Moreover, luteolin-induced CREB activation, miR-132 expression and neurite outgrowth were inhibited by adenylate cyclase, protein kinase A (PKA and MAPK/ERK kinase 1/2 (MEK1/2 inhibitors but not by protein kinase C (PKC or calcium/calmodulin-dependent protein kinase II (CaMK II inhibitors. Consistently, we find that luteolin treatment increases ERK phosphorylation and PKA activity in PC12 cells. These results show that luteolin induces the up-regulation of miR-132, which serves as an important regulator for neurotrophic actions, mainly acting through the activation of cAMP/PKA- and ERK-dependent CREB signaling pathways in PC12 cells.

  14. Advances in Roles of miR-132 in the Nervous System

    Directory of Open Access Journals (Sweden)

    Yun Qian

    2017-10-01

    Full Text Available miR-132 is an endogenous small RNA and controls post-transcriptional regulation of gene expression via controlled degradation of mRNA or transcription inhibition. In the nervous system, miR-132 is significant for regulating neuronal differentiation, maturation and functioning, and widely participates in axon growth, neural migration, and plasticity. The miR-132 is affected by factors like mRNA expression, functional redundancy, and signaling cascades. It targets multiple downstream molecules to influence physiological and pathological neuronal activities. MiR-132 can influence the pathogenesis of many diseases, especially in the nervous system. The dysregulation of miR-132 results in the occurrence and exacerbation of neural developmental, degenerative diseases, like Alzheimer’s disease, Parkinson’s disease and epilepsy, neural infection and psychiatric disorders including disturbance of consciousness, cognition and memory, depression and schizophrenia. Regulation of miR-132 expression relieves symptoms, alleviates severity and finally effects a cure. This review aims to discuss the clinical potentials of miR-132 in the nervous system.

  15. Transgenic miR132 alters neuronal spine density and impairs novel object recognition memory.

    Directory of Open Access Journals (Sweden)

    Katelin F Hansen

    2010-11-01

    Full Text Available Inducible gene expression plays a central role in neuronal plasticity, learning, and memory, and dysfunction of the underlying molecular events can lead to severe neuronal disorders. In addition to coding transcripts (mRNAs, non-coding microRNAs (miRNAs appear to play a role in these processes. For instance, the CREB-regulated miRNA miR132 has been shown to affect neuronal structure in an activity-dependent manner, yet the details of its physiological effects and the behavioral consequences in vivo remain unclear. To examine these questions, we employed a transgenic mouse strain that expresses miR132 in forebrain neurons. Morphometric analysis of hippocampal neurons revealed that transgenic miR132 triggers a marked increase in dendritic spine density. Additionally, miR132 transgenic mice exhibited a decrease in the expression of MeCP2, a protein implicated in Rett Syndrome and other disorders of mental retardation. Consistent with these findings, miR132 transgenic mice displayed significant deficits in novel object recognition. Together, these data support a role for miR132 as a regulator of neuronal structure and function, and raise the possibility that dysregulation of miR132 could contribute to an array of cognitive disorders.

  16. Pyrolysis result of polyethylene waste as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-02-01

    In this research, the result of pyrolysis on polyethylene was used as fuel for a solid oxide fuel cell (SOFC). The pyrolysis result is a liquid which consists of hydrocarbon chains. According to GC-MS analysis, the hydrocarbons mainly consist of C7 to C20 hydrocarbon chain. Then, the liquid was applied to a single cell of NSDC-L | NSDC | NSDC-L. NSDC is a composite SDC (samarium doped-ceria) with sodium carbonate. Meanwhile, NSDC-L is a composite of NSDC with LiNiCuO (LNC). NSDC and LNC were analyzed by X-ray diffraction to understand their crystal structure. The result shows that presence of carbonate did not change the crystal structure of SDC. SEM EDX analysis for fuel cell before and after being loaded with polyethylene oil to get information of element diffusion to the electrolyte. Meanwhile, the conductivity properties were investigated through impedance measurement. The presence of carbonate even increases the electrical conductivity. The single cell test with the pyrolysis result of polyethylene at 300 - 600 °C, found that the highest power density is at 600 °C with the maximum power density of 0.14 mW/cm2 and open circuit voltage of 0.4 Volt. Elemental analysis at three point spots of single cell NDSC-L |NSDC|NSDC-L found that a migration of ions was occurred during fuel operation at 300 - 600 °C.

  17. Effects of some rare earth and carbonate-based co-dopants on structural and electrical properties of samarium doped ceria (SDC) electrolytes for solid oxide fuel cells

    Science.gov (United States)

    Anwar, Mustafa; Khan, Zuhair S.; Mustafa, Kamal; Rana, Akmal

    2015-09-01

    In the present study, samarium doped ceria (SDC) and SDC-based composite with the addition of K2CO3 were prepared by co-precipitation route and effects of pH of the solution and calcination temperature on microstructure of SDC and SDC-K2CO3, respectively, were investigated. Furthermore, experimentation was performed to investigate into the ionic conductivity of pure SDC by co-doping with yttrium i.e., YSDC, XRD and SEM studies show that the crystallite size and particle size of SDC increases with the increase in pH. The SEM images of all the samples of SDC synthesized at different pH values showed the irregular shaped and dispersed particles. SDC-K2CO3 was calcined at 600∘C, 700∘C and 800∘C for 4 h and XRD results showed that crystallite size increases while lattice strain, decreases with the increase in calcination temperature and no peaks were detected for K2CO3 as it is present in an amorphous form. The ionic conductivity of the electrolytes increases with the increase in temperature and SDC-K2CO3 shows the highest value of ionic conductivity as compared to SDC and YSDC. Chemical compatibility tests were performed between the co-doped electrolyte and lithiated NiO cathode at high temperature. It revealed that the couple could be used up to the temperature of 700∘C.

  18. Calculation of the Dose of Samarium-153-Ethylene Diamine Tetramethylene Phosphonate (153Sm-EDTMP as a Radiopharmaceutical for Pain Relief of bone Metastasis

    Directory of Open Access Journals (Sweden)

    Fatemeh Razghandi

    2016-04-01

    Full Text Available Introduction One of the important applications of nuclear physics in medicine is the use of radioactive elements as radiopharmaceuticals. Metastatic bone disease is the most common form of malignant bone tumors. Samarium-153-ethylene diamine tetramethylene phosphonate (153Sm-EDTMP as a radiopharmaceutical is used for pain palliation. This radiopharmaceutical usually emits beta particles, which have a high uptake in bone tissues. The purpose of this study was to calculate the radiation dose distribution of 153Sm-EDTMP in bone and other tissues, using MCNPX Monte Carlo code in the particle transport model. Materials and Methods Dose delivery to the bone was simulated by seeking radiopharmaceuticals on the bone surface. The phantom model had a simple cylindrical geometry and included bone, bone marrow, and soft tissue. Results The simulation results showed that a significant amount of radiation dose was delivered to the bone by the use of this radiopharmaceutical. Conclusion Thebone acted as a fine protective shield against rays for the bone marrow. Therefore, the trivial absorbed dose by the bone marrow caused less damage to bone-making cells. Also, the high absorbed dose of the bone could destroy cancer cells and relieve the pain in the bone.

  19. Synthesis, quality control and biological evaluation of tris[(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate complex as a therapeutic agent

    Energy Technology Data Exchange (ETDEWEB)

    Naseri, Z.; Kharat, A. Nemati [Tehran Univ. (Iran, Islamic Republic of). Inorganic Chemistry Dept.; Hakimi, A. [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Dept. of Nuclear Engineering, Science and Research Branch; Jalilian, A.R.; Shirvani-Arani, S.; Bahrami-Samani, A.; Ghannadi-Maragheh, M. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (IR). Radiopharmaceutical Research and Development Lab (RRDL)

    2012-07-01

    Therapeutic radiopharmaceuticals are designed to deliver high doses of radiation to selected target organs or tissues with an aim of minimizing unwanted radiation to surrounding healthy tissue. In this work, [tris(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate ({sup 153}Sm-TPTTC) was developed for possible therapeutic properties. The cold compound, i.e. {sup nat}Sm-TPTTC was prepared and characterized by IR, UV, mass and {sup 1}H-NMR spectroscopy. {sup 153}Sm-TPTTC was prepared in two steps using [{sup 153}Sm]SmCl{sub 3}, obtained by neutron activation of an enriched {sup 152}Sm sample. Stability tests, partition coefficient determination, toxicity tests and biodistribution studies of the complex in wild-type and fibrosarcoma-bearing mice were determined. The radiolabeled complex was prepared in high radiochemical purity (> 99% precipitation method) and specific activity of 278 GBq/mmol and demonstrated significant stability at 4, 25 and 37 C (in presence of human serum). Initial complex biodistribution data showed significant liver accumulation in wild-type mice and significant tumor accumulation in fibrosarcoma-bearing mice with tumor:blood and tumor:muscle ratios of 3.55 (2 h) and 38.26 (96 h) respectively. {sup 153}Sm-TPTTC properties suggest an efficient tumor targeting agent with high tumor-avidity. Further investigation on the therapeutic properties must be conducted. (orig.)

  20. Overexpression of microRNA-132 enhances the radiosensitivity of cervical cancer cells by down-regulating Bmi-1.

    Science.gov (United States)

    Liu, Gui-Feng; Zhang, Shu-Hua; Li, Xue-Feng; Cao, Li-Yan; Fu, Zhan-Zhao; Yu, Shao-Nan

    2017-10-06

    We examined the effects of microRNA-132 (miR-132) on Bmi-1 expression and radiosensitivity in HeLa, SiHa, and C33A cervical cancer (CC) cells and 104 CC patients. MiR-132 expression was decreased and Bmi-1 expression was increased in tumor tissues compared to adjacent normal tissues and in radiotherapy-resistant patients compared to radiotherapy-sensitive patients. MiR-132 expression and Bmi-1 mRNA expression were also negatively correlated in tumor tissues. HeLa, SiHa, and C33A cells were divided into blank, miR-132 negative control (NC), miR-132 inhibitor, miR-132 mimics, siBmi-1, and miR-132 inhibitor + siBmi-1 groups, after which expression of miR-132 and Bmi-1, and the interaction between them and cell survival, proliferation, and apoptosis were examined. Bmi-1 was confirmed as a target of miRNA-132. Survival was higher and apoptosis lower in the miR-132 inhibitor group than the blank group after various doses of radiation. By contrast, survival was lower and apoptosis higher in the miRNA-132 mimics and siBmi-1 groups than in the blank group. Moreover, miR-132 expression increased and Bmi-1 mRNA expression decreased in each group at radiation doses of 6 and 8 Gy. Finally, co-administration of radiotherapy and exogenous miR-132 inhibited the growth of HeLa cell transplant-induced tumors in nude mice more effectively than radiotherapy alone. These results suggest overexpression of miR-132 enhances the radiosensitivity of CC cells by down-regulating Bmi-1 and that miR-132 may be a useful new target for the treatment of CC.

  1. Linx individual B132 from north-eastern Switzerland sighted in Trentino (northern Italy

    Directory of Open Access Journals (Sweden)

    Brugnoli A

    2008-10-01

    Full Text Available A subadult lynx was caught in February 2008 in the Swiss National Park, fitted with a Gps-Gsm radio-collar and later genetically identified as B132 - i.e., a male born in 2006 in North-Eastern Switzerland -. B132 is at present located in the western Trentino region, more than 200 km away from his mother's home range. This is the furthest dispersal ever documented outside of Scandinavia for a Eurasian lynx.

  2. 29 CFR 780.132 - Operations must be performed “by” a farmer.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Operations must be performed âbyâ a farmer. 780.132 Section... General Scope of Agriculture Practices Performed âby A Farmerâ § 780.132 Operations must be performed “by... of tobacco, i.e., removing leaves from the stalk, by the employees of an independent warehouse is not...

  3. Destruction of porous spherical Mo132 nanocluster polyoxometallate of keplerate type in aqueous solutions

    Science.gov (United States)

    Ostroushko, A. A.; Tonkushina, M. O.

    2016-02-01

    The mechanism and kinetics of the decomposition of the Mo132 nanocluster polyoxomolybdate (POM) with a keplerate structure in aqueous solutions, including those containing calcium ions, were studied. The destruction mechanism of POM and the lifetime of Mo132 depend on the initial concentration of its solutions, and this, in turn, is related to the thermodynamic factors. The destruction of keplerate can be described as an autocatalytic process. The calcium ions stabilize POM to different degrees depending on their content in solution.

  4. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  5. Effects of proteasome inhibitor MG-132 on the parasite Schistosoma mansoni

    Science.gov (United States)

    de Paula, Renato G.; Ornelas, Alice M. M.; Moreira, Érika B. C.; Badoco, Fernanda Rafacho; Magalhães, Lizandra G.; Verjovski-Almeida, Sergio; Rodrigues, Vanderlei

    2017-01-01

    Proteasome is a proteolytic complex responsible for intracellular protein turnover in eukaryotes, archaea and in some actinobacteria species. Previous work has demonstrated that in Schistosoma mansoni parasites, the proteasome inhibitor MG-132 affects parasite development. However, the molecular targets affected by MG-132 in S. mansoni are not entirely known. Here, we used expression microarrays to measure the genome-wide changes in gene expression of S. mansoni adult worms exposed in vitro to MG-132, followed by in silico functional analyses of the affected genes using Ingenuity Pathway Analysis (IPA). Scanning electron microscopy was used to document changes in the parasites’ tegument. We identified 1,919 genes with a statistically significant (q-value ≤ 0.025) differential expression in parasites treated for 24 h with MG-132, when compared with control. Of these, a total of 1,130 genes were up-regulated and 790 genes were down-regulated. A functional gene interaction network comprised of MG-132 and its target genes, known from the literature to be affected by the compound in humans, was identified here as affected by MG-132. While MG-132 activated the expression of the 26S proteasome genes, it also decreased the expression of 19S chaperones assembly, 20S proteasome maturation, ubiquitin-like NEDD8 and its partner cullin-3 ubiquitin ligase genes. Interestingly, genes that encode proteins related to potassium ion binding, integral membrane component, ATPase and potassium channel activities were significantly down-regulated, whereas genes encoding proteins related to actin binding and microtubule motor activity were significantly up-regulated. MG-132 caused important changes in the worm tegument; peeling, outbreaks and swelling in the tegument tubercles could be observed, which is consistent with interference on the ionic homeostasis in S. mansoni. Finally, we showed the down-regulation of Bax pro-apoptotic gene, as well as up-regulation of two apoptosis

  6. Effects of proteasome inhibitor MG-132 on the parasite Schistosoma mansoni.

    Directory of Open Access Journals (Sweden)

    Enyara R Morais

    Full Text Available Proteasome is a proteolytic complex responsible for intracellular protein turnover in eukaryotes, archaea and in some actinobacteria species. Previous work has demonstrated that in Schistosoma mansoni parasites, the proteasome inhibitor MG-132 affects parasite development. However, the molecular targets affected by MG-132 in S. mansoni are not entirely known. Here, we used expression microarrays to measure the genome-wide changes in gene expression of S. mansoni adult worms exposed in vitro to MG-132, followed by in silico functional analyses of the affected genes using Ingenuity Pathway Analysis (IPA. Scanning electron microscopy was used to document changes in the parasites' tegument. We identified 1,919 genes with a statistically significant (q-value ≤ 0.025 differential expression in parasites treated for 24 h with MG-132, when compared with control. Of these, a total of 1,130 genes were up-regulated and 790 genes were down-regulated. A functional gene interaction network comprised of MG-132 and its target genes, known from the literature to be affected by the compound in humans, was identified here as affected by MG-132. While MG-132 activated the expression of the 26S proteasome genes, it also decreased the expression of 19S chaperones assembly, 20S proteasome maturation, ubiquitin-like NEDD8 and its partner cullin-3 ubiquitin ligase genes. Interestingly, genes that encode proteins related to potassium ion binding, integral membrane component, ATPase and potassium channel activities were significantly down-regulated, whereas genes encoding proteins related to actin binding and microtubule motor activity were significantly up-regulated. MG-132 caused important changes in the worm tegument; peeling, outbreaks and swelling in the tegument tubercles could be observed, which is consistent with interference on the ionic homeostasis in S. mansoni. Finally, we showed the down-regulation of Bax pro-apoptotic gene, as well as up-regulation of two

  7. SU-C-201-06: Utility of Quantitative 3D SPECT/CT Imaging in Patient Specific Internal Dosimetry of 153-Samarium with GATE Monte Carlo Package

    Energy Technology Data Exchange (ETDEWEB)

    Fallahpoor, M; Abbasi, M [Tehran University of Medical Sciences, Vali-Asr Hospital, Tehran, Tehran (Iran, Islamic Republic of); Sen, A [University of Houston, Houston, TX (United States); Parach, A [Shahid Sadoughi University of Medical Sciences, Yazd, Yazd (Iran, Islamic Republic of); Kalantari, F [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: Patient-specific 3-dimensional (3D) internal dosimetry in targeted radionuclide therapy is essential for efficient treatment. Two major steps to achieve reliable results are: 1) generating quantitative 3D images of radionuclide distribution and attenuation coefficients and 2) using a reliable method for dose calculation based on activity and attenuation map. In this research, internal dosimetry for 153-Samarium (153-Sm) was done by SPECT-CT images coupled GATE Monte Carlo package for internal dosimetry. Methods: A 50 years old woman with bone metastases from breast cancer was prescribed 153-Sm treatment (Gamma: 103keV and beta: 0.81MeV). A SPECT/CT scan was performed with the Siemens Simbia-T scanner. SPECT and CT images were registered using default registration software. SPECT quantification was achieved by compensating for all image degrading factors including body attenuation, Compton scattering and collimator-detector response (CDR). Triple energy window method was used to estimate and eliminate the scattered photons. Iterative ordered-subsets expectation maximization (OSEM) with correction for attenuation and distance-dependent CDR was used for image reconstruction. Bilinear energy mapping is used to convert Hounsfield units in CT image to attenuation map. Organ borders were defined by the itk-SNAP toolkit segmentation on CT image. GATE was then used for internal dose calculation. The Specific Absorbed Fractions (SAFs) and S-values were reported as MIRD schema. Results: The results showed that the largest SAFs and S-values are in osseous organs as expected. S-value for lung is the highest after spine that can be important in 153-Sm therapy. Conclusion: We presented the utility of SPECT-CT images and Monte Carlo for patient-specific dosimetry as a reliable and accurate method. It has several advantages over template-based methods or simplified dose estimation methods. With advent of high speed computers, Monte Carlo can be used for treatment planning

  8. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO2) thin films using electron beam evaporation

    Science.gov (United States)

    Kundu, Subrata; Sutradhar, Narottam; Thangamuthu, R.; Subramanian, B.; Panda, Asit Baran; Jayachandran, M.

    2012-08-01

    Samarium (Sm)-doped cerium oxide (CeO2) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ( 300 or 500 °C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO2 nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO2 nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH4. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO2 thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.

  9. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films using electron beam evaporation

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Subrata, E-mail: skundu@cecri.res.in [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Sutradhar, Narottam [G. B. Marg, Central Salt and Marine Chemical Research Institute - CSIR (India); Thangamuthu, R.; Subramanian, B. [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Panda, Asit Baran [G. B. Marg, Central Salt and Marine Chemical Research Institute (CSIR) (India); Jayachandran, M., E-mail: mjayam54@yahoo.com [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India)

    2012-08-15

    Samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ({approx}300 or 500 Degree-Sign C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO{sub 2} nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO{sub 2} nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH{sub 4}. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO{sub 2} thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.Graphical Abstract.

  10. Identification of the first surrogate agonists for the G protein-coupled receptor GPR132

    DEFF Research Database (Denmark)

    Shehata, Mohamed A.; Christensen, Hanna Belcik; Isberg, Vignir

    2015-01-01

    GPR132 is an orphan class A G protein-coupled receptor. It has been proposed to be activated by protons and to regulate apoptosis, atherosclerosis and inflammation, but these results are still preliminary. In the current work, we designed and screened a focused compound library using a β-arrestin......GPR132 is an orphan class A G protein-coupled receptor. It has been proposed to be activated by protons and to regulate apoptosis, atherosclerosis and inflammation, but these results are still preliminary. In the current work, we designed and screened a focused compound library using a β......-arrestin recruitment assay, and thereby identified the first disclosed surrogate GPR132 agonist 1 with a potency of 3.4 μM. This constitutes the first available pharmacological tool for the in vitro characterization of the orphan receptor GPR132. The testing of 32 analogs furthermore identified a number of compounds...... with lower activity – of which six were agonists and two were antagonists – that were used to construct preliminary structure–activity relationships. Docking followed by a molecular dynamics simulation of compound 1 in a structural model of GPR132 displayed the putative interactions for the key ligand...

  11. Memory formation and retention are affected in adult miR-132/212 knockout mice.

    Science.gov (United States)

    Hernandez-Rapp, Julia; Smith, Pascal Y; Filali, Mohammed; Goupil, Claudia; Planel, Emmanuel; Magill, Stephen T; Goodman, Richard H; Hébert, Sébastien S

    2015-01-01

    The miR-132/212 family is thought to play an important role in neural function and plasticity, while its misregulation has been observed in various neurodegenerative disorders. In this study, we analyzed 6-month-old miR-132/212 knockout mice in a battery of cognitive and non-cognitive behavioral tests. No significant changes were observed in reflexes and basic sensorimotor functions as determined by the SHIRPA primary screen. Accordingly, miR-132/212 knockout mice did not differ from wild-type controls in general locomotor activity in an open-field test. Furthermore, no significant changes of anxiety were measured in an elevated plus maze task. However, the mutant mice showed retention phase defects in a novel object recognition test and in the T-water maze. Moreover, the learning and probe phases in the Barnes maze were clearly altered in knockout mice when compared to controls. Finally, changes in BDNF, CREB, and MeCP2 were identified in the miR-132/212-deficient mice, providing a potential mechanism for promoting memory loss. Taken together, these results further strengthen the role of miR-132/212 in memory formation and retention, and shed light on the potential consequences of its deregulation in neurodegenerative diseases. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Generation and Performance of R132H Mutant IDH1 Rabbit Monoclonal Antibody

    Directory of Open Access Journals (Sweden)

    Juliet Rashidian

    2017-12-01

    Full Text Available Isocitrate dehydrogenase 1 (IDH1 gene mutations have been observed in a majority of diffuse astrocytomas, oligodendrogliomas, and secondary glioblastomas, and the mutant IDH1 R132H is detectable in most of these lesions. By specifically targeting the R132H mutation through B-cell cloning, a novel rabbit monoclonal antibody, MRQ-67, was produced that can recognize mutant IDH1 R132H and does not react with the wild type protein as demonstrated by Enzyme-linked immunosorbent assay (ELISA and Western blotting. Through immunohistochemistry, the antibody is able to highlight neoplastic cells in glioma tissue specimens, and can be used as a tool in glioma subtyping. Immunohistochemistry (IHC detection of IDH1 mutant protein may also be used to visualize single infiltrating tumor cells in surrounding brain tissue with an otherwise normal appearance.

  13. microRNA-132: a key noncoding RNA operating in the cellular phase of Alzheimer's disease.

    Science.gov (United States)

    Salta, Evgenia; De Strooper, Bart

    2017-02-01

    With the consideration of the broad involvement of microRNAs (miRNAs) in the regulation of molecular networks in the brain, it is not surprising that miRNA dysregulation causes neurodegeneration in animal models. miRNA profiling in the human brain has revealed miR-132 as one of the most severely down-regulated miRNAs at the intermediate and late Braak stages of Alzheimer's disease (AD), as well as in other neurodegenerative disorders. Suppression of miR-132 aggravates multiple layers of pathology at the molecular and functional level. We describe the potential therapeutic implications of these findings and suggest miRNA targeting or replacement as a realistic multi-hit, therapeutic strategy for AD. Salta, E., De Strooper, B. microRNA-132: a key noncoding RNA operating in the cellular phase of Alzheimer's disease. © FASEB.

  14. Establishment of replacement International Standard 13/132 for human antibodies to Toxoplasma gondii.

    Science.gov (United States)

    Rijpkema, Sjoerd; Hockley, Jason; Rigsby, Peter; Guy, Edward C

    2016-09-01

    Sixteen laboratories carried out a collaborative study to validate 13/132 as a replacement International Standard (IS) for TOXM (3rd IS for anti-Toxoplasma Serum, Human, 1000 IU). 13/132 is a freeze dried preparation of pooled human plasma from six donors who experienced a recent Toxoplasma gondii infection. The potency of 13/132 was compared to TOXM and 01/600 (1st IS for anti-Toxoplasma IgG, Human, 20 IU). Samples were tested for IgA, IgG, IgG avidity and IgM in agglutination assays; enzyme linked immunosorbent assays (ELISA), enzyme linked fluorescent assays, immunoblots, immunofluorescence assays and the Sabin-Feldman dye test for Ig. 13/132 was strongly positive for Ig, IgA, IgG and IgM and the reproducibility was very good. 13/132 contains high levels of anti-Toxoplasma Ig, IgG and IgM and its potency falls between TOXM and 01/600. The avidity of IgG was found to be low, similar to the avidity of IgG from TOXM. 13/132 was established by the Expert Committee on Biological Standardization as the 4th IS for Antibodies, Human, to T. gondii with an assigned unitage of 160 IU per ampoule for Ig by dye test and 263 U per ampoule for IgG by ELISA. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. The Mexican #YoSoy132: the (unexpected) emergence of an activist network

    OpenAIRE

    Guiomar Rovira Sancho

    2014-01-01

    The movement #YoSoy132 in Mexico began in May 2012. It represented an uncontainable social eruption, a self-gener­ated call to action which took to the streets and squares of the country’s main towns and cities. This article seeks to highlight the specific nature of these protests by examining the collective action and the experience of the use of infor­mation and communication technologies (ICT). As an activist network, #YoSoy132 developed within a cycle of protests that simultaneously creat...

  16. Kinetic energy dependence of fission fragment isomeric ratios for spherical nuclei 132Sn

    Science.gov (United States)

    Chebboubi, A.; Kessedjian, G.; Litaize, O.; Serot, O.; Faust, H.; Bernard, D.; Blanc, A.; Köster, U.; Méplan, O.; Mutti, P.; Sage, C.

    2017-12-01

    Isomeric ratios are a powerful observable to investigate fission fragment total angular momenta. A recent experimental campaign achieved at the LOHENGRIN spectrometer, shows a kinetic energy dependence of μs isomeric ratios from fission fragments populated in neutron induced fission of 235U. For the first time, this dependence was measured for the isomeric ratio of the doubly magic 132Sn. A Bayesian assessment of the angular momentum distribution of 132Sn is proposed according to calculations performed with the FIFRELIN code and interpreted with spin generation models.

  17. Crystal structure of monoclinic samarium and cubic europium sesquioxides and bound coherent neutron scattering lengths of the isotopes {sup 154}Sm and {sup 153}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Kohlmann, Holger [Leipzig Univ. (Germany). Inst. of Inorganic Chemistry; Hein, Christina; Kautenburger, Ralf [Saarland Univ., Saarbruecken (Germany). Inorganic Solid State Chemistry; Hansen, Thomas C.; Ritter, Clemens [Institut Laue-Langevin, Grenoble (France); Doyle, Stephen [Karlsruhe Institute of Technology, Eggenstein-Leopoldshafen (Germany). Inst. for Synchrotron Radiation (ISS)

    2016-11-01

    The crystal structures of monoclinic samarium and cubic europium sesquioxide, Sm{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}, were reinvestigated by powder diffraction methods (laboratory X-ray, synchrotron, neutron). Rietveld analysis yields more precise structural parameters than previously known, especially for oxygen atoms. Interatomic distances d(Sm-O) in Sm{sub 2}O{sub 3} range from 226.3(4) to 275.9(2) pm [average 241.6(3) pm] for the monoclinic B type Sm{sub 2}O{sub 3} [space group C2/m, a = 1418.04(3) pm, b = 362.660(7) pm, c = 885.48(2) pm, β = 100.028(1) ], d(Eu-O) in Eu{sub 2}O{sub 3} from 229.9(2) to 238.8(2) pm for the cubic bixbyite (C) type [space group Ia anti 3, a = 1086.87(1) pm]. Neutron diffraction at 50 K and 2 K did not show any sign for magnetic ordering in Sm{sub 2}O{sub 3}. Isotopically enriched {sup 154}Sm{sub 2}O{sub 3} and {sup 153}Eu{sub 2}O{sub 3} were used for the neutron diffraction work because of the enormous absorption cross section of the natural isotopic mixtures for thermal neutrons. The isotopic purity was determined by inductively coupled plasma - mass spectrometry to be 98.9% for {sup 154}Sm and 99.8% for {sup 153}Eu. Advanced analysis of the neutron diffraction data suggest that the bound coherent scattering lengths of {sup 154}Sm and {sup 153}Eu need to be revised. We tentatively propose b{sub c}({sup 154}Sm) = 8.97(6) fm and b{sub c}({sup 153}Eu) = 8.85(3) fm for a neutron wavelength of 186.6 pm to be better values for these isotopes, showing up to 8% deviation from accepted literature values. It is shown that inaccurate scattering lengths may result in severe problems in crystal structure refinements causing erroneous structural details such as occupation parameters, which might be critically linked to physical properties like superconductivity in multinary oxides.

  18. 9 CFR 2.132 - Procurement of dogs, cats, and other animals; dealers.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Procurement of dogs, cats, and other... SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE REGULATIONS Miscellaneous § 2.132 Procurement of dogs, cats, and other animals; dealers. (a) A class “B” dealer may obtain live random source dogs and cats...

  19. Cluster radioactivity leading to doubly magic 100Sn and 132Sn ...

    Indian Academy of Sciences (India)

    Cluster radioactivity leading to doubly magic 100Sn and 132Sn daughters. K P SANTHOSH. School of Pure and Applied Physics, Kannur University, Payyanur Campus,. Payyanur 670 327, India. E-mail: drkpsanthosh@gmail.com. MS received 1 June 2010; revised 13 August 2010; accepted 8 September 2010. Abstract.

  20. A Mechanistic Study of Hydroboration of 1-Octene with 1,3,2 ...

    African Journals Online (AJOL)

    NJD

    ethylenedithio)bis-(1,3,2-dithiaborolane) (5). (Scheme 2) with a 50 % yield (Table 1, Entry 1). The same .... of the reagent had no effect on the hydroborating activity of the reagent. ... atom, which makes the boron atom less electropositive, thus.

  1. Coulomb excitation of doubly magic $^{132}$Sn with MINIBALL at HIE-ISOLDE

    CERN Multimedia

    We propose to study the vibrational first 2$^{+}$ and 3$^{-}$ states of the doubly magic nucleus $^{132}$ Sn via Coulomb excitation using the HIE-ISOLDE facility coupled with the highly efficient MINIBALL array. The intense $^{132}$Sn beam at ISOLDE, the high beam energy of HIE-ISOLDE, the high energy resolution and good efficiency of the MINIBALL provide a unique combination and favourable advantages to master this demanding measurement. Reliable B(E2;0$^{+}\\rightarrow$ 2$^{+}$) values for neutron deficient $^{106,108,110}$Sn were obtained with the MINIBALL at REX-ISOLDE. These measurements can be extended up to and beyond the shell closure at the neutron-rich side with $^{132}$Sn. The results on excited collective states in $^{132}$Sn will provide crucial information on 2p-2h cross shell configurations which are expected to be dominated by a strong proton contribution. Predictions are made within various large scale shell model calculations and new mean field calculations within the framework of different a...

  2. 42 CFR 460.132 - Quality assessment and performance improvement plan.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Quality assessment and performance improvement plan...-INCLUSIVE CARE FOR THE ELDERLY (PACE) Quality Assessment and Performance Improvement § 460.132 Quality assessment and performance improvement plan. (a) Basic rule. A PACE organization must have a written quality...

  3. Angiotensin II Regulates microRNA-132/-212 in Hypertensive Rats and Humans

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Jeppesen, Pia L; Schneider, Mikael

    2013-01-01

    analyzed tissue samples of mammary artery obtained from surplus arterial tissue after coronary bypass operations. Indeed, we found a decrease in expression levels of miR-132 and miR-212 in human arteries from bypass-operated patients treated with AT1R blockers, whereas treatment with β-blockers had...

  4. 31 CFR 1.32 - Use and disclosure of social security numbers.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Use and disclosure of social security... OF RECORDS Privacy Act § 1.32 Use and disclosure of social security numbers. (a) In general. An... such individual's refusal to disclose his social security number. (b) Exceptions. The provisions of...

  5. 5,5-Dimethyl-2-methylseleno-1,3,2-dioxaphosphorinan-2-one

    Directory of Open Access Journals (Sweden)

    Grzegorz Cholewinski

    2010-04-01

    Full Text Available The title compound, C6H13O3PSe, was obtained in the reaction of 5,5-dimethyl-2-oxo-2-seleno-1,3,2-dioxaphosphorinane potassium salt with methyl iodide. The selenomethyl group is in the axial position in relation to the six-membered dioxaphosphorinane ring.

  6. Hesperidin Alleviates Lipopolysaccharide-Induced Neuroinflammation in Mice by Promoting the miRNA-132 Pathway.

    Science.gov (United States)

    Li, Min; Shao, Huanzhang; Zhang, Xia; Qin, Bingyu

    2016-10-01

    Previous studies have demonstrated that hesperidin, a flavanone glycoside from citrus fruits, produces antidepressant-like effects in both mice and rats. However, whether these effects are mediated by pro-inflammatory cytokines remains unknown. In the present study, we attempted to investigate the effects of hesperidin on the depressive-like behavior; the serum corticosterone concentrations; and the interleukin (IL)-1β, IL-6, and tumor necrosis factor alpha (TNF-α) levels in lipopolysaccharide (LPS)-induced depression-like mice. In particular, we evaluated the miRNA-132 expression after LPS and hesperidin treatment. We found that LPS injection not only decreased the sucrose preference and increased the serum corticosterone levels but also elevated IL-1β, IL-6, and TNF-α in the prefrontal cortex. More importantly, LPS down-regulated the expression of miRNA-132. Pre-treatment with hesperidin (25, 50, 100 mg/kg) for 7 days prevented these abnormalities induced by LPS injection. In contrast, this effect of hesperidin was abolished by a miRNA-132 antagomir. Taken together, these results suggest that the antidepressant-like mechanisms of hesperidin are at least partially related to decreased pro-inflammatory cytokine levels via the miRNA-132 pathway in the brain.

  7. 2-Substituted-1,3,2-dithioborolans as Chiral Lewis Acid Catalysts

    Directory of Open Access Journals (Sweden)

    Paul Glynn

    2000-08-01

    Full Text Available 1,3,2-Dithioborolans substituted at the 2-position with various homochiral groups can act as chiral Lewis acids in the Diels-Alder reaction between crotonaldehyde or methacrolein with cyclopentadiene. The endo:exo selectivities obtained were good although the enantiomeric excesses were low to moderate.

  8. P132

    Directory of Open Access Journals (Sweden)

    M. Chernyavskaya

    2015-11-01

    4.A significant increase in IL-10 may indicate the severity of the local immunosuppression induced by tumor growth in the mechanisms of choroidal melanoma. A significant positive relationship between the concentrations of IL-4, IL-6, IL-8, IL-10, AAB to Ag of nDNA in the lacrimal liquids of eye and paired “healthy” eye was found in patients with choroidal melanoma.

  9. Systemic analysis of heat shock response induced by heat shock and a proteasome inhibitor MG132.

    Directory of Open Access Journals (Sweden)

    Hee-Jung Kim

    Full Text Available The molecular basis of heat shock response (HSR, a cellular defense mechanism against various stresses, is not well understood. In this, the first comprehensive analysis of gene expression changes in response to heat shock and MG132 (a proteasome inhibitor, both of which are known to induce heat shock proteins (Hsps, we compared the responses of normal mouse fibrosarcoma cell line, RIF-1, and its thermotolerant variant cell line, TR-RIF-1 (TR, to the two stresses. The cellular responses we examined included Hsp expressions, cell viability, total protein synthesis patterns, and accumulation of poly-ubiquitinated proteins. We also compared the mRNA expression profiles and kinetics, in the two cell lines exposed to the two stresses, using microarray analysis. In contrast to RIF-1 cells, TR cells resist heat shock caused changes in cell viability and whole-cell protein synthesis. The patterns of total cellular protein synthesis and accumulation of poly-ubiquitinated proteins in the two cell lines were distinct, depending on the stress and the cell line. Microarray analysis revealed that the gene expression pattern of TR cells was faster and more transient than that of RIF-1 cells, in response to heat shock, while both RIF-1 and TR cells showed similar kinetics of mRNA expression in response to MG132. We also found that 2,208 genes were up-regulated more than 2 fold and could sort them into three groups: 1 genes regulated by both heat shock and MG132, (e.g. chaperones; 2 those regulated only by heat shock (e.g. DNA binding proteins including histones; and 3 those regulated only by MG132 (e.g. innate immunity and defense related molecules. This study shows that heat shock and MG132 share some aspects of HSR signaling pathway, at the same time, inducing distinct stress response signaling pathways, triggered by distinct abnormal proteins.

  10. MiR-132 suppresses the migration and invasion of lung cancer cells via targeting the EMT regulator ZEB2.

    Directory of Open Access Journals (Sweden)

    Jiacong You

    Full Text Available MicroRNAs (miRNAs are small, non-coding RNAs which can function as oncogenes or tumor suppressor genes in human cancers. Emerging evidence reveals that deregulation of miRNAs contributes to the human non-small cell lung cancer (NSCLC. In the present study, we demonstrated that the expression levels of miR-132 were dramatically decreased in examined NSCLC cell lines and clinical NSCLC tissue samples. Then, we found that introduction of miR-132 significantly suppressed the migration and invasion of lung cancer cells in vitro, suggesting that miR-132 may be a novel tumor suppressor. Further studies indicated that the EMT-related transcription factor ZEB2 was one direct target genes of miR-132, evidenced by the direct binding of miR-132 with the 3' untranslated region (3' UTR of ZEB2. Further, miR-132 could decrease the expression of ZEB2 at the levels of mRNA and protein. Notably, the EMT marker E-cadherin or vimentin, a downstream of ZEB2, was also down-regulated or up-regulated upon miR-132 treatment. Additionally, over-expressing or silencing ZEB2 was able to elevate or inhibit the migration and invasion of lung cancer cells, parallel to the effect of miR-132 on the lung cancer cells. Meanwhile, knockdown of ZEB2 reversed the enhanced migration and invasion mediated by anti-miR-132. These results indicate that miR-132 suppresses the migration and invasion of NSCLC cells through targeting ZEB2 involving the EMT process. Thus, our finding provides new insight into the mechanism of NSCLC progression. Therapeutically, miR-132 may serve as a potential target in the treatment of human lung cancer.

  11. A monoclonal antibody IMab-1 specifically recognizes IDH1{sup R132H}, the most common glioma-derived mutation

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Yukinari, E-mail: yukinari-k@bea.hi-ho.ne.jp [Department of Pathology, Duke University Medical Center, DUMC-3156, Durham, NC 27710 (United States); The Oncology Research Center, Research Institute for Advanced Molecular Epidemiology, Yamagata University, 2-2-2 Iida-nishi, Yamagata 990-9585 (Japan); Jin, Genglin; Kuan, Chien-Tsun; McLendon, Roger E.; Yan, Hai; Bigner, Darell D. [Department of Pathology, Duke University Medical Center, DUMC-3156, Durham, NC 27710 (United States)

    2009-12-18

    IDH1 (isocitrate dehydrogenase 1) mutations have been identified as early and frequent genetic alterations in astrocytomas, oligodendrogliomas, and oligoastrocytomas as well as secondary glioblastomas. In contrast, primary glioblastomas very rarely contain IDH1 mutations, although primary and secondary glioblastomas are histologically indistinguishable. The IDH1 mutations are remarkably specific to a single codon in the conserved and functionally important Arg132 in IDH1. In gliomas, the most frequent IDH1 mutations (>90%) were G395A (R132H). In this study, we immunized mice with R132H-containing IDH1 (IDH1{sup R132H}) peptide. After cell fusion using Sendai virus envelope, the monoclonal antibodies (mAbs), which specifically reacted with IDH1{sup R132H}, were screened in ELISA. One of the mAbs, IMab-1 reacted with the IDH1{sup R132H} peptide, but not with wild type IDH1 (IDH1{sup wt}) peptide in ELISA. In Western-blot analysis, IMab-1 reacted with only the IDH1{sup R132H} protein, not IDH1{sup wt} protein or the other IDH1 mutants, indicating that IMab-1 is IDH1{sup R132H}-specific. Furthermore, IMab-1 specifically stained the IDH1{sup R132H}-expressing cells in astrocytomas in immunohistochemistry, whereas it did not react with IDH1{sup R132H}-negative primary glioblastoma sections. In conclusion, we established an anti-IDH1{sup R132H}-specific monoclonal antibody IMab-1, which should be significantly useful for diagnosis and biological evaluation of mutation-bearing gliomas.

  12. Post-fusion treatment with MG132 increases transcription factor expression in somatic cell nuclear transfer embryos in pigs.

    Science.gov (United States)

    You, Jinyoung; Lee, Joohyeong; Kim, Jinyoung; Park, Junhong; Lee, Eunsong

    2010-02-01

    The objective of this study was to examine the effect of post-fusion treatment of somatic cell nuclear transfer (SCNT) oocytes with the proteasomal inhibitor MG132 on maturation promoting factor (MPF) activity, nuclear remodeling, embryonic development, and gene expression of cloned pig embryos. Immediately after electrofusion, SCNT oocytes were treated with MG132 and/or caffeine for 2 hr, vanadate for 0.5 hr, or vanadate for 0.5 hr followed by MG132 for 1.5 hr. Of the MG132 concentrations tested (0-5 microM), the 1 microM concentration showed a higher rate of blastocyst formation (25.9%) than 0 (14.2%), 0.5 (16.9%), and 5 microM (16.9%). Post-fusion treatment with MG132, caffeine, and both MG132 and caffeine improved blastocyst formation (22.1%, 21.4%, and 24.4%, respectively), whereas vanadate treatment inhibited blastocyst formation (6.5%) compared to the control (11.1%). When examined 2 hr after fusion and 1 hr after activation, MPF activity remained at a higher (P fusion with caffeine and/or MG132, but it was decreased by vanadate. The rate of oocytes showing premature chromosome condensation was not altered by MG132 but was decreased by vanadate treatment. In addition, formation of single pronuclei was increased by MG132 compared to control and vanadate treatment. MG132-treated embryos showed increased expression of POU5F1, DPPA2, DPPA3, DPPA5, and NDP52l1 genes compared to control embryos. Our results demonstrate that post-fusion treatment of SCNT oocytes with MG132 prevents MPF degradation and increases expression of transcription factors in SCNT embryos, which are necessary for normal development of SCNT embryos. (c) 2009 Wiley-Liss, Inc.

  13. MiR-132 prohibits proliferation, invasion, migration, and metastasis in breast cancer by targeting HN1

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhan-Guo, E-mail: zhang_zhanguo@hotmail.com; Chen, Wei-Xun, E-mail: chenweixunclark@163.com; Wu, Yan-Hui, E-mail: wuyanhui84@126.com; Liang, Hui-Fang, E-mail: lianghuifang1997@126.com; Zhang, Bi-Xiang, E-mail: bixiangzhang@163.com

    2014-11-07

    Highlights: • MiR-132 is down-regulated in breast cancer tissues and cell lines. • MiR-132 directly regulates HN1 by binding its 3′ UTR. • MiR-132 shows regulatory role in proliferation, invasion, migration and metastasis. • HN1 is involved in miR-132-mediated cell behavior. • Aberrant HN1 is associated with worse overall survival of breast cancer patients. - Abstract: Accumulating evidence indicates that miRNAs play critical roles in tumorigenesis and cancer progression. This study aims to investigate the role and the underlying mechanism of miR-132 in breast cancer. Here, we report that miR-132 is significantly down-regulated in breast cancer tissues and cancer cell lines. Additional study identifies HN1 as a novel direct target of miR-132. MiR-132 down-regulates HN1 expression by binding to the 3′ UTR of HN1 transcript, thereby, suppressing multiple oncogenic traits such as cancer cell proliferation, invasion, migration and metastasis in vivo and in vitro. Overexpression of HN1 restores miR-132-suppressed malignancy. Importantly, higher HN1 expression is significantly associated with worse overall survival of breast cancer patients. Taken together, our data demonstrate a critical role of miR-132 in prohibiting cell proliferation, invasion, migration and metastasis in breast cancer through direct suppression of HN1, supporting the potential utility of miR-132 as a novel therapeutic strategy against breast cancer.

  14. Highly CO2-Tolerant Cathode for Intermediate-Temperature Solid Oxide Fuel Cells: Samarium-Doped Ceria-Protected SrCo0.85Ta0.15O3-δ Hybrid.

    Science.gov (United States)

    Li, Mengran; Zhou, Wei; Zhu, Zhonghua

    2017-01-25

    Susceptibility to CO2 is one of the major challenges for the long-term stability of the alkaline-earth-containing cathodes for intermediate-temperature solid oxide fuel cells. To alleviate the adverse effects from CO2, we incorporated samarium-stabilized ceria (SDC) into a SrCo0.85Ta0.15O3-δ (SCT15) cathode by either mechanical mixing or a wet impregnation method and evaluated their cathode performance stability in the presence of a gas mixture of 10% CO2, 21% O2, and 69% N2. We observed that the CO2 tolerance of the hybrid cathode outperforms the pure SCT15 cathode by over 5 times at 550 °C. This significant enhancement is likely attributable to the low CO2 adsorption and reactivity of the SDC protective layer, which are demonstrated through thermogravimetric analysis, energy-dispersive spectroscopy, and electrical conductivity study.

  15. 27 CFR 53.132 - Tax-free sale of articles to be used for, or resold for, further manufacture.

    Science.gov (United States)

    2010-04-01

    ... to be used for, or resold for, further manufacture. 53.132 Section 53.132 Alcohol, Tobacco Products... articles to be used for, or resold for, further manufacture. (a) Further manufacture—(1) In general. Under... manufacturer, pursuant to section 4221(a)(1) of the Code, for use by the purchaser in further manufacture, or...

  16. 10 CFR 60.132 - Additional design criteria for surface facilities in the geologic repository operations area.

    Science.gov (United States)

    2010-01-01

    ... applicable. (e) Consideration of decommissioning. The surface facility shall be designed to facilitate... 10 Energy 2 2010-01-01 2010-01-01 false Additional design criteria for surface facilities in the geologic repository operations area. 60.132 Section 60.132 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED...

  17. 27 CFR 478.132 - Dispositions of semiautomatic assault weapons and large capacity ammunition feeding devices to...

    Science.gov (United States)

    2010-04-01

    ... semiautomatic assault weapons and large capacity ammunition feeding devices to law enforcement officers for official use and to employees or contractors of nuclear facilities. 478.132 Section 478.132 Alcohol... assault weapons and large capacity ammunition feeding devices to law enforcement officers for official use...

  18. Charge radius change in the heavy tin isotopes until A=132 from laser spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Le Blanc, F.; Essabaa, S.; Obert, J.; Oms, J.; Ouchrif, A. [Institut de Physique Nucleaire, IN2P3-CNRS, 91406 Orsay cedex (France); Cabaret, L. [Laboratoire Aime Cotton, 91405 Orsay cedex (France); Crawford, J.E.; Lee, J.K.P. [Physics Department, Mc Gill University, H3A2T8 Montreal (Canada); Fedoseyev, V.; Mishin, V. [Institute for Spectroscopy, Troisk (Russian Federation); Geithner, W.; Horn, R.; Huber, G.; Kappertz, S.; Lassen, J.; Neugart, R. [Institut fuer Physik der Universitaet Mainz, 55099 Mainz (Germany); Genevey, J. [Institut des Sciences Nucleaires, Universite Joseph Fourier, 38026 Grenoble cedex (France); Girod, M.; Peru, S. [Service de Physique et Techniques Nucleaires, CEA, BP 12, 91680 Bruyeres-le-Chatel (France); Le Scornet, G. [CERN, 1211 Geneve 23 (Switzerland); Pinard, J.; Ravn, H.; Roussiere, B.; Sauvage, J.; Verney, D.

    2002-10-01

    Laser spectroscopy measurements have been carried out on the very neutron-rich tin isotopes with the COMPLIS experimental setup. Using the 5s{sup 2}5p{sup 23}P{sub 0} {yields} 5s{sup 2}5p6s{sup 3}P{sub 1} optical transition, hyperfine spectra of {sup 126-132}Sn and {sup 125m,127m,129m-131m}Sn where recorded for the first time. The variation of the mean-square charge radius ({delta} left angle r {sup 2} right angle) between these nuclei and nuclear moments of the isomers and the odd isotopes were thus measured. An odd-even staggering which inverts at A=130 is clearly observed. This indicates a small appearance of a plateau on the {delta} left angle r {sup 2} right angle which has to be confirmed by measuring the isotope shift beyond A=132. (orig.)

  19. Recapture of lynx individual B132 in the Trentino province, Italy

    Directory of Open Access Journals (Sweden)

    Brugnoli A

    2010-10-01

    Full Text Available In February 2010, B132 - a male lynx born in 2006 in north-eastern Switzerland - was recaptured in a box trap set above Molveno Lake, in Brenta Massif eastern slopes, and fit with a new GPS/GSM radiocollar by staff members of the Forest and Wildlife Service of the Autonomous Province of Trento. His 2008 dispersal into the Adamello-Brenta Natural Park area in the Trentino province was the furthest one ever documented outside of Scandinavia for a Eurasian lynx. The complete recovery of the lynx in the entire Alpine arc, after 40 years since the first reintroduction, will be a long-term task, and documentation of B132’s dispersal and spatial behaviour is of crucial interest in this respect.

  20. Replication and meta-analysis of TMEM132D gene variants in panic disorder

    DEFF Research Database (Denmark)

    Erhardt, A; Akula, N; Schumacher, J

    2012-01-01

    A recent genome-wide association study in patients with panic disorder (PD) identified a risk haplotype consisting of two single-nucleotide polymorphisms (SNPs) (rs7309727 and rs11060369) located in intron 3 of TMEM132D to be associated with PD in three independent samples. Now we report a subseq......A recent genome-wide association study in patients with panic disorder (PD) identified a risk haplotype consisting of two single-nucleotide polymorphisms (SNPs) (rs7309727 and rs11060369) located in intron 3 of TMEM132D to be associated with PD in three independent samples. Now we report...... a subsequent confirmation study using five additional PD case-control samples (n = 1670 cases and n = 2266 controls) assembled as part of the Panic Disorder International Consortium (PanIC) study for a total of 2678 cases and 3262 controls in the analysis. In the new independent samples of European ancestry...

  1. El #YoSoy132 mexicano: la aparición (inesperada) de una red activista

    OpenAIRE

    Rovira Sancho, Guiomar

    2014-01-01

    El movimiento #YoSoy132 en México nació en mayo de 2012. Supuso un estallido social incontenible, una convocatoria autogenerada que tomó las calles y plazas de las principales urbes del país. Este artículo busca iluminar su especificidad desde una mirada a la acción colectiva y la experiencia del uso de las tecnologías de la información y la comunicación (TIC). Como red activista, #YoSoy132 se sitúa dentro del ciclo de protestas que crean simultáneamente «espacios de lo común» en las calle...

  2. Proteomic analysis of MG132-treated germinating pollen reveals expression signatures associated with proteasome inhibition.

    Directory of Open Access Journals (Sweden)

    Candida Vannini

    Full Text Available Chemical inhibition of the proteasome has been previously found to effectively impair pollen germination and tube growth in vitro. However, the mediators of these effects at the molecular level are unknown. By performing 2DE proteomic analysis, 24 differentially expressed protein spots, representing 14 unique candidate proteins, were identified in the pollen of kiwifruit (Actinidia deliciosa germinated in the presence of the MG132 proteasome inhibitor. qPCR analysis revealed that 11 of these proteins are not up-regulated at the mRNA level, but are most likely stabilized by proteasome inhibition. These differentially expressed proteins are predicted to function in various pathways including energy and lipid metabolism, cell wall synthesis, protein synthesis/degradation and stress responses. In line with this evidence, the MG132-induced changes in the proteome were accompanied by an increase in ATP and ROS content and by an alteration in fatty acid composition.

  3. Search for a new reaction mechanism in the system132Xe+natFe

    Science.gov (United States)

    Westmeier, W.; Reus, U.; Esterlund, R. A.; Gilat, J.; Patzelt, P.

    1981-09-01

    Thin targets of natural Fe have been irradiated with132xe ions at beam energies of 5.00, 5.90, and 7.15 MeV/u. Mass yields for projectile-like and symmetric products were evaluated, and their ratio as a function of beam energy determined. The results are consistent with previously-determined thick-target radiochemical data, and are not consistent with published on-line counter data for the same system.

  4. The coriolis attenuation problem in the perturbed i13/2 neutronbands

    Directory of Open Access Journals (Sweden)

    T. Engeland

    1983-01-01

    Full Text Available The Coriolis attenuation problem in the particle-rotor model is shown to be related to the BCS approximation. A model including the full recoil effect of one- and two-body terms, and with an exact diagonalization of the pairing force, is applied on four nuclei in the rare earth region known to have strongly Coriolis-perturbed i13/2 rotational bands. In all nuclei, the old Coriolis attenuation problem has been removed.

  5. The Mexican #YoSoy132: the (unexpected emergence of an activist network

    Directory of Open Access Journals (Sweden)

    Guiomar Rovira Sancho

    2014-04-01

    Full Text Available The movement #YoSoy132 in Mexico began in May 2012. It represented an uncontainable social eruption, a self-gener­ated call to action which took to the streets and squares of the country’s main towns and cities. This article seeks to highlight the specific nature of these protests by examining the collective action and the experience of the use of infor­mation and communication technologies (ICT. As an activist network, #YoSoy132 developed within a cycle of protests that simultaneously create «common spaces» in city streets, and on the web 2.0, as was also the case with the Arab Spring, the 15-M movement in Spain and Occupy Wall Street in the United States, among other examples. This collective actor generated a performative being-together based on a call for democracy. The article examines the emergence, development, discourse and impact of #YoSoy132 through the analytical frameworks of collective action.

  6. IUE spectra and optical imaging of the oxygen-rich supernova remnant N132D

    Science.gov (United States)

    Blair, William P.; Raymond, John C.; Long, Knox S.

    1994-01-01

    We present new optical Charge Coupled Devices (CCD) interference filter imagery and International Ultraviolet Explorer (IUE) spectroscopy for the oxygen-rich supernova remnant N132D in the Large Magellanic Cloud. The optical images show a wealth of structure, and comparison with an archival Einstein High Resolution Imager (HRI) X-ray image shows that a few optical features have X-ray counter-parts, but in general there is little correlation between X-ray and optical features. The IUE spectra at two positions show strong lines of carbon and oxygen, with lines of neon, magnesium, silicon, and helium also present and variable in relative intensities. We use optical data for N132D from Dopita & Tuohy (1984) with our UV observations to compare with shock models (both with and without thermal conduction) and X-ray photoionization model calculations. While none of the model fits is entirely satisfactory, the generally weak UV emission relative to optical disagrees with the general character of shock model predictions and indicates that photoionization is the dominant excitation mechanism for the UV/optical emission. This conclusion is similar to what was found for E0102 - 7219, the oxygen-rich remnant in the Small Magellanic Cloud. We derive rough abundances for the emitting material in N132D, compare to stellar nucleosynthesis models, and discuss the implications for its precursor. A precursor near 20 solar mass is consistent with the data.

  7. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  8. The sulfate-reducing bacterium Desulfovibrio desulfuricans ND132 as a model for understanding bacterial mercury methylation

    Energy Technology Data Exchange (ETDEWEB)

    Gilmour, C C [Smithsonian Environmental Research Center, Edgewater, MD; Elias, Dwayne A [ORNL; Kucken, A M [University of Missouri, Columbia; Brown, Steven D [ORNL; Palumbo, Anthony Vito [ORNL; Wall, Judy D. [University of Missouri

    2010-01-01

    We propose the use of Desulfovibrio sp. ND132 as a model species for understanding the genetics and biochemistry of microbial Hg methylation. ND132 is a dissimilatory sulfate-reducing bacterium (DSRB) that exhibits exceptionally high rates of Hg methylation in culture, but is otherwise a characteristically typical Desulfovibrio strain. The full genome sequence of ND132 will be available soon. ND132 is very similar to other DSRB that are sequenced but do not methylate Hg, allowing comparison for potential methylation genes. Here, we describe the physiological characteristics of the strain, examine its MeHg production capability, and place the strain within the phylogeny of the Desulfovibrionales using 16S rRNA. We also examine Hg toxicity and the inducibility of MeHg production amongst the DSRB by comparing ND132 to non-methylating DSRB. The optimal growth medium for Hg methylation is pyruvate/fumarate, which supports strong respiratory growth without sulfide production. At moderate Hg concentrations (10 ng/ml), and using TiNTA as a reductant, ND132 methylates about 30% of added HgCl2 during batch culture growth on 40 mM pyruvate/fumarate. Under constant culture conditions, MeHg production is an exponential function of Hg concentration, probably reflecting Hg partitioning between aqueous and solid phases. To help understand how Hg is taken up by this organism, we examined the influence of a variety of small thiol-bearing ligands, as well as select amino acids, on methylation by D. desulfuricans ND132. All thiol bearing ligands tested affected methylation in similar ways, suggesting that Hg uptake by ND132 is not associated with uptake of a specific amino acid. To identify enzymes for the methylation activity, a genetic approach is being pursued. Conjugation from E. coli donors works well that allows the generation of a transposon library of random ND132 mutants. These mutants will be screened for affects on mercury methylation.

  9. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B

    2015-01-01

    function including regulation of cardiac hypertrophy, heart failure and blood pressure possibly through AT1R signalling. However, the miR-132/212 targets in the heart remain unknown. MATERIALS AND METHODS: To understand the role of these miRNAs in cardiac signalling networks, we undertook comprehensive......INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular...... in silico and in vitro experiments to identify miR-132/212 molecular targets in primary rat cardiac fibroblasts. RESULTS: MiR-132/212 overexpression increased fibroblast cell size and mRNA arrays detected several hundred genes that were differentially expressed, including a wide panel of receptors...

  10. Fusion near the barrier in the system 132XE + natFE

    Science.gov (United States)

    Esterlund, R. A.; Westmeier, W.; Rajagopalan, M.; Patzelt, P.

    Cross sections for the production of 154 nuclides were measured radiochemically in the reaction of (near-barrier) 600-MeV132 Xe ions with a natural Fe target, and the mass-yield curve was constructed. No evidence for significant subbarrier fusion was observed. Coalescence Model calculations were found to be in good agreement with the fusion yields from this and higher-energy experiments, while other model predictions were not, indicating that the Swiatecki "extra push" for fusion processes occurs as predicted. Moreover, this result supports the model implication that systems with similar effective fissilities are dynamically equivalent.

  11. Study of the Doubly-closed Shell Nucleus $^{132}$Sn and its Valence Nuclei

    CERN Multimedia

    2002-01-01

    The aim of the experiment is to study the level structure of nuclei close to the shell closures (Z,N)~=~(50,50) and (50,82). \\\\ \\\\ The decay of the isotopes |9|8Cd, |1|3|2In, |1|3|3In and|1|3|1Cd are invesigated by means of $\\gamma$; electron- and neutron spectroscopy. Gamma-gamma and electron-gamma coincidences are also recorded.\\\\ \\\\ The experimental equipment (Ge(Li) detectors, Si(Li) detectors and |3He neutron spectrometers) are connected on-line to the ISOLDE on-line isotope separator.

  12. 20q13.2-q13.33 deletion syndrome: A case report.

    Science.gov (United States)

    Butler, Merlin G; Usrey, Kelly M; Roberts, Jennifer L; Manzardo, Ann M; Schroeder, Stephen R

    2013-01-01

    We report a 32-month-old female of Peruvian ethnicity identified with a rare 20q13.2-q13.33 deletion using microarray analysis. She presented with intellectual disability, absent speech, hypotonia, pre- and post-natal growth retardation and an abnormal face with a unilateral cleft lip. Clinical features and genetic findings with the loss of 30 genes, including GNAS, MC3R, CDH4 and TFAP2C , are described in relationship to the very few cases of 20q13 deletion reported in the literature. Deletion of this region may play an important role in neurodevelopment and function and in causing specific craniofacial features.

  13. Studies of Nuclei Close to 132Sn Using Single-Neutron Transfer Reactions

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K. L. [University of Tennessee, Knoxville (UTK); Pain, S. D. [Rutgers University; Kozub, R. L. [Tennessee Technological University; Adekola, Aderemi S [ORNL; Bardayan, Daniel W [ORNL; Blackmon, Jeff C [ORNL; Catford, Wilton N [ORNL; Chae, K. Y. [University of Tennessee, Knoxville (UTK); Chipps, K. [Colorado School of Mines, Golden; Cizewski, J. A. [Rutgers University; Erikson, Luke [Colorado School of Mines, Golden; Gaddis, A. L. [Furman University; Greife, U. [Colorado School of Mines, Golden; Grzywacz, R. K. [University of Tennessee, Knoxville (UTK); Harlin, Christopher W [ORNL; Hatarik, Robert [Rutgers University; Howard, Joshua A [ORNL; James, J. [Colorado School of Mines, Golden; Kapler, R. [University of Tennessee, Knoxville (UTK); Krolas, W. [University of Warsaw; Liang, J Felix [ORNL; Ma, Zhanwen [ORNL; Matei, Catalin [Oak Ridge Associated Universities (ORAU); Moazen, Brian [University of Tennessee, Knoxville (UTK); Nesaraja, Caroline D [ORNL; O' Malley, Patrick [Rutgers University; Patterson, N. P. [University of Surrey, UK; Paulauskas, Stanley [University of Tennessee, Knoxville (UTK); Shapira, Dan [ORNL; ShrinerJr., J. F. [Tennessee Technological University; Sikora, M. [Rutgers University; Sissom, D. J. [Tennessee Technological University; Smith, Michael Scott [ORNL; Swan, T. P. [University of Surrey, UK; Thomas, J. S. [Rutgers University; Wilson, Gemma L [ORNL

    2009-01-01

    Neutron transfer reactions were performed in inverse kinematics using radioactive ion beams of 132Sn, 130Sn, and 134Te and deuterated polyethylene targets. Preliminary results are presented. The Q-value spectra for 133Sn, 131Sn and 135Te reveal a number of previously unobserved peaks. The angular distributions are compatible with the expected lf7/2 nature of the ground state of 133Sn, and 2p3/2 for the 3.4 MeV state in 131Sn.

  14. Blocking Plasmodium falciparum development via dual inhibition of hemoglobin degradation and the ubiquitin proteasome system by MG132.

    Science.gov (United States)

    Prasad, Rajesh; Atul; Kolla, Venkata Karunakar; Legac, Jennifer; Singhal, Neha; Navale, Rahul; Rosenthal, Philip J; Sijwali, Puran Singh

    2013-01-01

    Among key potential drug target proteolytic systems in the malaria parasite Plasmodium falciparum are falcipains, a family of hemoglobin-degrading cysteine proteases, and the ubiquitin proteasomal system (UPS), which has fundamental importance in cellular protein turnover. Inhibition of falcipains blocks parasite development, primarily due to inhibition of hemoglobin degradation that serves as a source of amino acids for parasite growth. Falcipains prefer P2 leucine in substrates and peptides, and their peptidyl inhibitors with leucine at the P2 position show potent antimalarial activity. The peptidyl inhibitor MG132 (Z-Leu-Leu-Leu-CHO) is a widely used proteasome inhibitor, which also has P2 leucine, and has also been shown to inhibit parasite development. However, the antimalarial targets of MG132 are unclear. We investigated whether MG132 blocks malaria parasite development by inhibiting hemoglobin degradation and/or by targeting the UPS. P. falciparum was cultured with inhibitors of the UPS (MG132, epoxomicin, and lactacystin) or falcipains (E64), and parasites were assessed for morphologies, extent of hemoglobin degradation, and accumulation of ubiquitinated proteins. MG132, like E64 and unlike epoxomicin or lactacystin, blocked parasite development, with enlargement of the food vacuole and accumulation of undegraded hemoglobin, indicating inhibition of hemoglobin degradation by MG132, most likely due to inhibition of hemoglobin-degrading falcipain cysteine proteases. Parasites cultured with epoxomicin or MG132 accumulated ubiquitinated proteins to a significantly greater extent than untreated or E64-treated parasites, indicating that MG132 inhibits the parasite UPS as well. Consistent with these findings, MG132 inhibited both cysteine protease and UPS activities present in soluble parasite extracts, and it strongly inhibited recombinant falcipains. MG132 was highly selective for inhibition of P. falciparum (IC50 0.0476 µM) compared to human peripheral blood

  15. Proteasome inhibitor MG132 enhances the antigrowth and antimetastasis effects of radiation in human nonsmall cell lung cancer cells.

    Science.gov (United States)

    Liu, Jing; Shen, Wenhao; Tang, Yiting; Zhou, Jundong; Li, Ming; Zhu, Wei; Yang, Hongying; Wu, Jinchang; Zhang, Shuyu; Cao, Jianping

    2014-08-01

    The current treatment for advanced nonsmall cell lung cancer (NSCLC) remains unsatisfactory due to resistance to chemotherapy and ionizing radiation. The ubiquitin-proteasome system (UPS) regulates multiple cellular processes that are crucial for the proliferation and survival of all kinds of cells. Carbobenzoxyl-leucinyl-leucinyl-leucinal-H (MG132), a specific and selective reversible inhibitor of the 26S proteasome, represents a novel approach for cancer therapy. However, whether MG132 can potentiate the effect of radiation against the growth and metastasis of NSCLC is not clear. We found that MG132 inhibited the proliferation of human NSCLC cell lines (A549 and H1299) in a dose- and time-dependent manner by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Then MG132 at a nontoxic dose (100 nM) was selected for following studies. Pretreatment of A549 and H1299 cells with 100 nM MG132 before ionizing radiation (IR) potentiated the anticancer effect of IR. Moreover, pretreatment with 100 nM MG132 before IR-enhanced radiation induced cell cycle arrest by decreased CyclinD1 but increased Wee1 expression in A549 and H1299 cells. In addition, pretreatment of MG132 combined with IR significantly suppressed cell migration and invasion abilities in NSCLC cell lines, which was accompanied by decreased expression of matrix metalloproteinase (MMP)-2 and MMP-9 in NSCLC cell lines. Taken together, our results demonstrate that MG132 enhances the antigrowth and antimetastatic effects of irradiation in NSCLC cells by modulating expression of cell cycle and invasion- related genes.

  16. Carboxyethylgermanium sesquioxide (Ge-132) treatment during in vitro culture protects fertilized porcine embryos against oxidative stress induced apoptosis.

    Science.gov (United States)

    Kim, Eunhye; Hwang, Seon-Ung; Yoon, Junchul David; Jeung, Eui-Bae; Lee, Eunsong; Kim, Dae Young; Hyun, Sang-Hwan

    2017-12-15

    Compared with the in vivo environment, porcine in vitro embryo-culture systems are suboptimal, as they induce oxidative stress via the accumulation of reactive oxygen species (ROS). High ROS levels during early embryonic development cause negative effects, such as apoptosis. In this study, we examined the effects of the antioxidant carboxyethylgermanium sesquioxide (Ge-132) during in vitro culture (IVC) on embryonic development in porcine in vitro fertilization (IVF) embryos. Zygotes were treated with different concentrations of Ge-132 (0, 100, 200 and 400 μg/ml). All of the Ge-132 treatment groups displayed greater total cell numbers after IVC (98.1, 98.5 and 103.4, respectively) compared with the control group (73.9). The 200 μg/ml Ge-132 treatment group exhibited significantly increased intracellular GSH levels compared with the control group, whereas the ROS generation levels decreased in Ge-132 dose-dependent manner (P cultured under Ge-132 treatment may be associated with KEAP1 signaling cascades involved in oxidative stress and apoptosis during porcine preimplantation embryo development.

  17. The Environmental Neurotoxicant PCB 95 Promotes Synaptogenesis via Ryanodine Receptor-Dependent miR132 Upregulation

    Science.gov (United States)

    Lesiak, Adam; Zhu, Mingyan; Chen, Hao; Appleyard, Suzanne M.; Impey, Soren; Wayman, Gary A.

    2014-01-01

    Non–dioxin-like (NDL) polychlorinated biphenyls (PCBs) are widespread environmental contaminants linked to neuropsychological dysfunction in children. NDL PCBs increase spontaneous Ca2+ oscillations in neurons by stabilizing ryanodine receptor (RyR) calcium release channels in the open configuration, which results in CREB-dependent dendritic outgrowth. In this study, we address the question of whether activation of CREB by NDL PCBs also triggers dendritic spine formation. Nanomolar concentrations of PCB 95, a NDL congener with potent RyR activity, significantly increased spine density and the frequency of miniature EPSCs in primary dissociated rat hippocampal cultures coincident with upregulation of miR132. Inhibition of RyR, CREB, or miR132 as well as expression of a mutant p250GAP cDNA construct that is not suppressed by miR132 blocked PCB 95 effects on spines and miniature EPSCs. PCB 95 also induced spine formation via RyR- and miR132-dependent mechanisms in hippocampal slice cultures. These data demonstrate a novel mechanism of PCB developmental neurotoxicity whereby RyR sensitization modulates spine formation and synaptogenesis via CREB-mediated miR132 upregulation, which in turn suppresses the translation of p250GAP, a negative regulator of synaptogenesis. In light of recent evidence implicating miR132 dysregulation in Rett syndrome and schizophrenia, these findings identify NDL PCBs as potential environmental risk factors for neurodevelopmental disorders. PMID:24431430

  18. Encapsulation of Arenes within a Porous Molybdenum Oxide {Mo132 } Nanocapsule.

    Science.gov (United States)

    Sarma, Bidyut Bikash; Avram, Liat; Neumann, Ronny

    2016-10-17

    The use of confined space to modulate chemical reactivity and to sequester organic compounds spans significant disciplines in chemistry and biology. Here, the inclusion and assembly of arenes into a water-soluble porous metal oxide nanocapsule [{(MoVI )MoV5 O21 (H2 O)6 }12 {MoV2 O4 (CH3 COO)}30 ]42- (Mo132 ) is reported. The uptake of benzene, halobenzenes, alkylbenzenes, phenols, and other derivatives was studied by NMR, where it was possible to follow the encapsulation process from the outside of the capsule through its pores and then into the interior. The importance of size or shape of the arenes, and various intermolecular bond interactions contributed by the benzene substituent on the encapsulation process was studied, showing the importance of π-π stacking and CH-π interactions. Furthermore, by using NOESY, ROESY, and HOESY NMR techniques it was possible to understand the interaction of the encapsulated arenes and the acetate linkers or ligands that line the interior of the Mo132 capsule. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Combination of Proteasomal Inhibitors Lactacystin and MG132 Induced Synergistic Apoptosis in Prostate Cancer Cells

    Directory of Open Access Journals (Sweden)

    Robert B. Shirley

    2005-12-01

    Full Text Available The proteasome inhibitor Velcade (bortezomib/PS-341 has been shown to block the targeted proteolytic degradation of short-lived proteins that are involved in cell maintenance, growth, division, and death, advocating the use of proteasomal inhibitors as therapeutic agents. Although many studies focused on the use of one proteasomal inhibitor for therapy, we hypothesized that the combination of proteasome inhibitors Lactacystin (AG Scientific, Inc., San Diego, CA and MG132 (Biomol International, Plymouth Meeting, PA may be more effective in inducing apoptosis. Additionally, this regimen would enable the use of sublethal doses of individual drugs, thus reducing adverse effects. Results indicate a significant increase in apoptosis when LNCaP prostate cancer cells were treated with increasing levels of Lactacystin, MG132, or a combination of sublethal doses of these two inhibitors. Furthermore, induction in apoptosis coincided with a significant loss of IKKα, IKKβ, and IKKγ proteins and NFκB activity. In addition to describing effective therapeutic agents, we provide a model system to facilitate the investigation of the mechanism of action of these drugs and their effects on the IKK-NFκB axis.

  20. Launch of the I13-2 data beamline at the Diamond Light Source synchrotron

    Science.gov (United States)

    Bodey, A. J.; Rau, C.

    2017-06-01

    Users of the Diamond-Manchester Imaging Branchline I13-2 commonly spend many months analysing the large volumes of tomographic data generated in a single beamtime. This is due to the difficulties inherent in performing complicated, computationally-expensive analyses on large datasets with workstations of limited computing power. To improve productivity, a ‘data beamline’ was launched in January 2016. Users are scheduled for visits to the data beamline in the same way as for regular beamlines, with bookings made via the User Administration System and provision of financial support for travel and subsistence. Two high-performance graphics workstations were acquired, with sufficient RAM to enable simultaneous analysis of several tomographic volumes. Users are given high priority on Diamond’s central computing cluster for the duration of their visit, and if necessary, archived data are restored to a high-performance disk array. Within the first six months of operation, thirteen user visits were made, lasting an average of 4.5 days each. The I13-2 data beamline was the first to be launched at Diamond Light Source and, to the authors’ knowledge, the first to be formalised in this way at any synchrotron.

  1. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong-Kook [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Henry, Jon C. [Department of Surgery, Ohio State University, Columbus, OH 43210 (United States); Jiang, Jinmai [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Esau, Christine [Regulus Therapeutics, Carlsbad, CA (United States); Gusev, Yuriy [Lombardi Cancer Center, Georgetown University, Washington, DC (United States); Lerner, Megan R. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Postier, Russell G. [Department of Surgery, University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States); Brackett, Daniel J. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Schmittgen, Thomas D., E-mail: Schmittgen.2@osu.edu [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States)

    2011-03-25

    Research highlights: {yields} The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. {yields} miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. {yields} miR-132 and miR-212 expression is increased by a {beta}2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G{sub 2}/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the {beta}2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The {beta}2 adrenergic pathway may play an important role in this novel mechanism.

  2. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor.

    Science.gov (United States)

    Park, Jong-Kook; Henry, Jon C; Jiang, Jinmai; Esau, Christine; Gusev, Yuriy; Lerner, Megan R; Postier, Russell G; Brackett, Daniel J; Schmittgen, Thomas D

    2011-03-25

    Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G(2)/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the β2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The β2 adrenergic pathway may play an important role in this novel mechanism. Copyright © 2011 Elsevier Inc. All rights reserved.

  3. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  4. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS); Die Dynamik des laserinduzierten Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS)

    Energy Technology Data Exchange (ETDEWEB)

    Kaempfer, Tino

    2009-12-15

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [German] Die vorliegende Arbeit ist der experimentellen Untersuchung des Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS) gewidmet. Es werden temperatur- und zeitaufgeloeste Experimente zur Charakterisierung des Phasenuebergangs gemischt-valenter SmS Proben (M-SmS) vorgestellt. Die Messung der Dynamik des laserinduzierten Phasenuebergangs erfolgt ueber zeitaufgeloeste Ultrakurzzeit-Mikroskopie und durch Roentgenbeugung mit subpikosekunden Zeitaufloesung. Die elektronischen und strukturellen Prozesse, welche einer Anregung von M-SmS mit infraroten Femtosekunden-Laserpulsen folgen, werden auf der Basis der in dieser Arbeit gewonnenen Ergebnisse und Modellvorstellungen physikalisch interpretiert. (orig.)

  5. Saturated 13.2 nm high-repetition-rate laser in nickellike cadmium

    Science.gov (United States)

    Rocca, J. J.; Wang, Y.; Larotonda, M. A.; Luther, B. M.; Berrill, M.; Alessi, D.

    2005-10-01

    We report gain-saturated operation of a 13.2 nm tabletop laser in Ni-like Cd at a 5 Hz repetition rate. A gain-length product G×L=17.6 was obtained by heating a precreated plasma with 8 ps duration Ti:sapphire laser pulses with an energy of only 1 J impinging at a grazing angle of 23°. With an average power of ˜1 µW, this laser is an attractive coherent source for at-wavelength metrology of extreme UV lithography optics and other applications. [Note: Due to a production error in the print version abstract, the value "1 µW" is incorrectly stated as "1 mW." This value is stated correctly in the online PDF.

  6. Self-consistent calculations of radiative nuclear reaction characteristics for 56Ni, 132Sn, 208Pb

    Science.gov (United States)

    Achakovskiy, Oleg; Kamerdzhiev, Sergei

    2017-09-01

    The photon strength functions (PSF), neutron capture cross sections and average radiative widths of neutron resonances for three double-magic nuclei 56Ni, 132Sn and 208Pb have been calculated within the self-consistent version of the microscopic theory. Our approach includes phonon coupling (PC) effects in addition to the standard QRPA approach. With our microscopic PSFs, calculations of radiative nuclear reaction characteristics have been performed using the EMPIRE 3.1 nuclear reaction code. Three nuclear level density (NLD) models have been used: the phenomenological so-called GSM, phenomenological Enhanced GSM (EGSM) and microscopical combinatorial HFB model. For all the considered characteristics, we found a noticeable contribution of the PC effects and a significant disagreement between the results obtained with the GSM and the other two NLD models. The results confirm the necessity of using consistent microscopic approaches for calculations of radiative nuclear characteristics in double-magic nuclei.

  7. Cross Sections of Charged Current Neutrino Scattering off 132Xe for the Supernova Detection

    Directory of Open Access Journals (Sweden)

    P. C. Divari

    2013-01-01

    Full Text Available The total cross sections as well as the neutrino event rates are calculated in the charged current neutrino and antineutrino scattering off 132Xe isotope at neutrino energies Ev<100 MeV. Transitions to excited nuclear states are calculated in the framework of quasiparticle random-phase approximation. The contributions from different multipoles are shown for various neutrino energies. Flux-averaged cross sections are obtained by convolving the cross sections with a two-parameter Fermi-Dirac distribution. The flux-averaged cross sections are also calculated using terrestrial neutrino sources based on conventional sources (muon decay at rest or on low-energy beta-beams.

  8. The therapeutic potential of pharmacological chaperones and proteosomal inhibitors, Celastrol and MG132 in the treatment of sialidosis.

    Science.gov (United States)

    O'Leary, Erin M; Igdoura, Suleiman A

    2012-09-01

    Sialidosis is an autosomal recessive disorder caused by a dysfunctional Sialidase enzyme. Categorised into two phenotypes, Sialidosis type I and II, Sialidosis is a highly heterogeneous disorder with varying ages of onset and pathologies. Currently, there is no viable therapy for the treatment of Sialidosis patients. At the molecular level, cells from Sialidosis patients with compound heterozygous mutations show improper enzyme folding, loss of Sialidase enzyme activity and subsequent accumulation of sialylconjugates within lysosomes. One promising treatment option is the use of small pharmacological molecules to increase the enzymatic activities of mutant proteins. In this study, we examined the efficacy of the immuno-suppressant (Celastrol) as well as a proteosomal inhibitor (MG132) to rescue mutant enzymes with altered conformation. Our results reveal that MG132 enhances enzyme activity and its localisation in cells expressing defective Sialidase. We also found that MG132 reduces accumulation of ganglioside products, GT1b, GD3, and GM3 in pre-loaded Sialidosis cells. Alternatively, Celastrol appears to reduce Sialidase expression and activity revealing a potentially novel effect of Celastrol on Sialidase. Interestingly, the combination of Celastrol and MG132 appears to amplify the beneficial impact of MG132 on both the endogenous and recombinant expression of defective Sialidase. This study explores a novel biological criteria to assess the efficacy of small molecules through accumulation analysis and points to a potential therapeutic strategy for the treatment of Sialidosis. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Prevalence and Prognostic Value of IDH1 R132 Mutation in Newly Diagnosed AML Egyptian Patients with Normal Karyotype.

    Science.gov (United States)

    Salem, Dalia; El-Aziz, Sherin Abd; El-Menshawy, Nadia; Abouzeid, Tarek; Ebrahim, Mohamed

    2017-03-01

    Mutation in IDH1 gene was suggested to be associated with bad prognosis in cytogenetically normal AML (CN-AML). However, there are conflicting data about its prognostic impact. Besides, its prevalence and prognostic significance in Egyptian patients still not fully stated. We aimed to assess the prevalence of IDH1R132 mutation in Egyptian CN-AML patients, its correlation with FAB subtypes, and clinical outcome of those patients. Sequencing of amplified IDH1 gene exon four from 50 patients was performed to detect codon R132 point mutation. High prevalence of IDH1 mutation was detected in our patients (9/50, 18 %). Mutated IDH1R132 was associated with older age and higher platelets count (p = 0.04 and 0.01 respectively). The most common FAB subtype associated with mutated IDH1R132 was AML-M2 followed by M4. In multivariate analysis, IDH1R132 mutation was found as independent prognostic variable. It was significantly associated with lower CR and shorter OS (p = 0.06 and 0.009 respectively).

  10. La Muela commissioned. Thyssen Rheinstahl Technik plans 132x750 kW NEG Micon; La Muela geht ans Netz. Thyssen Rheinstahl Technik plant 132x750 kW NEG Micon

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The first wind turbine at La Muela was connected to the locl grid at the end of 2002. There are now 132 wind turbines, all of which are monitored from a central control room at Duesseldorf. (orig.) [German] 132 Windkraftanlagen signalisieren auf dem Monitor von Hans-Bruno Ripkens in Duesseldorf ihre Betriebsbereitschaft bzw. ihren Betrieb. Jede Anzeige steht fuer eine Windkraftanlage im spanischen La Muela. Eine spezielle Software ueberwacht rund um die Uhr den Anlagenzustand, seit puenktlich zum Jahresende 2002 die erste Windturbine an das oertliche Stromnetz angeschlossen wurde. (orig.)

  11. Estimation of Te-132 distribution in Fukushima Prefecture at the early stage of the Fukushima Daiichi Nuclear Power Plant reactor failures.

    Science.gov (United States)

    Tagami, Keiko; Uchida, Shigeo; Ishii, Nobuyoshi; Zheng, Jian

    2013-05-21

    Tellurium-132 ((132)Te, half-life: 3.2 d) has been assessed as the radionuclide with the third largest release from the Fukushima Daiichi Nuclear Power Plant (FDNPP) in March 2011; thus it would have made some dose contribution during the early stage of the reactor failures. The available data for (132)Te are, however, limited. In this study, available reported values of other isotopes of Te were compiled to estimate (132)Te concentration (in MBq m(-2)). It was found that (132)Te and (129m)Te (half-life: 33.6 d) concentrations were well correlated (R = 0.99, p < 0.001) by t test. Thus, (132)Te concentrations on March 11, 2011 were estimated from (129m)Te using the concentration conversion factor ((132)Te /(129m)Te) of 14.5. It was also found that since deposited (129m)Te was well retained in the soil, the data collected in March-May of 2011 were applicable to (132)Te estimation. It was possible to obtain the first (132)Te concentration contour map for the eastern part of Fukushima Prefecture, including data from within the 20-km exclusion zone around the FDNPP, using these newly available estimated (132)Te data sets.

  12. Rotational bands and signature inversion phenomena in {pi}h{sub 9/2} x {nu}i{sub 13/2} and {pi}i{sub 13/2} x {nu}i{sub 13/2} structures in odd-odd {sup 176}Ir

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.H. [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou (China); Oshima, M.; Toh, Y.; Koizumi, M.; Osa, A.; Shizuma, T.; Hayakawa, T. [Japan Atomic Energy Research Institute, Tokai-mura, Ibaraki (Japan); Sugawara, M. [Chiba Institute of Technology, Narashino, Chiba (Japan); Kusakari, H. [Chiba University, Inage-ku, Chiba (Japan); Morikawa, T. [Department of Physics, Kyushu University, Fukuoka 812-81 (Japan); Wen, S.X.; Zhu, L.H. [China Institute of Atomic Energy, Beijing (China)

    2002-04-01

    High-spin states in {sup 176}Ir have been investigated via the {sup 149}Sm({sup 31}P,4n{gamma}) {sup 176}Ir reaction through excitation functions, X-{gamma} and {gamma}-{gamma} coincidence measurements. Four rotational bands have been identified for the first time and their configurations are suggested on the basis of the existing knowledge of band structures in odd-odd nuclei as well as the measured in-band B(M1)/B(E2) ratios. Among the four bands observed, the {pi}h{sub 9/2} x {nu}i{sub 13/2} and {pi}i{sub 13/2} x {nu}i{sub 13/2} bands exhibit an anomalous signature splitting. The signature inversion point is observed in the former at I{sub c} = 18{Dirac_h} which is consistent with expectations; this signature inversion spin in the {pi}i{sub 13/2} x {nu}i{sub 13/2} band may be larger than 25{Dirac_h}. The combined effects of Coriolis and p-n residual interactions involved in such an inversion phenomenon have been discussed qualitatively. (orig.)

  13. 1p3/2 Proton-Hole State in Sn132 and the Shell Structure Along N =82

    Science.gov (United States)

    Taprogge, J.; Jungclaus, A.; Grawe, H.; Nishimura, S.; Doornenbal, P.; Lorusso, G.; Simpson, G. S.; Söderström, P.-A.; Sumikama, T.; Xu, Z. Y.; Baba, H.; Browne, F.; Fukuda, N.; Gernhäuser, R.; Gey, G.; Inabe, N.; Isobe, T.; Jung, H. S.; Kameda, D.; Kim, G. D.; Kim, Y.-K.; Kojouharov, I.; Kubo, T.; Kurz, N.; Kwon, Y. K.; Li, Z.; Sakurai, H.; Schaffner, H.; Steiger, K.; Suzuki, H.; Takeda, H.; Vajta, Zs.; Watanabe, H.; Wu, J.; Yagi, A.; Yoshinaga, K.; Benzoni, G.; Bönig, S.; Chae, K. Y.; Coraggio, L.; Covello, A.; Daugas, J.-M.; Drouet, F.; Gadea, A.; Gargano, A.; Ilieva, S.; Kondev, F. G.; Kröll, T.; Lane, G. J.; Montaner-Pizá, A.; Moschner, K.; Mücher, D.; Naqvi, F.; Niikura, M.; Nishibata, H.; Odahara, A.; Orlandi, R.; Patel, Z.; Podolyák, Zs.; Wendt, A.

    2014-04-01

    A low-lying state in In82131, the one-proton hole nucleus with respect to double magic Sn132, was observed by its γ decay to the Iπ=1/2- β-emitting isomer. We identify the new state at an excitation energy of Ex=1353 keV, which was populated both in the β decay of Cd13183 and after β-delayed neutron emission from Cd13284, as the previously unknown πp3/2 single-hole state with respect to the Sn132 core. Exploiting this crucial new experimental information, shell-model calculations were performed to study the structure of experimentally inaccessible N =82 isotones below Sn132. The results evidence a surprising absence of proton subshell closures along the chain of N =82 isotones. The consequences of this finding for the evolution of the N =82 shell gap along the r-process path are discussed.

  14. A heterozygous IDH1R132H/WT mutation induces genome-wide alterations in DNA methylation.

    Science.gov (United States)

    Duncan, Christopher G; Barwick, Benjamin G; Jin, Genglin; Rago, Carlo; Kapoor-Vazirani, Priya; Powell, Doris R; Chi, Jen-Tsan; Bigner, Darell D; Vertino, Paula M; Yan, Hai

    2012-12-01

    Monoallelic point mutations of the NADP(+)-dependent isocitrate dehydrogenases IDH1 and IDH2 occur frequently in gliomas, acute myeloid leukemias, and chondromas, and display robust association with specific DNA hypermethylation signatures. Here we show that heterozygous expression of the IDH1(R132H) allele is sufficient to induce the genome-wide alterations in DNA methylation characteristic of these tumors. Using a gene-targeting approach, we knocked-in a single copy of the most frequently observed IDH1 mutation, R132H, into a human cancer cell line and profiled changes in DNA methylation at over 27,000 CpG dinucleotides relative to wild-type parental cells. We find that IDH1(R132H/WT) mutation induces widespread alterations in DNA methylation, including hypermethylation of 2010 and hypomethylation of 842 CpG loci. We demonstrate that many of these alterations are consistent with those observed in IDH1-mutant and G-CIMP+ primary gliomas and can segregate IDH wild-type and mutated tumors as well as those exhibiting the G-CIMP phenotype in unsupervised analysis of two primary glioma cohorts. Further, we show that the direction of IDH1(R132H/WT)-mediated DNA methylation change is largely dependent upon preexisting DNA methylation levels, resulting in depletion of moderately methylated loci. Additionally, whereas the levels of multiple histone H3 and H4 methylation modifications were globally increased, consistent with broad inhibition of histone demethylation, hypermethylation at H3K9 in particular accompanied locus-specific DNA hypermethylation at several genes down-regulated in IDH1(R132H/WT) knock-in cells. These data provide insight on epigenetic alterations induced by IDH1 mutations and support a causal role for IDH1(R132H/WT) mutants in driving epigenetic instability in human cancer cells.

  15. Movimiento Juvenil YoSoy132: “El Cisne Negro Mexicano” frente a los Monopolios Mediáticos

    OpenAIRE

    SÁNCHEZ GUDIÑO, Hugo

    2014-01-01

    Jóvenes mexicanos hartos de la larga herencia de irresponsabilidad, marginación, simulación y desvergüenza del viejo orden establecido expresan su indignación nacional al crear el 11 de mayo de 2012 a través de las redes sociales, el movimiento estudiantil denominado Yo soy 132. El #YoSoy132 sacudió al país y emergió como una corriente vinculada a las preocupaciones ciudadanas, con una lógica diferente a los intereses de los poderes fácticos, rechazando la desinformación y exigiendo la veraci...

  16. The role of social media in the rise of the Mexican Social Movement #YoSoy132

    OpenAIRE

    Hernandez Lopez, Diana Itzel

    2015-01-01

    1) In which way were the social media used by the #YoSoy132 movement? In this question I am interested in looking at how the movement #YoSoy132 used social media as an emotional conduit. I will also look at the social media`s efficacy as an organizational tool. 2) Did the movement have a horizontal structure, and if so, how did this affect it? In this question I want to understand the impact of using social media allowing a horizontal structure. 3) To what degree di...

  17. ESTRATÉGIAS ARGUMENTATIVAS NO FACEBOOK DO MOVIMENTO #YOSOY132 PÓS-ELEIÇÃO PRESIDENCIAL MEXICANA DE 2012

    OpenAIRE

    Bozza, Gabriel Alexandre; Panke, Luciana

    2014-01-01

    Esse artigo debate o ciberativismo no movimento estudantil #YoSoy132, criado durante a eleição presidencial mexicana de 2012. Assim, analisaremos 142 postagens realizadas no Facebook oficial, entre 03 de julho e 03 de dezembro de 2012 para conferir estratégias argumentativas empregadas na Teoria da Argumentação (PERELMAN, OLBRECHTS-TYTECA, 1996).CIBERACTIVISMO Y ESTRATEGIAS ARGUMENTATIVAS EN FACEBOOK DE MOVIMIENTO ESTUDIANTIL #YOSOY132 DESPUES DE CAMPAÑA PRESIDENCIAL MEXICANA DE 2012 Resumen:...

  18. miR-132, an experience-dependent microRNA, is essential for visual cortex plasticity.

    Science.gov (United States)

    Mellios, Nikolaos; Sugihara, Hiroki; Castro, Jorge; Banerjee, Abhishek; Le, Chuong; Kumar, Arooshi; Crawford, Benjamin; Strathmann, Julia; Tropea, Daniela; Levine, Stuart S; Edbauer, Dieter; Sur, Mriganka

    2011-09-04

    Using quantitative analyses, we identified microRNAs (miRNAs) that were abundantly expressed in visual cortex and that responded to dark rearing and/or monocular deprivation. The most substantially altered miRNA, miR-132, was rapidly upregulated after eye opening and was delayed by dark rearing. In vivo inhibition of miR-132 in mice prevented ocular dominance plasticity in identified neurons following monocular deprivation and affected the maturation of dendritic spines, demonstrating its critical role in the plasticity of visual cortex circuits. © 2011 Nature America, Inc. All rights reserved.

  19. Evolution from quasielastic to deep-inelastic transfer in the system132Xe+natFe§

    Science.gov (United States)

    Reus, U.; Westmeier, W.; Esterlund, R. A.; Rox, A.; Rajagopalan, M.; Patzelt, P.

    1981-12-01

    Angular distributions of products from the reaction of 5.90 Mev/u132Xe ions with a natural Fe target have been determined radiochemically, using catcher-foil techniques. Partially-damped products with charge near that of the projectile exhibit distributions which clearly evolve from quasielastic yields focussed near the grazing angle to deep-inelastic products orbiting towards forward angles.

  20. Proteasome inhibitor MG132 sensitizes HPV-positive human cervical cancer cells to rhTRAIL-induced apoptosis

    NARCIS (Netherlands)

    Hougardy, BMT; Maduro, JH; van der Zee, AGJ; de Groot, DJA; van den Heuvel, FAJ; de Vries, EGE; de Jong, S

    2006-01-01

    In cervical carcinogenesis, the p53 tumor suppressor pathway is disrupted by HPV (human papilloma virus) E6 oncogene expression. E6 targets p53 for rapid proteasome-mediated degradation. We therefore investigated whether proteasome inhibition by MG132 could restore wild-type p53 levels and sensitize

  1. The prognostic IDH1( R132 ) mutation is associated with reduced NADP+-dependent IDH activity in glioblastoma

    NARCIS (Netherlands)

    Bleeker, Fonnet E.; Atai, Nadia A.; Lamba, Simona; Jonker, Ard; Rijkeboer, Denise; Bosch, Klazien S.; Tigchelaar, Wikky; Troost, Dirk; Vandertop, W. Peter; Bardelli, Alberto; van Noorden, Cornelis J. F.

    2010-01-01

    Somatic mutations in the isocitrate dehydrogenase 1 gene (IDH1) occur at high frequency in gliomas and seem to be a prognostic factor for survival in glioblastoma patients. In our set of 98 glioblastoma patients, IDH1 ( R132 ) mutations were associated with improved survival of 1 year on average,

  2. 40 CFR Appendix C to Part 132 - Great Lakes Water Quality Initiative Methodologies for Development of Human Health Criteria and...

    Science.gov (United States)

    2010-07-01

    ... Methodologies for Development of Human Health Criteria and Values C Appendix C to Part 132 Protection of... for Development of Human Health Criteria and Values Great Lakes States and Tribes shall adopt... 100,000 using the exposure assumptions specified in the Methodologies for the Development of Human...

  3. 25 CFR 39.132 - Can a school integrate Language Development programs into its regular instructional program?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a school integrate Language Development programs into... Language Development Programs § 39.132 Can a school integrate Language Development programs into its regular instructional program? A school may offer Language Development programs to students as part of its...

  4. μ Opioid Receptor Expression after Morphine Administration Is Regulated by miR-212/132 Cluster.

    Directory of Open Access Journals (Sweden)

    Adrian Garcia-Concejo

    Full Text Available Since their discovery, miRNAs have emerged as a promising therapeutical approach in the treatment of several diseases, as demonstrated by miR-212 and its relation to addiction. Here we prove that the miR-212/132 cluster can be regulated by morphine, through the activation of mu opioid receptor (Oprm1. The molecular pathways triggered after morphine administration also induce changes in the levels of expression of oprm1. In addition, miR-212/132 cluster is actively repressing the expression of mu opioid receptor by targeting a sequence in the 3' UTR of its mRNA. These findings suggest that this cluster is closely related to opioid signaling, and function as a post-transcriptional regulator, modulating morphine response in a dose dependent manner. The regulation of miR-212/132 cluster expression is mediated by MAP kinase pathway, CaMKII-CaMKIV and PKA, through the phosphorylation of CREB. Moreover, the regulation of both oprm1 and of the cluster promoter is mediated by MeCP2, acting as a transcriptional repressor on methylated DNA after prolonged morphine administration. This mechanism explains the molecular signaling triggered by morphine as well as the regulation of the expression of the mu opioid receptor mediated by morphine and the implication of miR-212/132 in these processes.

  5. 78 FR 17744 - Social Security Ruling, SSR 13-2p; Titles II and XVI: Evaluating Cases Involving Drug Addiction...

    Science.gov (United States)

    2013-03-22

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION Social Security Ruling, SSR 13-2p; Titles II and XVI: Evaluating Cases Involving Drug Addiction and Alcoholism (DAA); Correction AGENCY: Social Security Administration. ACTION: Notice of Social...

  6. Nuclear Structure Studies in the 132Sn Region: Safe Coulex with Carbon Targets

    Energy Technology Data Exchange (ETDEWEB)

    Allmond, James M [ORNL; Stuchbery, Andrew E [ORNL; Galindo-Uribarri, Alfredo {nmn} [ORNL; Padilla-Rodal, Elizabeth [Universidad Nacional Autonoma de Mexico (UNAM); Radford, David C [ORNL; Batchelder, J. C. [Oak Ridge Associated Universities (ORAU); Bingham, C. R. [University of Tennessee, Knoxville (UTK); Howard, Meredith E [ORNL; Liang, J Felix [ORNL; Manning, Brett M [ORNL; Pain, Steven D [ORNL; Stone, N. J. [University of Tennessee, Knoxville (UTK); Varner, Jr, Robert L [ORNL; Yu, Chang-Hong [ORNL

    2015-01-01

    The collective and single-particle structure of nuclei in the 132Sn region was recently studied by Coulomb excitation and heavy-ion induced transfer reactions using carbon, beryllium, and titanium targets. In particular, Coulomb excitation was used determine a complete set of electromagnetic moments for the first 2+ states and one-neutron transfer was used to probe the purity and evolution of single-neutron states. These recent experiments were conducted at the Holifield Radioactive Ion Beam Facility at ORNL using a CsI-HPGe detector array (BareBall- CLARION) to detect scattered particles and emitted gamma rays from the in-beam reactions. A Bragg-curve detector was used to measure the energy loss of the various beams through the targets and to measure the radioactive beam compositions. A sample of the Coulomb excitation results is presented here with an emphasis placed on 116Sn. In particular, the safe Coulex criterion for carbon targets will be analyzed and discussed.

  7. Common genetic variants on 1p13.2 associate with risk of autism.

    Science.gov (United States)

    Xia, K; Guo, H; Hu, Z; Xun, G; Zuo, L; Peng, Y; Wang, K; He, Y; Xiong, Z; Sun, L; Pan, Q; Long, Z; Zou, X; Li, X; Li, W; Xu, X; Lu, L; Liu, Y; Hu, Y; Tian, D; Long, L; Ou, J; Liu, Y; Li, X; Zhang, L; Pan, Y; Chen, J; Peng, H; Liu, Q; Luo, X; Su, W; Wu, L; Liang, D; Dai, H; Yan, X; Feng, Y; Tang, B; Li, J; Miedzybrodzka, Z; Xia, J; Zhang, Z; Luo, X; Zhang, X; St Clair, D; Zhao, J; Zhang, F

    2014-11-01

    Autism is a highly heritable neurodevelopmental disorder, and known genetic variants, mostly rare, account only for a small proportion of cases. Here we report a genome-wide association study on autism using two Chinese cohorts as gene discovery (n=2150) and three data sets of European ancestry populations for replication analysis of top association signals. Meta-analysis identified three single-nucleotide polymorphisms, rs936938 (P=4.49 × 10(-8)), non-synonymous rs6537835 (P=3.26 × 10(-8)) and rs1877455 (P=8.70 × 10(-8)), and related haplotypes, AMPD1-NRAS-CSDE1, TRIM33 and TRIM33-BCAS2, associated with autism; all were mapped to a previously reported linkage region (1p13.2) with autism. These genetic associations were further supported by a cis-acting regulatory effect on the gene expressions of CSDE1, NRAS and TRIM33 and by differential expression of CSDE1 and TRIM33 in the human prefrontal cortex of post-mortem brains between subjects with and those without autism. Our study suggests TRIM33 and NRAS-CSDE1 as candidate genes for autism, and may provide a novel insight into the etiology of autism.

  8. The transition of emotions in collective action. The #Yo Soy 132 youth discourse analysis

    Directory of Open Access Journals (Sweden)

    Verónica García Martínez

    2016-12-01

    Full Text Available Emotions belong human nature, they must not be disaggregated, however, they have been rejected by many disciplinary perspectives that overlap rational action to emotional in the analysis of collective action. Although recently the interest arises to analyze how emotions boost social mobilizations. The objective of this work is analyze the emotions arising in the context of the collective action which was taken by young Mexicans in the movement #Yo Soy 132 through social constructionism of emotions as the theoretical perspective and using as method the discourse analysis. This paper is presented in five parts: in the first the emotions in the collective action are discussed, subsequently the studied phenomenon is contextualized, in the third the analysis method is detailed, in the fourth, results are presented, and in the last section, the findings are confronted on the basis of theoretical approaches recovered. It is concluded that regardless of the context, emotions keep on a similar path in collective action, and the emerged emotions are not positive or negative, instead they are impulsor and detractor of such action.

  9. Adiposity among 132 479 UK Biobank participants; contribution of sugar intake vs other macronutrients.

    Science.gov (United States)

    Anderson, J J; Celis-Morales, C A; Mackay, D F; Iliodromiti, S; Lyall, D M; Sattar, N; Gill, Jmr; Pell, J P

    2017-04-01

    Policy makers are being encouraged to specifically target sugar intake in order to combat obesity. We examined the extent to which sugar, relative to other macronutrients, was associated with adiposity. We used baseline data from UK Biobank to examine the associations between energy intake (total and individual macronutrients) and adiposity [body mass index (BMI), percentage body fat and waist circumference]. Linear regression models were conducted univariately and adjusted for age, sex, ethnicity and physical activity. Among 132 479 participants, 66.3% of men and 51.8% of women were overweight/obese. There was a weak correlation (r = 0.24) between energy from sugar and fat; 13% of those in the highest quintile for sugar were in the lowest for fat, and vice versa. Compared with normal BMI, obese participants had 11.5% higher total energy intake and 14.6%, 13.8%, 9.5% and 4.7% higher intake from fat, protein, starch and sugar, respectively. Hence, the proportion of energy derived from fat was higher (34.3% vs 33.4%, P health messages on sugar may mislead on the need to reduce fat and overall energy consumption.

  10. Hitomi Observations of the LMC SNR N132D: Fast and Asymmetric Iron-rich Ejecta

    Science.gov (United States)

    Miller, Eric D.; Hitomi Collaboration

    2018-01-01

    We present Hitomi Soft X-ray Spectrometer (SXS) observations of N132D, a young, ~2500 year-old, X-ray bright, O-rich core-collapse supernova remnant in the LMC. Despite a very short observation of only 3.7 ksec, the SXS easily detects the line complexes of He-like S K and Fe K with 16-17 counts in each. The Fe K feature is measured for the first time at high spectral resolution, and we find that the Fe K-emitting material is highly redshifted at ~1000 km/s compared to the local LMC ISM, indicating (1) that it arises from the SN ejecta, and (2) that this ejecta is highly asymmetric, since no corresponding blue-shifted component is found. The S K-emitting material has a velocity consistent with the local LMC ISM, and is likely swept-up ISM material. These results are consistent with spatial mapping of these emission lines with XMM-Newton and Chandra, which show the Fe K concentrated in the interior of the remnant and the S K tracing the outer shell. Most importantly, they highlight the power of high-spectral-resolution imaging observations, and demonstrate the new window that has been opened with Hitomi and will be greatly widened with future missions such as the X-ray Astronomy Recovery Mission (XARM) and Athena.

  11. Optimisation of biotransformation conditions for production of 2-phenylethanol by a Saccharomyces cerevisiae CWY132 mutant.

    Science.gov (United States)

    Cui, Zhifeng; Yang, Xiao; Shen, Qingjia; Wang, Kun; Zhu, Tingheng

    2011-04-01

    A mutant Saccharomyces cerevisiae CWY132 was isolated, producing 1.393 g L(-1) 2-phenylethanol (2-PE) in a batch process containing 5 g L(-1) L-phenylalanine (L-Phe), which is equivalent to an increase of 38.3% compared to the initial strain. In this study, biotransformation conditions of this strain were studied. We found glucose, KH2PO4, (NH4)2SO4, and amounts of inoculum cells had significant effects on the biotransformation process; in particular, the existence of (NH(4))(2)SO(4) in the medium strongly inhibited the yield of 2-PE, while an increase in the amount of inoculum had a positive correlation with the yield of 2-PE. The optimum condition for production of 2-PE was obtained using the following uniform design: glucose 34.16 g L(-1), yeast nitrogen base 0.17 g L(-1), MgSO4 0.5 g L(-1), KH2PO4 14.89 g L(-1), (NH4)2SO4 0 g L(-1), L-Phe 5 g L(-1), and an inoculum amount of 1.6 × 10(7) cells/mL. With the optimised conditions, the yield of 2-PE was further increased to 3.52 g L(-1) (an increase of 249.5%), which corresponds to a molar conversion rate of 95.19%.

  12. How and when plume zonation appeared during the 132 Myr evolution of the Tristan Hotspot

    Science.gov (United States)

    Hoernle, Kaj; Rohde, Joana; Hauff, Folkmar; Garbe-Schönberg, Dieter; Homrighausen, Stephan; Werner, Reinhard; Morgan, Jason P.

    2015-07-01

    Increasingly, spatial geochemical zonation, present as geographically distinct, subparallel trends, is observed along hotspot tracks, such as Hawaii and the Galapagos. The origin of this zonation is currently unclear. Recently zonation was found along the last ~70 Myr of the Tristan-Gough hotspot track. Here we present new Sr-Nd-Pb-Hf isotope data from the older parts of this hotspot track (Walvis Ridge and Rio Grande Rise) and re-evaluate published data from the Etendeka and Parana flood basalts erupted at the initiation of the hotspot track. We show that only the enriched Gough, but not the less-enriched Tristan, component is present in the earlier (70-132 Ma) history of the hotspot. Here we present a model that can explain the temporal evolution and origin of plume zonation for both the Tristan-Gough and Hawaiian hotspots, two end member types of zoned plumes, through processes taking place in the plume sources at the base of the lower mantle.

  13. Etap Software Based Transient, Ground Grid and Short Circuit Analyses of 132 KV Grid

    Science.gov (United States)

    Bashir, Adnan; Jabbar Khan, Rana A.; Junaid, Muhammad; Mansoor Asghar, M.

    2010-06-01

    Faults always contribute significantly in disturbing the reliability and security of an integrated electrical power system. This requires the considerable attention of researchers and power industry stake holders to address these issues using latest instrumentation techniques. For this purpose a practical power system of 132 kV Grid has been selected for comprehensive analyses using Electrical Transient Analyzer Program (ETAP) software for Transient, Short circuit and Ground Grid analyses. In Transient analysis different waveforms like variation in bus frequency, bus real power loading, bus voltage angle and bus reactive power loading have been recorded for short interval of time. During Ground Grid modeling which is based upon practical data, step and touch potential have been calculated in comparison with set standards. While performing short circuit analysis all the possible short circuit faults like line to ground, double line to ground 3-phase faults etc on 1/2 cycle, 1.5 to 4 cycle and 30 cycle networks have been performed to record the short circuit currents. These real time data analyses provide opportunity to utilities about the remedial measures for the issues high-lighted in them.

  14. Alopecia areata totalis and universalis: a multicenter review of 132 patients in Spain.

    Science.gov (United States)

    Vañó-Galván, S; Fernández-Crehuet, P; Grimalt, R; Garcia-Hernandez, M J; Rodrigues-Barata, R; Arias-Santiago, S; Molina-Ruiz, A; Garcia-Lora, E; Dominguez-Cruz, J; Brugues, A; Ferrando, J; Serrano-Falcón, C; Serrano, S; Paoli, J; Camacho, F

    2017-03-01

    Alopecia areata totalis (AAT) and universalis (AAU) pose a therapeutic challenge. To describe the clinical and epidemiological features, therapeutic response and prognostic factors in a large series of patients diagnosed with AAT and AAU. This retrospective multicenter study included patients diagnosed with AAT/AAU with a minimum follow-up of 12 months. Response was assessed based on the regrowth of scalp hair. In all, 132 patients (92 women and 40 men) - 80 (61%) diagnosed with AAU and 52 (39%) diagnosed with AAT - were included. The median time between the presentation of alopecia areata (AA) and the development of extensive AA was 1 year and it was less than 4 years in 121 patients (91%). There was an initial response to treatment in 64% of patients, although only 14% presented a persistent response. Adverse side effects from the medications used were detected in 33% of patients. The prognostic factors associated with poor response were the presence of AAU and a positive family history of AA. Treatment of AAT and AAU is challenging. Although an initial regrowth may be achieved, the duration of response is usually short. There were no significant differences on the effectiveness or duration of response between the various systemic therapies. © 2016 European Academy of Dermatology and Venereology.

  15. S18 family of mitochondrial ribosomal proteins: evolutionary history and Gly132 polymorphism in colon carcinoma.

    Science.gov (United States)

    Mushtaq, Muhammad; Ali, Raja Hashim; Kashuba, Vladimir; Klein, George; Kashuba, Elena

    2016-08-23

    S18 family of mitochondrial ribosomal proteins (MRPS18, S18) consists of three members, S18-1 to -3. Earlier, we found that overexpression of S18-2 protein resulted in immortalization and eventual transformation of primary rat fibroblasts. The S18-1 and -3 have not exhibited such abilities. To understand the differences in protein properties, the evolutionary history of S18 family was analyzed. The S18-3, followed by S18-1 and S18-2 emerged as a result of ancient gene duplication in the root of eukaryotic species tree, followed by two metazoan-specific gene duplications. However, the most conserved metazoan S18 homolog is the S18-1; it shares the most sequence similarity with S18 proteins of bacteria and of other eukaryotic clades. Evolutionarily conserved residues of S18 proteins were analyzed in various cancers. S18-2 is mutated at a higher rate, compared with S18-1 and -3 proteins. Moreover, the evolutionarily conserved residue, Gly132 of S18-2, shows genetic polymorphism in colon adenocarcinomas that was confirmed by direct DNA sequencing.Concluding, S18 family represents the yet unexplored important mitochondrial ribosomal proteins.

  16. AgRP(83-132) and SHU9119 differently affect activity-based anorexia.

    Science.gov (United States)

    Hillebrand, Jacquelien J G; Kas, Martien J H; Scheurink, Anton J W; van Dijk, Gertjan; Adan, Roger A H

    2006-08-01

    Activity-based anorexia (ABA) mimics starvation and hyperactivity of anorexia nervosa patients in rats. Activation of the melanocortin (MC) system leads to hypophagia and increased energy expenditure in ad libitum fed rats. Therefore, activation of the MC system might underlie the development and propagation of ABA. Pro-opiomelanocortin (POMC) gene expression is normally decreased during negative energy balance. Strikingly, we found a transient up-regulation of POMC mRNA levels in the arcuate nucleus during the development of ABA, indicating a hyperactive MC system. However, wheel running and food intake were not influenced by treating ABA rats with the competitive antagonist SHU9119. This suggests that agonism of MC receptors by endogenous alpha-melanocyte-stimulating hormone (alpha-MSH) levels does not underlie ABA. Instead, treatment with the inverse agonist AgRP(83-132) did ameliorate signs of ABA. This implies that modulation of constitutive MC receptor activity rather than antagonizing putative alpha-MSH release contributes to the development and propagation of ABA.

  17. Approaching the r-process "waiting point" nuclei below $^{132}$Sn: quadrupole collectivity in $^{128}$Cd

    CERN Multimedia

    Reiter, P; Blazhev, A A; Nardelli, S; Voulot, D; Habs, D; Schwerdtfeger, W; Iwanicki, J S

    We propose to investigate the nucleus $^{128}$Cd neighbouring the r-process "waiting point" $^{130}$Cd. A possible explanation for the peak in the solar r-abundances at A $\\approx$ 130 is a quenching of the N = 82 shell closure for spherical nuclei below $^{132}$Sn. This explanation seems to be in agreement with recent $\\beta$-decay measurements performed at ISOLDE. In contrast to this picture, a beyond-mean-field approach would explain the anomaly in the excitation energy observed for $^{128}$Cd rather with a quite large quadrupole collectivity. Therefore, we propose to measure the reduced transition strengths B(E2) between ground state and first excited 2$^{+}$-state in $^{128}$Cd applying $\\gamma$-spectroscopy with MINIBALL after "safe" Coulomb excitation of a post-accelerated beam obtained from REX-ISOLDE. Such a measurement came into reach only because of the source developments made in 2006 for experiment IS411, in particular the use of a heated quartz transfer line. The result from the proposed measure...

  18. MiR-132 Regulates Rem Expression in Cardiomyocytes During Long-Term β-Adrenoceptor Agonism

    Directory of Open Access Journals (Sweden)

    Elba D. Carrillo

    2015-04-01

    Full Text Available Aims: To characterize the effects of long-term β-adrenergic receptor stimulation on Rem protein and mRNA expression in rat heart and possible involvement of miR-132. Methods: Adult rats were treated with isoproterenol (ISO, 150 µg.kg.h-1 for 2 d and Rem, miR-132, and α1c (the principal subunit of Cav1.2 channels were measured at protein and mRNA levels with western blot and quantitative reverse transcriptase polymerase chain reaction (qRT-PCR experiments, respectively. Ca2+ currents and intracellular Ca2+ signals were evaluated in isolated cardiomyocytes. Results: Systemic administration of ISO led to decreases in Rem protein and mRNA levels (down to 49%. Furthermore, levels of the microRNAs (miRs miR-132 and miR-214 were upregulated 5- and 9-fold, respectively. Transfection of miR-132, but not miR-214, into HEK293 cells reduced the expression of a luciferase reporter gene controlled by a conserved 3´-untranslated region (UTR of Rem by half. Chronic ISO administration also led to a 25% decrease in the amplitude of peak L-type Ca2+ currents, a 40% decrease in α1c subunit protein abundance at the membrane level, and a 60% decrease in expression of α1c channel subunit mRNA. Conclusions: These results suggest that Rem expression is down-regulated posttranscriptionally by miR-132 in response to long-term activation of β-adrenergic signaling, but this down-regulation does not produce a larger Ca2+ influx through Cav1.2 channels.

  19. Development of a BNP1-32 Immunoassay That Does Not Cross-React with proBNP.

    Science.gov (United States)

    Lewis, Lynley K; Raudsepp, Sara D; Yandle, Tim G; Prickett, Timothy C; Richards, A Mark

    2017-06-01

    Plasma B-type natriuretic peptide (BNP) concentration reflects cardiac dysfunction and assists in determining the diagnosis and prognosis of heart failure (HF). Current BNP assays overestimate circulating bioactive BNP1-32 concentrations as they also detect less active BNP metabolites and proBNP. A specific BNP1-32 assay with negligible cross-reactivity to proBNP and/or BNP metabolites may be advantageous. We developed a Luminex-based specific BNP1-32 immunoassay and compared results obtained from 3 other BNP assays (a Luminex-based total-BNP assay, our BNP RIA, and the commercially available Abbott Architect BNP assay) in plasma from 42 patients with HF and 22 healthy controls. The BNP1-32 assay showed 57% cross-reactivity with BNP2-32, but ≤0.1% cross-reactivity to BNP3-32, other BNP metabolites, and proBNP; its detection limit was 0.35 ng/L; and intra- and interassay CVs were 32, total-BNP, BNP RIA, and Abbott BNP assays respectively). The fold increase between HF cases with the New York Heart Association (NYHA) class IV was significantly greater with the BNP1-32 assay than the Abbott BNP (P = 0.026) and the BNP RIA (P 32 in plasma without interference by proBNP. Analysis of larger patient cohorts is now required to compare the performance of this assay with current less specific assays for the diagnosis or prognosis of HF. © 2017 American Association for Clinical Chemistry.

  20. Spatially Resolved X-ray Spectroscopy of the Large Magellanic Cloud Supernova Remnant N132D

    Science.gov (United States)

    Plucinsky, Paul; Sharda, Piyush; Gaetz, Terrance; Kashyap, Vinay

    2018-01-01

    We perform detailed X-ray spectroscopy of the brightest Supernova Remnant (SNR), N132D, in the Large Magellanic Cloud (LMC) using observations taken by the Advanced CCD Imaging Spectrometer (ACIS) on the Chandra X-ray Observatory (Chandra). By studying the spectra of regions on the well-defined rim running from NW to NE, we determine an average abundance set for O, Ne, Mg, Si, S and Fe for the local LMC environment. We note that the elements other than Fe and Ne show significant trends across this region, implying they cannot be approximated by a single, constant value. We characterize the blast wave properties and find a simple plane parallel shock model is sufficient to explain the X-ray spectrum of the forward shock moving into ambient LMC material, with a shock velocity near 800 km/s and a shock age of 600-1100 years. We find evidence of enhanced Si near the western blast wave which would imply an asymmetric explosion. We fit a region near the central, optical O-rich knots which exhibits enhanced abundances of O, Ne, Mg, Si, and Fe. Comparison to nucleosynthesis models of the ratios of these elements indicates a progenitor mass of 28-35 solar masses, consistent with most previous estimates. Lastly, we find an intriguing presence of a very hot plasma with a temperature of ~4.5 keV (assuming a non-equilibrium ionization model) to explain the Fe-K emission which is centrally concentrated in the lower half of the remnant.

  1. Investigating Catalyst-Support Interactions To Improve the Hydrogen Evolution Reaction Activity of Thiomolybdate [Mo3S13](2-) Nanoclusters

    DEFF Research Database (Denmark)

    Hellstern, Thomas R.; Kibsgaard, Jakob; Tsai, Charlie

    2017-01-01

    a structural motif that resembles the active site of MoS2 and has been reported to be among the most active forms of molybdenum sulfide. Herein, we improve the activity of the [Mo3S13](2-) catalysts through catalyst support interactions. We synthesize [Mo3S13](2-) on gold, silver, glassy carbon, and copper...

  2. Amino acid positions 69-132 of UGT1A9 are involved in the C-glucuronidation of phenylbutazone.

    Science.gov (United States)

    Nishiyama, Takahito; Fujishima, Miki; Masuda, Yasuhiro; Izawa, Tadashi; Ohnuma, Tomokazu; Ogura, Kenichiro; Hiratsuka, Akira

    2008-10-01

    Phenylbutazone (PB) is known to be biotransformed to its O- and C-glucuronide. Recently, we reported that PB C-glucuronide formation is catalyzed by UGT1A9. Interestingly, despite UGT1A8 sharing high amino acid sequence identity with UGT1A9, UGT1A8 had no PB C-glucuronidating activity. In the present study, we constructed eight UGT1A9/UGT1A8 chimeras and evaluated which region is important for PB C-glucuronide formation. All of the chimeras and UGT1A8 and UGT1A9 had 7-hydroxy-(4-trifluoromethyl)coumarin (HFC) O-glucuronidating activity. The K(m) values for HFC glucuronidation of UGT1A8, UGT1A9 and their chimeras were divided into two types, UGT1A8 type (high K(m)) and UGT1A9 type (low K(m)), and these types were determined according to whether their amino acids at positions 69-132 were those of UGT1A8 or UGT1A9. Likewise, PB O-glucuronidating activity was also detected by all of the chimeras, and their K(m) values were divided into two types. On the contrary, PB C-glucuronidating activity was detected by UGT1A9((1-132))/1A8((133-286)), UGT1A9((1-212))/1A8((213-286)), UGT1A8((1-68))/1A9((69-286)), and UGT1A8((1-68))/1A9((69-132))/1A8((133-286)) chimeras. The region 1A9((69-132)) was common among chimeras having PB C-glucuronidating activity. Of interest is that UGT1A9((1-68))/1A8((69-132))/1A9((133-286)) had lost PB C-glucuronidation activity, but retained activities of PB and HFC O-glucuronidation. These results strongly suggested that amino acid positions 69-132 of UGT1A9 are responsible for chemoselectivity for PB and affinity to substrates such as PB and HFC.

  3. MiR-132 regulates osteogenic differentiation via downregulating Sirtuin1 in a peroxisome proliferator-activated receptor β/δ–dependent manner

    Energy Technology Data Exchange (ETDEWEB)

    Gong, Kai; Qu, Bo; Liao, Dongfa; Liu, Da; Wang, Cairu; Zhou, Jingsong; Pan, Xianming, E-mail: xianmingpanxj@163.com

    2016-09-09

    MicroRNAs (miRNAs) play significant roles in multiple diseases by regulating the expression of their target genes. Type 2 diabetes mellitus (T2DM) is a chronic endocrine and metabolic disease with complex mechanisms. T2DM can result in diabetic osteoporosis (DO), which is characterized by bone loss, decreased bone mineral density and increased bone fractures. The promotion of osteogenic differentiation of osteoblasts is an effective way to treat osteoporosis. In the present study, high glucose (HG) and free fatty acids (FFA) were employed to mimic T2DM in MC3T3-E1 cells. To induce osteogenic differentiation, MC3T3-E1 cells were cultured in osteogenic medium. The results showed that osteogenic differentiation was significantly suppressed by HG and FFA. We found that miR-132 expression was significantly upregulated and much higher in HG-FFA–induced cells than other selected miRNAs, indicating that miR-132 might play an important role in DO. Furthermore, overexpression of miR-132 markedly inhibited the expression of key markers of osteogenic differentiation and alkaline phosphatase (ALP) activity. Reciprocally, inhibition of miR-132 restored osteogenic differentiation, even under treatment with HG-FFA. We also showed that Sirtuin 1 (Sirt1) was one of the target genes of miR-132, whose expression was controlled by miR-132. Ectopic expression of Sirt1 reversed the decrease in osteogenic differentiation caused by miR-132 and HG-FFA. These results demonstrated the direct role of miR-132 in suppressing osteogenic differentiation through downregulating Sirt1. Moreover, we demonstrated that peroxisome proliferator-activated receptor β/δ (PPARβ/δ) was a downstream molecule of Sirt1, and its knockout by PPARβ/δ siRNA significantly abolished the promotive effects of Sirt1 on osteogenic differentiation, indicating that Sirt1 functioned in a PPARβ/δ–dependent manner. Taken together, we provide crucial evidence that miR-132 plays a key role in regulating osteogenic

  4. A high-throughput analysis of the IDH1(R132H) protein expression in pituitary adenomas

    DEFF Research Database (Denmark)

    Casar-Borota, Olivera; Øystese, Kristin Astrid Berland; Sundström, Magnus

    2016-01-01

    PURPOSE: Inactivating mutations of isocitrate dehydrogenase (IDH) 1 and 2, mitochondrial enzymes participating in the Krebs tricarboxylic acid cycle play a role in the tumorigenesis of gliomas and also less frequently in acute myeloid leukemia and other malignancies. Inhibitors of mutant IDH1...... and IDH2 may potentially be effective in the treatment of the IDH mutation driven tumors. Mutations in the succinate dehydrogenase, the other enzyme complex participating in the Krebs cycle and electron transfer of oxidative phosphorylation occur in the paragangliomas, gastrointestinal stromal tumors......, and occasionally in the pituitary adenomas. We aimed to determine whether the IDH1(R132H) mutation, the most frequent IDH mutation in human malignancies, occurs in pituitary adenomas. METHODS: We performed immunohistochemical analysis by using a monoclonal anti-IDH1(R132H) antibody on the tissue microarrays...

  5. Evolution from quasielastic to deep-inelastic transfer in the system /sup 132/Xe + sup(nat)Fe

    Energy Technology Data Exchange (ETDEWEB)

    Reus, U.; Westmeier, W.; Esterlund, R.A.; Rox, A.; Rajagopalan, M.; Patzelt, P.

    1981-08-01

    Angular distributions of products from the reaction of 5.90 MeV/u /sup 132/Xe ions with a natural Fe target have been determined radiochemically, using catcher-foil techniques. Partially-damped products with charge near that of the projectile exhibit distributions which clearly evolve from quasielastic yields focussed near the grazing angle to deep-inelastic products orbiting towards forward angles.

  6. Analysis and Mitigation of Shunt Capacitor Bank Switching Transients on 132 kV Grid Station, Qasimabad Hyderabad

    Directory of Open Access Journals (Sweden)

    Sunny Katyara

    2015-10-01

    Full Text Available In this paper analysis and mitigation methods of capacitor bank switching transients on 132KV Grid station, Qasimabad Hyderabad are simulated through the MATLAB software (Matrix Laboratory. Analysis of transients with and without capacitor bank is made. Mathematical measurements of quantities such as transient voltages and inrush currents for each case are discussed. Reasons for these transients, their impact on utility and customer systems and their mitigation are provided.

  7. Leptin Induces Hippocampal Synaptogenesis via CREB-Regulated MicroRNA-132 Suppression of p250GAP

    Science.gov (United States)

    Dhar, Matasha; Zhu, Mingyan; Impey, Soren; Lambert, Talley J.; Bland, Tyler; Karatsoreos, Ilia N.; Nakazawa, Takanobu

    2014-01-01

    Leptin acts in the hippocampus to enhance cognition and reduce depression and anxiety. Cognitive and emotional disorders are associated with abnormal hippocampal dendritic spine formation and synaptogenesis. Although leptin has been shown to induce synaptogenesis in the hypothalamus, its effects on hippocampal synaptogenesis and the mechanism(s) involved are not well understood. Here we show that leptin receptors (LepRs) are critical for hippocampal dendritic spine formation in vivo because db/db mice lacking the long form of the leptin receptor (LepRb) have reduced spine density on CA1 and CA3 neurons. Leptin promotes the formation of mature spines and functional glutamate synapses on hippocampal pyramidal neurons in both dissociated and slice cultures. These effects are blocked by short hairpin RNAs specifically targeting the LepRb and are absent in cultures from db/db mice. Activation of the LepR leads to cAMP response element–binding protein (CREB) phosphorylation and initiation of CREB-dependent transcription via the MAPK kinase/Erk pathway. Furthermore, both Mek/Erk and CREB activation are required for leptin-induced synaptogenesis. Leptin also increases expression of microRNA-132 (miR132), a well-known CREB target, which is also required for leptin-induced synaptogenesis. Last, leptin suppresses the expression of p250GAP, a miR132 target, and this suppression is obligatory for leptin's effects as is the downstream target of p250GAP, Rac1. LepRs appear to be critical in vivo as db/db mice have lowered hippocampal miR132 levels and elevated p250GAP expression. In conclusion, we identify a novel signaling pathway by which leptin increases synaptogenesis through inducing CREB transcription and increasing microRNA-mediated suppression of p250GAP activity, thus removing a known inhibitor of Rac1-stimulated synaptogenesis. PMID:24877561

  8. THE THIRD MAN ARGUMENT(PARM.132A1-B2-A ‘PURELY’ METAPHYSICAL EXERCISE?

    Directory of Open Access Journals (Sweden)

    Marcus Nabielek

    2013-11-01

    Full Text Available All commentators of the ‘Parmenides’ agree that the Third Man argument, 132a-b2, raises a difficulty for Plato’s theory of forms. Many commentators, following Vlastos, hold that the argument’s infinite regress is vicious for epistemic reasons. Rickless contends that the infinite regress is vicious for exclusively metaphysical reasons. This essay intends to show that Rickless’ interpretation is inadequate, as well as to vindicate Vlastos’ interpretation.

  9. miR-132/212 knockout mice reveal roles for these miRNAs in regulating cortical synaptic transmission and plasticity.

    Directory of Open Access Journals (Sweden)

    Judit Remenyi

    Full Text Available miR-132 and miR-212 are two closely related miRNAs encoded in the same intron of a small non-coding gene, which have been suggested to play roles in both immune and neuronal function. We describe here the generation and initial characterisation of a miR-132/212 double knockout mouse. These mice were viable and fertile with no overt adverse phenotype. Analysis of innate immune responses, including TLR-induced cytokine production and IFNβ induction in response to viral infection of primary fibroblasts did not reveal any phenotype in the knockouts. In contrast, the loss of miR-132 and miR-212, while not overtly affecting neuronal morphology, did affect synaptic function. In both hippocampal and neocortical slices miR-132/212 knockout reduced basal synaptic transmission, without affecting paired-pulse facilitation. Hippocampal long-term potentiation (LTP induced by tetanic stimulation was not affected by miR-132/212 deletion, whilst theta burst LTP was enhanced. In contrast, neocortical theta burst-induced LTP was inhibited by loss of miR-132/212. Together these results indicate that miR-132 and/or miR-212 play a significant role in synaptic function, possibly by regulating the number of postsynaptic AMPA receptors under basal conditions and during activity-dependent synaptic plasticity.

  10. Estimación de la característica de Inductancia de fase del Motor de Reluctancia Conmutada MFR 132.1;Estimation of phase inductance profile of MFR 132.1 switched reluctance motor

    Directory of Open Access Journals (Sweden)

    Javier Quintana - Santos

    2011-06-01

    Full Text Available En el presente trabajo se enuncia la idea fundamental en la que se basan todos los métodos empleados para la estimación de los parámetros de fase de los motores de reluctancia conmutada. Se describe, además, un algoritmo de división con punto decimal fijo en lenguaje VHDL. El algoritmo descrito se utiliza posteriormente para la estimación de la inductancia de fase del motor de reluctancia conmutada MFR 132.1, mediante el empleo de la técnica invasiva de modulación de amplitud con señales de tensión pulsantes de tres estados. Se diseñó y construyó una instalación experimental sobre la base de un FPGA de Actel, de la familia ProASIC 3 modelo A3P250, para el procesamiento de las señales. Finalmente se exponen y comentan las características de inductancia de fase del motor de reluctancia MFR 132.1, obtenidas.In the present work is enunciated the fundamental idea of all the methods used for the estimation of phase parameters in the switched reluctance motors. The fixed point division algorithm employed to estimate the inactive phase inductance profile of the MFR 132.1 switched reluctance motor, is described in VHDL programming language. The algorithm implements the intrusive estimation technique of amplitude modulation with three states pulsating signals. The structure of the experimental set up for the digital signal processing, which is based on the Actel FPGA ProAsic 3 A3P250 development kit, is depicted. Finally, the inactive phase’s inductance profiles, which were experimentally obtained, are shown for different voltage values in the Direct Current converter link.

  11. Estimación de la característica de Inductancia de fase del Motor de Reluctancia Conmutada MFR 132.1 Estimation of phase inductance profile of MFR 132.1 switched reluctance motor

    Directory of Open Access Journals (Sweden)

    Javier Quintana Santos

    2011-06-01

    Full Text Available En el presente trabajo se enuncia la idea fundamental en la que se basan todos los métodos empleados para la estimación de los parámetros de fase de los motores de reluctancia conmutada. Se describe, además, un algoritmo de división con punto decimal fijo en lenguaje VHDL. El algoritmo descrito se utiliza posteriormente para la estimación de la inductancia de fase del motor de reluctancia conmutada MFR 132.1, mediante el empleo de la técnica invasiva de modulación de amplitud con señales de tensión pulsantes de tres estados. Se diseñó y construyó una instalación experimental sobre la base de un FPGA de Actel, de la familia ProASIC 3 modelo A3P250, para el procesamiento de las señales. Finalmente se exponen y comentan las características de inductancia de fase del motor de reluctancia MFR 132.1, obtenidas.  In the present work is enunciated the fundamental idea of all the methods used for the estimation of phase parameters in the switched reluctance motors. The fixed point division algorithm employed to estimate the inactive phase inductance profile of the MFR 132.1 switched reluctance motor, is described in VHDL programming language. The algorithm implements the intrusive estimation technique of amplitude modulation with three states pulsating signals. The structure of the experimental set up for the digital signal processing, which is based on the Actel FPGA ProAsic 3 A3P250 development kit, is depicted. Finally, the inactive phase’s inductance profiles, which were experimentally obtained, are shown for different voltage values in the Direct Current converter link.

  12. Effective immuno-targeting of the IDH1 mutation R132H in a murine model of intracranial glioma.

    Science.gov (United States)

    Pellegatta, Serena; Valletta, Lorella; Corbetta, Cristina; Patanè, Monica; Zucca, Ileana; Riccardi Sirtori, Federico; Bruzzone, Maria Grazia; Fogliatto, Gianpaolo; Isacchi, Antonella; Pollo, Bianca; Finocchiaro, Gaetano

    2015-01-21

    The R132H mutation of cytosolic isocitrate dehydrogenase (IDH1) is present in the majority of low grade gliomas.Immunotherapy in these tumors has an interesting, still unexploited, therapeutic potential, as they are less immunosuppressive than glioblastomas. Using site-directed mutagenesis we introduced the R132H mutation into the murine glioma cell line GL261,creating mIDH1-GL261. Presence of the mutation was confirmed by immunoblotting and production of the oncometabolite 2-hydroxyglutarate (2HG), demonstrated by mass spectrometry (LC-MS/MS) performed on cell supernatant. In vitro mIDH1-GL261 had different morphology but similar growth rate than parental GL261 (p-GL261). After intracranial injection, MRI suggested that the initial growth rate was slower in mIDH1-GL261 than p-GL261 gliomas but overall survival was similar. mIDH1-GL261 gliomas showed evidence of R132H expression and of intratumoral 2HG production (evaluated by MRS and LC-MS/MS). Immunizations were performed nine days after intracranial implantation of mIDH1- or p-GL261 cells by three subcutaneous injections of five different peptides encompassing the IDH1 mutation site, all emulsified with Montanide ISA-51, in association with GM-CSF. Control mice were injected with four ovalbumin peptides or vehicle. Mice with mIDH1-GL261 but not p-GL261 gliomas treated with mIDH1 peptides survived longer than controls; 25% of them were cured. Immunized mice showed higher amounts of peripheral CD8+ T cells, higher production of IFN-γ, and evidence of anti-mIDH1 antibodies.Immunizations led to intratumoral up-regulation of IFN-γ, granzyme-b and perforin-1 and down-regulation of TGF-β2 and IL-10. These results support the translational potential of immunotherapeutic targeting of gliomas carrying IDH1 mutations.

  13. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B

    2015-01-01

    INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular......, signalling molecules and transcription factors. Subsequent comprehensive in silico analysis identified 24 target genes, of which 22 genes were qPCR validated. We identified seven genes involved in AngII signalling pathways. CONCLUSION: We here report novel insight of an extensive network of molecular...

  14. Boson-model M1 form factors for inelastic electron scattering on sup 130,132,134 Ba

    Energy Technology Data Exchange (ETDEWEB)

    Lipas, P.O.; Koskinen, M. (Jyvaeskylae Univ. (Finland). Dept. of Physics); Harter, H.; Nojarov, R.; Faessler, Amand (Tuebingen Univ. (Germany, F.R.). Inst. fuer Theoretische Physik)

    1991-06-01

    The proton-neutron interacting-boson model (IBA-2) is used to predict the (e,e') form factor for collective 1{sup +} excitation in {sup 130,132,134}Ba. A simple estimate of the {sup 130}Ba transition current density, and thence of the form factor, is obtained from the known form factor of {sup 164}Dy by a scaling method built on PWBA and Fourier-Bessel analysis. A weightier prediction is obtained from microscopic boson structure and DWBA. The 1{sup +} excitation should be observable in the bariums. Boson g factors are calculated. (author).

  15. $\\beta$-delayed neutron spectroscopy of $^{130-132}$ Cd isotopes with the ISOLDE decay station and the VANDLE array

    CERN Multimedia

    We propose to use the new ISOLDE decay station and the neutron detector VANDLE to measure the $\\beta$-delayed neutron emission of N=82-84 $^{130-132}$Cd isotopes. The large delayed neutron emission probability observed in a previous ISOLDE measurement is indicative of the Gamow-Teller transitions due to the decay of deep core neutrons. Core Gamow-Teller decay has been experimentally proven in the $^{78}$Ni region for the N>50 nuclei using the VANDLE array. The spectroscopic measurement of delayed neutron emission along the cadmium isotopic chain will allow us to track the evolution of the single particle states and the shell gap.

  16. Remaining Sites Verification Package for 132-D-3, 1608-D Effluent Pumping Station, Waste Site Reclassification Form 2005-033

    Energy Technology Data Exchange (ETDEWEB)

    R. A. Carlson

    2006-05-09

    Decommissioning and demolition of the 132-D-3 site, 1608-D Effluent Pumping Station was performed in 1986. Decommissioning included removal of equipment, water, and sludge for disposal as radioactive waste. The at- and below-grade structure was demolished to at least 1 m below grade and the resulting rubble buried in situ. The area was backfilled to grade with at least 1 m of clean fill and contoured to the surrounding terrain. Residual concentrations support future land uses that can be represented by a rural-residential scenario and pose no threat to groundwater or the Columbia River based on RESRAD modeling.

  17. The neuroprotective effect of miRNA-132 against amyloid β-protein-induced neuronal damage via upregulation of brain-derived neurotrophic factor

    Directory of Open Access Journals (Sweden)

    Lei XIANG

    2016-08-01

    Full Text Available Background Brain-derived neurotrophic factor (BDNF plays a crucial role in the pathogenesis of Alzheimer's disease (AD. MicroRNA (miRNA-132, which is widely expressed in neurons, is involved in BDNF-mediated neural development by regulating the expression of target gene. This study aims to investigate the effect of miRNA-132 on BDNF and its neuroprotective effect.  Methods The hippocampal neurons were transfected by miRNA-132 after 72 h in vitro, then exposed to amyloid β-protein (Aβ on the 7th day to build AD models. The difference of miRNA-132 expression between AD group and control group was detected by real-time fluorescent quantitative polymerase chain reaction (PCR. The alterations of BDNF mRNA were observed in the neurons of different groups. Finally, the cell viability was observed by methyl thiazolyl tetrazolium (MTT assay in AD neurons transfected with miRNA-132 or incubated with BDNF. Results 1 MiRNA-132 was significantly decreased (t = 13.888, P = 0.000, and the expression of BDNF mRNA was also reduced in AD group (t = -12.274, P = 0.000. 2 Green fluorescence was clearly visible by inverted phase-contrast fluorescence microscopy after transfected with miRNA-132. BDNF mRNA was upregulated when miRNA-132 overexpression both in control group (t = 16.135, P = 0.000 and AD group (t = 8.656, P = 0.000. 3 Cell viability was obviously decreased in neurons exposed to Aβ (t = -6.023, P = 0.000, which was improved when transfected with miRNA-132 (t = 3.385, P = 0.007 or incubated with BDNF (t = 3.672, P = 0.004.  Conclusions The expression of miRNA-132 and BDNF was reduced in neuronal AD model. MiRNA-132 played an important role on neuroprotection against A β-induced neuronal damage via upregulation of BDNF. It could be expected to provide new perspective for the diagnosis and treatment of AD. DOI: 10.3969/j.issn.1672-6731.2016.07.009

  18. IDH1R132H Promotes Malignant Transformation of Benign Prostatic Epithelium by Dysregulating MicroRNAs: Involvement of IGF1R-AKT/STAT3 Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Lili Zhang

    2018-02-01

    Full Text Available Risk stratification using molecular features could potentially help distinguish indolent from aggressive prostate cancer (PCa. Mutations in isocitrate dehydrogenase (IDH acquire an abnormal enzymatic activity, resulting in the production of 2-hydroxyglutarate and alterations in cellular metabolism, histone modification, and DNA methylation. Mutant IDH1 has been identified in various human malignancies, and IDH1R132H constituted the vast majority of mutational events of IDH1. Most recent studies suggested that IDH1 mutations define a methylator subtype in PCa. However, the function of IDH1R132H in PCa development and progression is largely unknown. In this study, we showed that the prevalence of IDH1R132H in Chinese PCa patients is 0.6% (2/336. Of note, IDH1R132H-mutant PCa patients lacked other canonical genomic lesions (e.g., ERG rearrangement, PTEN deletion that are common in most other PCa patients. The in vitro experiment suggested that IDH1R132H can promote proliferation of benign prostate epithelial cell RWPE-1 when under the situation of low cytokine. It could also promote migration capacity of RWPE-1 cells. Mechanistically, IDH1R132H was an important regulator of insulin-like growth factor 1receptor (IGF1R by downregulating a set of microRNAs (miR-141-3p, miR-7-5p, miR-223-3p. These microRNAs were repressed by the alteration of epigenetic modification to decrease the enrichment of active marker H3K4me3 or to increase repressive marker H3K27me3 at their promoters. Collectively, we proposed a novel model for an IDH1R132H-microRNAs-IGF1R regulatory axis, which might provide insight into the function of IDH1R132H in PCa development.

  19. Upregulated ROS production induced by the proteasome inhibitor MG-132 on XBP1 gene expression and cell apoptosis in Tca-8113 cells.

    Science.gov (United States)

    Chen, Hai-ying; Ren, Xiao-yan; Wang, Wei-hua; Zhang, Ying-xin; Chen, Shuang-feng; Zhang, Bin; Wang, Le-xin

    2014-07-01

    Exposure of Tca-8113 cells to proteasome inhibitor carbobenzoxy-Leu-Leu-leucinal (MG-132) causing apoptosis is associated with endoplasmic reticulum (ER) stress. X-box-binding protein-1 (XBP1) is an important regulator of a subset of genes active during ER stress, which is related to cell survival and is required for tumor growth. The present study is to evaluate the effect of MG-132 on ROS production, XBP1 gene expression, tumor necrosis factor receptor-associated factor 2 (TRAF2), ASK1 and c-jun protein expression in tongue squamous cell carcinoma cell line Tca-8113 cells. ROS production was measured by reactive oxygen species assay. X-box binding protein-1 (XBP1) mRNA was analyzed by real-time-PCR, TRAF2, ASK1 and c-jun protein were investigated by western blot and immunocytochemistry respectively. The result indicated that ROS production, TRAF2, ASK1 and c-jun were elevated in MG-132 treated cells. Giving ROS scavenger N-acetyl-L-cysteine (NAC) largely prevented the effects of MG-132. Furthermore, treating with MG-132 lead to decreased XBP1 mRNA expression but could not completely block the expression of XBP1. Taken together, these findings provide the evidence that MG-132 induced ER stress lead to Tca-8113 cells apoptosis through ROS generation and TRAF2-ASK1-JNK signal pathway activation. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  20. [Plasmid pSym1-32 from Rhizobium leguminosarum bv. viceae, controlling nitrogen-fixing activity, effectiveness of symbiosis, competitiveness, and acid tolerance].

    Science.gov (United States)

    Kurchak, O N; Provorov, N A; Simarov, B V

    2001-09-01

    The symbiotic plasmid (pSym1-32) of the highly effective Rhizobium leguminosarum bv. viceae 1-32 strain was identified after the conjugal transfer of replicons carrying Tn5-mob into the plasmidless Agrobacterium tumefaciens Gm1-9023 strain. Plasmid pSym1-32 was transferred into R. leguminosarum bv. viceae strains Y14 (showing low effectiveness of symbiosis with Vicia villosa) and Y57 (unable to fix nitrogen). Transconjugants formed Fix+ nodules on roots of V. villosa and had a highly enhanced nitrogen fixing ability, increased plant weight, and increased nitrogen accumulation compared to the recipient strains. Variation of transconjugants in symbiotic properties (accompanied by alterations in plasmid composition in some of the conjugants) was detected. Moreover, the donor strain R. leguminosarum bv. viceae 1-32 was shown to be more efficient in the competitiveness and acid tolerance than the recipient Y14 strain. Both these properties were transmitted upon transfer of pSym1-32 into the recipient. Thus, plasmid pSym1-32 was shown to carry genes involved in the control of the nitrogen fixing ability, symbiotic effectiveness, competitiveness, and acid tolerance in R. leguminosarum bv. viceae.

  1. Activity-dependent expression of miR-132 regulates immediate-early gene induction during olfactory learning in the greater short-nosed fruit bat, Cynopterus sphinx.

    Science.gov (United States)

    Mukilan, Murugan; Ragu Varman, Durairaj; Sudhakar, Sivasubramaniam; Rajan, Koilmani Emmanuvel

    2015-04-01

    The activity-dependent expression of immediate-early genes (IEGs) and microRNA (miR)-132 has been implicated in synaptic plasticity and the formation of long-term memory (LTM). In the present study, we show that olfactory training induces the expression of IEGs (EGR-1, C-fos, C-jun) and miR-132 at similar time scale in olfactory bulb (OB) of Cynopterus sphinx. We examined the role of miR-132 in the OB using antisense oligodeoxynucleotide (AS-ODN) and demonstrated that a local infusion of AS-ODN in the OB 2h prior to training impaired olfactory memory formation in C. sphinx. However, the infusion of AS-ODN post-training did not cause a deficit in memory formation. Furthermore, the inhibition of miR-132 reduced the olfactory training-induced expression of IEGs and post synaptic density protein-95 (PSD-95) in the OB. Additionally, we show that miR-132 regulates the activation of calcium/calmodulin-dependent protein kinase-II (CaMKII) and cAMP response element binding protein (CREB), possibly through miR-148a. These data suggest that olfactory training induces the expression of miR-132 and IEGs, which in turn activates post-synaptic proteins that regulate olfactory memory formation. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Different collectivity in the two signatures of the i13/2 stemming band in 167Yb

    Science.gov (United States)

    Petkov, P.; Gladnishki, K. A.; Dewald, A.; Möller, O.; Deloncle, I.; Reese, M.; Fransen, C.; Hackstein, M.; Jolie, J.; Pissulla, Th; Rother, W.; Zell, K. O.

    2014-09-01

    Six lifetimes have been determined in the 5/2+ [642] band from vi13/2 parentage in 167Yb by means of Recoil distance Doppler-shift (RDDS) measurements carried out at the Cologne FN tandem. The deduced transition strengths and the level scheme are reasonably described by Particle plus triaxial rotor model (PTRM) calculations except for the behavior of the quadrupole collectivity in the two signatures of the 5/2+[642] band. In that band, the quadrupole collectivity of the favored signature is appreciably larger than this of the unfavored signature. The effect increases with increasing the spin. Naturally, the rigid PTRM cannot explain these features, but the structure of its wave functions suggests a possible solution. It is associated with the enhanced contribution of low-Ω orbitals from vi13/2 parentage in the favored signature compared to the unfavored one. This could selectively increase the deformation of the favored signature band members and give rise to a dynamic shape coexistence taking place between the two signatures which needs quantitative explanation by future theoretical work.

  3. Crystal structure of 2-azido-1,3-bis(2,6-diisopropylphenyl-1,3,2-diazaphospholidine

    Directory of Open Access Journals (Sweden)

    Alex J. Veinot

    2017-06-01

    Full Text Available The title compound, C26H38N5P, was synthesized by reacting 2-chloro-1,3-bis(2,6-diisopropylphenyl-1,3,2-diazaphospholidine with sodium azide and a catalytic amount of lithium chloride in tetrahydrofuran. The title compound is the first structurally characterized 2-azido-1,3,2-diazaphospholidine and exhibits a P atom in a trigonal pyramidal geometry. The azide P—N bond length of 1.8547 (16 Å is significantly longer than the P—N separations for the chelating diamine [P—N = 1.6680 (15 and 1.6684 (14 Å]. The sterically hindered 2,6-diisopropylphenyl groups twist away from the central heterocycle, with dihedral angles between the central heteocyclic ring and benzene rings of 76.17 (10 and 79.74 (9°. In the crystal, a weak C—H...N link to the terminal N atom of the azide group leads to [100] chains.

  4. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    INTRODUCTION. Fluorescent materials, particularly blue fluorescent materials have gained strong interest because ... emitting complexes in different technical applications, such as emitting materials for organic light emitting ..... properties of three novel two-dimensional lanthanide coordination polymers with mixed aromatic ...

  5. Pyroelectric Ferroelectric and Resistivity Studies on Samarium ...

    African Journals Online (AJOL)

    Barium Strontium Sodium Niobate (Ba1-xSrx)2NaNb5O15 (BSNN) belongs to tungsten bronze ferroelectric morphotrophic phase boundary (MPB) system at x = 0.6, having large spontaneous polarisation, pyroelectric coefficient and low dielectic constant and is expected to be applicable for piezoceramic filter and ...

  6. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    emitting complexes in different technical applications, such as emitting materials for organic light emitting diodes, sensitizers in solar energy conversion, chemical sensors and so forth [6-9]. The ability of bipy to act as a rigid ..... properties of three-dimensional organic-inorganic hybrids based on α-metatungstate. Inorg. Chim.

  7. Expression of R132H mutational IDH1 in human U87 glioblastoma cells affects the SREBP1a pathway and induces cellular proliferation.

    Science.gov (United States)

    Zhu, Jian; Cui, Gang; Chen, Ming; Xu, Qinian; Wang, Xiuyun; Zhou, Dai; Lv, Shengxiang; Fu, Linshan; Wang, Zhong; Zuo, Jianling

    2013-05-01

    Sterol regulatory element-binding protein-1a (SREBP1a) is a member of the SREBP family of transcription factors, which mainly controls homeostasis of lipids. SREBP1a can also activate the transcription of isocitrate dehydrogenase 1 (IDH1) by binding to its promoter region. IDH1 mutations, especially R132H mutation of IDH1, are a common feature of a major subset of human gliomas. There are few data available on the relationship between mutational IDH1 expression and SREBP1a pathway. In this study, we investigated cellular effects and SREBP1a pathway alterations caused by R132H mutational IDH1 expression in U87 cells. Two glioma cell lines, stably expressing mutational (U87/R132H) or wild type (U87/wt) IDH1, were established. A cell line, stably transfected with pcDNA3.1(+) (U87/vector), was generated as a control. Click-iT EdU assay, sulforhodamine B assay, and wound healing assay respectively showed that the expression of R132H induced cellular proliferation, cell growth, and cell migration. Western blot revealed that SREBP1 was increased in U87/R132H compared with that in U87/wt. Elevated SREBP1a and several its target genes, but not SREBP1c, were detected by real-time polymerase chain reaction in U87/R132H. All these findings indicated that R132H mutational IDH1 is involved in the regulation of proliferation, growth, and migration of glioma cells. These effects may partially be mediated by SREBP1a pathway.

  8. Fusion-like processes and the concept of dynamic equivalence: the system /sup 132/Xe+sup(nat)Fe

    Energy Technology Data Exchange (ETDEWEB)

    Esterlund, R.A.; Westmeier, W.; Reus, U.; Habbestad Waetzig, A.M.; Patzelt, P.

    1985-03-11

    Cross sections for production of nuclides in the reaction of 4.56, 5.90 and 7.12 MeV/u /sup 132/Xe ions with thick natural Fe targets were determined, and the corresponding mass- and charge-yield curves have been constructed. The latter are resolved into components corresponding to fusion-fission (symmetric fragmentation), fusion-evaporation, deep-inelastic transfer and quasielastic transfer. The integral excitation functions for fusion and fusion-like processes exhibit very good agreement with the predictions of the dynamic capture model of Swiatecki. Furthermore, the observed extra push energies for this system and those of /sup 208/Pb+/sup 48/Ca show very similar dependencies on the corresponding entrance-channel orbital energies, in line with the model prediction that these systems should be dynamically equivalent.

  9. Fusion-like processes and the concept of dynamic equivalence: The system 132Xe + natFe

    Science.gov (United States)

    Esterlund, R. A.; Westmeier, W.; Reus, U.; Wätzig, A. M. Habbestad; Patzelt, P.

    1985-03-01

    Cross sections for production of nuclides in the reaction of 4.56, 5.90 and 7.12 {MeV}/{u}132Xe ions with thick natural Fe targets were determined, and the corresponding mass- and charge-yield curves have been constructed. The latter are resolved into components corresponding to fusion-fission (symmetric fragmentation), fusion-evaporation, deep-inelastic transfer and quasielastic transfer. The integral excitation functions for fusion and fusion-like processes exhibit very good agreement with the predictions of the dynamic capture model of Swiatecki. Furthermore, the observed extra push energies for this system and those of 208Pb + 48Ca show very similar dependencies on the corresponding entrance-channel orbital energies, in line with the model prediction that these systems should be dynamically equivalent.

  10. 2p1v states populated in 135Te from 9Be induced reactions with a 132Sn beam

    Energy Technology Data Exchange (ETDEWEB)

    Allmond, James M [ORNL; Stuchbery, Andrew E [ORNL; Brown, Alex [National Superconducting Cyclotron Laboratory (NSCL), Michigan State University; Beene, James R [ORNL; Galindo-Uribarri, Alfredo {nmn} [ORNL; Gross, Carl J [ORNL; Liang, J Felix [ORNL; Padilla-Rodal, Elizabeth [Universidad Nacional Autonoma de Mexico (UNAM); Radford, David C [ORNL; Varner Jr, Robert L [ORNL; Ayres, A. [University of Tennessee, Knoxville (UTK); Batchelder, J. C. [Oak Ridge Associated Universities (ORAU); Bey, A. [University of Tennessee, Knoxville (UTK); Bingham, C. R. [University of Tennessee, Knoxville (UTK); Howard, Meredith E [ORNL; Jones, K. L. [University of Tennessee, Knoxville (UTK); Manning, Brett M [ORNL; Mueller, Paul Edward [ORNL; Nesaraja, Caroline D [ORNL; Pain, Steven D [ORNL; Peters, William A [ORNL; Ratkiewicz, Andrew J [ORNL; Schmitt, Kyle [University of Tennessee, Knoxville (UTK); Shapira, Dan [ORNL; Smith, Michael Scott [ORNL; Stone, N. J. [University of Tennessee, Knoxville (UTK); Stracener, Daniel W [ORNL; Yu, Chang-Hong [ORNL

    2014-01-01

    Gamma-ray transitions in $^{134}$\\textrm{Te}, $^{135}$\\textrm{Te}, and $^{136}$\\textrm{Te} were measured from $^{9}$\\textrm{Be} induced reactions with a radioactive $^{132}$\\textrm{Sn} beam at a sub-Coulomb barrier energy of $3$~MeV per nucleon using particle-$\\gamma$ coincidence spectroscopy. The transitions were selected by gating on alpha-like particles in a \\textrm{CsI} detector following a combination of ($^{9}$\\textrm{Be},$\\alpha 1n$), ($^{9}$\\textrm{Be},$\\alpha 2n$), and ($^{9}$\\textrm{Be},$\\alpha 3n$) reactions. Distorted wave Born approximation calculations suggest little to no contribution from the ($^{9}$\\textrm{Be},$^{7}$\\textrm{He}), ($^{9}$\\textrm{Be},$^{6}$\\textrm{He}), and ($^{9}$\\textrm{Be},$^{5}$\\textrm{He}) direct reactions. Gamma-ray transitions from previously known $2^+\\otimes \

  11. Evolution of the N=82 shell gap below {sup 132}Sn inferred from core excited states in {sup 131}In

    Energy Technology Data Exchange (ETDEWEB)

    Gorska, M. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany)], E-mail: m.gorska@gsi.de; Caceres, L. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany); Departamento de Fisica Teorica, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Grawe, H. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany); Pfuetzner, M. [IEP, University of Warsaw, PL-00681 Warsaw (Poland); Jungclaus, A. [Departamento de Fisica Teorica, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Instituto de Estructuras de la Materia, CSIC, Serrano113bis, E-28006 Madrid (Spain); Pietri, S. [Department of Physics, University of Surrey, Guildford, GU2 7XH (United Kingdom); Werner-Malento, E. [IEP, University of Warsaw, PL-00681 Warsaw (Poland); Podolyak, Z.; Regan, P.H. [Department of Physics, University of Surrey, Guildford, GU2 7XH (United Kingdom); Rudolph, D. [Department of Physics, Lund University, S-22100 Lund (Sweden); Detistov, P. [Faculty of Physics, University of Sofia, BG-1164 Sofia (Bulgaria); Lalkovski, S. [Faculty of Physics, University of Sofia, BG-1164 Sofia (Bulgaria); School of Enviroment and Technology, University of Brighton, Brighton, BN2 4GJ (United Kingdom); Modamio, V.; Walker, J. [Departamento de Fisica Teorica, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Beck, T. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany); Bednarczyk, P. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany); Henryk Niewodniczanski Institute of Nuclear Physics, PAN, PL-31342 Krakow (Poland); Doornenbal, P. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany); Institut fuer Kernphysik, Universitaet zu Koeln, D-50937 Koeln (Germany); Geissel, H.; Gerl, J. [Gesellschaft fuer Schwerionenforschung (GSI), D-64291 Darmstadt (Germany)] (and others)

    2009-03-02

    The {gamma}-ray decay of an excited state in {sup 131}In, the one proton hole neighbor of the doubly magic {sup 132}Sn has been measured. A high-spin, core-excited isomer with T{sub 1/2}=630(60) ns was identified following production by both relativistic fragmentation of a {sup 136}Xe beam and fission of a {sup 238}U beam. This state deexcites by a single {gamma}-ray branch of 3782(2) keV from which direct evidence for the size of the N=82 shell gap is inferred. The results are discussed in comparison to a shell-model calculation including configurations across the closed shells at N=82 and Z=50.

  12. Narrow intra-individual variation of maternal thyroid function in pregnancy based on a longitudinal study on 132 women

    DEFF Research Database (Denmark)

    Boas, M.; Forman, Julie Lyng; Juul, A.

    2009-01-01

    BACKGROUND: Adaptive alterations in maternal physiology cause changes in thyroid hormone levels throughout pregnancy, and precise biochemical evaluation is thus highly dependent on gestation-specific reference intervals and expected intra-individual variation. OBJECTIVE: The aim of the study...... was the assessment of the intra-individual variation as well as the longitudinal course of thyroid hormones during normal pregnancy and factors that influence the normal reference range for thyroid function. For this purpose, a longitudinal statistical model was applied. DESIGN: In a cohort of 132 pregnant women....... RESULTS: Intra-individual variations of thyroid hormone concentrations were smaller than inter-individual variations (individuality index range: 0.38-0.71). Maternal height was positively associated with free T(4) (FT(4)) (b=0.003; P=0.031) and pre-pregnancy body mass index with T(3) and free T(3) (b=0...

  13. Production of neutron-rich nuclei in fragmentation reactions of {sup 132}Sn projectiles at relativistic energies

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Loureiro, D., E-mail: david.loureiro@usc.es [Universidade de Santiago de Compostela, E-15782 (Spain); Benlliure, J.; Alvarez-Pol, H. [Universidade de Santiago de Compostela, E-15782 (Spain); Blank, B. [Centre d' Etudes Nucleaires, F-33175 Bordeaux-Gradignan Cedex (France); Casarejos, E. [Universidade de Santiago de Compostela, E-15782 (Spain); Dragosavac, D. [Universidade de Santiago de Compostela, E-15782 (Spain); Institute of Nuclear Sciences Vinca, University of Belgrade, 11001 Belgrade (Serbia); Foehr, V. [GSI Helmholtzzentrum fuer Schwerionenforschung, D-64291 Darmstadt (Germany); Gascon, M. [Universidade de Santiago de Compostela, E-15782 (Spain); Gawlikowicz, W. [Heavy Ion Laboratory, University of Warsaw, PL-02-093 Warsaw (Poland); Cardinal Stefan Wyszynski University, PL-01-938 Warsaw (Poland); Heinz, A. [A.W. Wright Nuclear Structure Laboratory, Yale University, New Haven, CT 06520 (United States); Helariutta, K. [University of Helsinki, FI-00014 Helsinki (Finland); Kelic-Heil, A.; Lukic, S.; Montes, F. [GSI Helmholtzzentrum fuer Schwerionenforschung, D-64291 Darmstadt (Germany); Pienkowski, L. [Heavy Ion Laboratory, University of Warsaw, PL-02-093 Warsaw (Poland); Schmidt, K.-H.; Staniou, M. [GSI Helmholtzzentrum fuer Schwerionenforschung, D-64291 Darmstadt (Germany); Subotic, K. [Institute of Nuclear Sciences Vinca, University of Belgrade, 11001 Belgrade (Serbia); Suemmerer, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, D-64291 Darmstadt (Germany); Taieb, J. [CEA/DAM Ile-de-France, F-91297 Arpajon Cedex (France)

    2011-09-26

    The fragmentation of neutron-rich {sup 132}Sn nuclei produced in the fission of {sup 238}U projectiles at 950 A MeV has been investigated at the FRagment Separator (FRS) at GSI. This work represents the first investigation of fragmentation of medium-mass radioactive projectiles with a large neutron excess. The measured production cross sections of the residual nuclei are relevant for the possible use of a two-stage reaction scheme (fission + fragmentation) for the production of extremely neutron-rich medium-mass nuclei in future rare-ion-beam facilities. Moreover, the new data will provide a better understanding of the 'memory' effect in fragmentation reactions.

  14. Transient Recovery Voltages at the Main 132kV Line Bay GIS Circuit Breaker in a Windfarm

    DEFF Research Database (Denmark)

    Arana Aristi, Iván; Okholm, J.; Holbøll, Joachim

    2011-01-01

    This paper presents the results of investigations of the Transient Recovery Voltage (TRV) across the terminals of the main 132kV Line Bay GIS circuit breaker (GIS CB) for Walney 2, second phase of the Walney Offshore Wind Farm. Several simulations were performed where the influence of different...... parameters in the network was evaluated during a fault in the onshore substation. The rate of rise of recovery voltage (RRRV) and the maximum crest voltage (Uc) of the TRV across the GIS CB were compared against the standard values based on the type test results from the GIS. The investigations were...... performed by means of time domain simulations using the EMT software PSCAD/HVDC. Based on the results, it was concluded that the highest RRRV appears on a system without additional stray capacitances, and the highest Uc appears when the fault is a single phase to ground....

  15. Caffeic Acid Phenylethyl Ester and MG-132 Have Apoptotic and Antiproliferative Effects on Leukemic Cells But Not on Normal Mononuclear Cells12

    Science.gov (United States)

    Cavaliere, Victoria; Papademetrio, Daniela L; Lorenzetti, Mario; Valva, Pamela; Preciado, María Victoria; Gargallo, Patricia; Larripa, Irene; Monreal, Mariela B; Pardo, María Laura; Hajos, Silvia E; Blanco, Guillermo AC; Álvarez, Élida MC

    2009-01-01

    Chemotherapy aims to limit proliferation and induce apoptotic cell death in tumor cells. Owing to blockade of signaling pathways involved in cell survival and proliferation, nuclear factor κB (NF-κB) inhibitors can induce apoptosis in a number of hematological malignancies. The efficacy of conventional chemotherapeutic drugs, such as vincristine (VCR) and doxorubicine (DOX), may be enhanced with combined therapy based on NF-κB modulation. In this study, we evaluated the effect of caffeic acid phenylethyl ester (CAPE) and MG-132, two nonspecific NF-κB inhibitors, and conventional chemotherapeutics drugs DOX and VCR on cell proliferation and apoptosis induction on a lymphoblastoid B-cell line, PL104, established and characterized in our laboratory. CAPE and MG-132 treatment showed a strong antiproliferative effect accompanied by clear cell cycle deregulation and apoptosis induction. Doxorubicine and VCR showed antiproliferative effects similar to those of CAPE and MG-132, although the latter drugs showed an apoptotic rate two-fold higher than DOX and VCR. None of the four compounds showed cytotoxic effect on peripheral mononuclear cells from healthy volunteers. CAPE- and MG-132-treated bone marrow cells from patients with myeloid and lymphoid leukemias showed 69% (P < .001) and 25% decrease (P < .01) in cell proliferation and 42% and 34% (P < .01) apoptosis induction, respectively. Overall, our results indicate that CAPE and MG-132 had a strong and selective apoptotic effect on tumor cells that may be useful in future treatment of hematological neoplasias. PMID:19252751

  16. De-repression of FOXO3a death axis by microRNA-132 and -212 causes neuronal apoptosis in Alzheimer's disease.

    Science.gov (United States)

    Wong, Hon-Kit Andus; Veremeyko, Tatiana; Patel, Nehal; Lemere, Cynthia A; Walsh, Dominic M; Esau, Christine; Vanderburg, Charles; Krichevsky, Anna M

    2013-08-01

    Alzheimer's disease (AD) is a multifactorial and fatal neurodegenerative disorder for which the mechanisms leading to profound neuronal loss are incompletely recognized. MicroRNAs (miRNAs) are recently discovered small regulatory RNA molecules that repress gene expression and are increasingly acknowledged as prime regulators involved in human brain pathologies. Here we identified two homologous miRNAs, miR-132 and miR-212, downregulated in temporal cortical areas and CA1 hippocampal neurons of human AD brains. Sequence-specific inhibition of miR-132 and miR-212 induces apoptosis in cultured primary neurons, whereas their overexpression is neuroprotective against oxidative stress. Using primary neurons and PC12 cells, we demonstrate that miR-132/212 controls cell survival by direct regulation of PTEN, FOXO3a and P300, which are all key elements of AKT signaling pathway. Silencing of these three target genes by RNAi abrogates apoptosis caused by the miR-132/212 inhibition. We further demonstrate that mRNA and protein levels of PTEN, FOXO3a, P300 and most of the direct pro-apoptotic transcriptional targets of FOXO3a are significantly elevated in human AD brains. These results indicate that the miR-132/miR-212/PTEN/FOXO3a signaling pathway contributes to AD neurodegeneration.

  17. Combined "Infiltrating Astrocytoma/Pleomorphic Xanthoastrocytoma" Harboring IDH1 R132H and BRAF V600E Mutations.

    Science.gov (United States)

    Yamada, Seiji; Kipp, Benjamin R; Voss, Jesse S; Giannini, Caterina; Raghunathan, Aditya

    2016-02-01

    Pleomorphic xanthoastrocytoma (PXA) has rarely been reported in combination with infiltrating glioma, historically interpreted as a "collision tumor." Isocitrate dehydrogenase 1 (IDH1) and BRAF V600E mutations are usually not concurrent. The former is typical of adult infiltrating gliomas, and the latter is identified in a variety of primary central nervous system neoplasms, including PXA, ganglioglioma, pilocytic astrocytoma, and rarely infiltrating gliomas. We report the case of a 56-year-old man presenting with seizures and headaches. Magnetic resonance imaging revealed a large right temporal lobe mass with low T1 and high T2/FLAIR signal and a discrete contrast-enhancing focus. Histologically, the tumor showed 2 distinct components: an infiltrating astrocytoma harboring 5 mitoses/10 high-power fields and a relatively circumscribed focus, resembling PXA with, at most, 2 mitoses/10 high-power fields. No microvascular proliferation or necrosis was present in either component. The infiltrating astrocytoma component contained numerous axons, whereas the PXA-like component had sparse axons, as demonstrated by the neurofilament immunostain. Both components were positive for the mutant IDH1 R132H and showed loss of ATRX expression, whereas BRAF V600E was restricted to the PXA-like component. On sequencing of the 2 components separately after microdissection, both showed identical IDH1 R132H and TP53 R273C point mutations, whereas the BRAF V600E mutation was limited to the PXA-like component. These findings are consistent with clonal expansion of a morphologically distinct focus, harboring a private BRAF V600E mutation within an IDH1-mutant glioma. Intratumoral heterogeneity and clonal evolution, as seems to have occurred here, suggest reevaluation of "collision tumors" as a concept.

  18. Observation of a {pi}h{sub 9/2} x {nu}i{sub 13/2} oblate band in {sup 188}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, X.H.; Ma, L.; Xing, Y.B.; Zhang, Y.H.; Guo, Y.X.; Lei, X.G.; Xie, C.Y. [Chinese Academy of Sciences, Institute of Modern Physics, Lanzhou (China); Oshima, M.; Toh, Y.; Koizumi, M.; Osa, A.; Hatsukawa, Y. [Japan Atomic Energy Research Institute, Ibaraki (Japan); Sugawara, M. [Chiba Institute of Technology, Chiba (Japan); Ndontchueng, M.M. [University of Douala, P. O. Box 24157, Douala (Cameroon)

    2006-06-15

    Excited states in {sup 188}Tl have been studied experimentally using the {sup 157}Gd({sup 35}Cl,4n) reaction at a beam energy of 170 MeV. A rotational band built on the {pi}h{sub 9/2} x {nu}i{sub 13/2} configuration with oblate deformation has been established for {sup 188}Tl. Based on the structure systematics of the oblate {pi}h{sub 9/2} x {nu}i{sub 13/2} bands in the heavier odd-odd Tl nuclei, we have tentatively proposed spin values for the new band in {sup 188}Tl. The {pi}h{sub 9/2} x {nu}i{sub 13/2} oblate band in {sup 188}Tl shows low-spin signature inversion, and it can be interpreted qualitatively by the two-quasiparticle plus rotor model including a J-dependent p-n residual interaction. (orig.)

  19. Inhibition by Avibactam and Clavulanate of the β-Lactamases KPC-2 and CTX-M-15 Harboring the Substitution N132G in the Conserved SDN Motif.

    Science.gov (United States)

    Ourghanlian, Clément; Soroka, Daria; Arthur, Michel

    2017-03-01

    The substitution N 132 G in the SDN motif of class A β-lactamases from rapidly growing mycobacteria was previously shown to impair their inhibition by avibactam but to improve the stability of acyl-enzymes formed with clavulanate. The same substitution was introduced in KPC-2 and CTX-M-15 to assess its impact on β-lactamases from Enterobacteriaceae and evaluate whether it may lead to resistance to the ceftazidime-avibactam combination. Kinetic parameters for the inhibition of the β-lactamases by avibactam and clavulanate were determined by spectrophotometry using nitrocefin as the substrate. The substitution N 132 G impaired (>1,000-fold) the efficacy of carbamylation of KPC-2 and CTX-M-15 by avibactam. The substitution improved the inhibition of KPC-2 by clavulanate due to reduced deacylation, whereas the presence or absence of N 132 G resulted in the inhibition of CTX-M-15 by clavulanate. The hydrolysis of amoxicillin and nitrocefin by KPC-2 and CTX-M-15 was moderately affected by the substitution N 132 G, but that of ceftazidime, ceftaroline, and aztreonam was drastically reduced. Isogenic strains producing KPC-2 and CTX-M-15 were constructed to assess the impact of the substitution N 132 G on the antibacterial activities of β-lactam-inhibitor combinations. For amoxicillin, the substitution resulted in resistance and susceptibility for avibactam and clavulanate, respectively. For ceftazidime, ceftaroline, and aztreonam, the negative impact of the substitution on β-lactamase activity prevented resistance to the β-lactam-avibactam combinations. In conclusion, the N 132 G substitution has profound effects on the substrate and inhibition profiles of class A β-lactamases, which are largely conserved in distantly related enzymes. Fortunately, the substitution does not lead to resistance to the ceftazidime-avibactam combination. Copyright © 2017 American Society for Microbiology.

  20. Inhibition by Avibactam and Clavulanate of the β-Lactamases KPC-2 and CTX-M-15 Harboring the Substitution N132G in the Conserved SDN Motif

    Science.gov (United States)

    Ourghanlian, Clément; Soroka, Daria

    2017-01-01

    ABSTRACT The substitution N132G in the SDN motif of class A β-lactamases from rapidly growing mycobacteria was previously shown to impair their inhibition by avibactam but to improve the stability of acyl-enzymes formed with clavulanate. The same substitution was introduced in KPC-2 and CTX-M-15 to assess its impact on β-lactamases from Enterobacteriaceae and evaluate whether it may lead to resistance to the ceftazidime-avibactam combination. Kinetic parameters for the inhibition of the β-lactamases by avibactam and clavulanate were determined by spectrophotometry using nitrocefin as the substrate. The substitution N132G impaired (>1,000-fold) the efficacy of carbamylation of KPC-2 and CTX-M-15 by avibactam. The substitution improved the inhibition of KPC-2 by clavulanate due to reduced deacylation, whereas the presence or absence of N132G resulted in the inhibition of CTX-M-15 by clavulanate. The hydrolysis of amoxicillin and nitrocefin by KPC-2 and CTX-M-15 was moderately affected by the substitution N132G, but that of ceftazidime, ceftaroline, and aztreonam was drastically reduced. Isogenic strains producing KPC-2 and CTX-M-15 were constructed to assess the impact of the substitution N132G on the antibacterial activities of β-lactam–inhibitor combinations. For amoxicillin, the substitution resulted in resistance and susceptibility for avibactam and clavulanate, respectively. For ceftazidime, ceftaroline, and aztreonam, the negative impact of the substitution on β-lactamase activity prevented resistance to the β-lactam–avibactam combinations. In conclusion, the N132G substitution has profound effects on the substrate and inhibition profiles of class A β-lactamases, which are largely conserved in distantly related enzymes. Fortunately, the substitution does not lead to resistance to the ceftazidime-avibactam combination. PMID:28069651

  1. Estimación del estado del motor de reluctancia conmutada MFR132.5 mediante Filtro Desaromatizado de Kalman. State estimation of the switching reluctance motor MFR132.5 using an Unscented Kalman Filter

    Directory of Open Access Journals (Sweden)

    Ariel Omar Cepero Díaz

    2015-04-01

    Full Text Available La determinación de la posición angular instantánea del rotor es parte integral del control en los accionamientos de Motores de Reluctancia Conmutada. La medición directa de esta variable adiciona complejidad y costo al sistema y no siempre brinda buenos resultados, lo que ha motivado el desarrollo y prueba de algoritmos de estimación de la posición angular del rotor. En este trabajo se presenta el empleo de un Filtro Desaromatizado de Kalman para estimar la velocidad y la posición angular del rotor del motor MFR 132.5, basado en un modelo de caja gris de dicho motor que también es presentado en este trabajo. Los resultados demuestran que este estimador ofrece estimaciones satisfactorias del estado del motor, lo mismo durante el arranque que durante el funcionamiento regular, aún bajo la presencia de perturbaciones en el torque de la carga y errores en la estimación inicial de la posición angular del rotor.  The measure of the instant angular position of the rotor is integral part of the control of Switching Reluctance Motors drivers. The direct measurement of this variable adds complexity and cost to the system and it doesn’t give good results sometimes. That has motivated the development and test of algorithms for estimating the rotor angular position of the motor. In this work is presented the use of an Unscented Kalman Filter for estimating the speed and rotor angular position of the motor MFR 132.5, based on a grey box model of the motor which is also presented in this work. The results show that this kind of estimator gives good estimations of the state of the motor, as well during the starting as during the regular operation, even under the presence of perturbations of the load torque and errors in the initial estimation of the angular position.

  2. FORMACIÓN DE EMBRIONES SOMÁTICOS A PARTIR DE SEMILLAS INMADURAS EN Sorghum bicolor VARIEDAD CIAP 132-R

    Directory of Open Access Journals (Sweden)

    Mayelín RODRÍGUEZ URQUIZA

    2015-01-01

    Full Text Available Existen varios protocolos de regeneración de plantas vía embriogénesis somática de Sorghum bicolor (L. Moench, sin embargo los porcentajes de formación de callos con estructuras embriogénicas y regeneración de plantas son bajos. Es por ello que esta investigación tuvo como objetivo generar embriones somáticos en sorgo rojo variedad CIAP 132-R. Se ensayaron diferentes concentraciones de 2,4-D para la formación de callos, así como tres concentraciones de ácido ascórbico para eliminar la exudación de compuestos fenólicos por el explante. También para la formación de los embriones somáticos a partir de los callos se evaluaron diferentes concentraciones de 2,4-D y 6-BAP. El mayor porcentaje de formación de callos (57,5 % se alcanzó con 18,1 μM de 2,4-D. Con la adición al medio de cultivo de 50,0 mg.l-1 de ácido ascórbico fue posible eliminar los compuestos fenólicos en el explante y en el medio de cultivo, además permitió incrementar el porcentaje de formación de callos con estructuras embriogénicas hasta un 95 %. El número mayor de embriones somáticos por callo se alcanzó en el medio de cultivo con concentraciones de 4,52 μM de 2,4- D, combinada con 2,22 μM de 6-BAP. Por primera vez, se logró la formación eficiente de embriones somáticos a partir de los callos obtenidos de semillas inmaduras germinadas como explante inicial en la variedad CIAP 132-R.

  3. Differential Activity of NADPH-Producing Dehydrogenases Renders Rodents Unsuitable Models to Study IDH1(R132) Mutation Effects in Human Glioblastoma

    NARCIS (Netherlands)

    Atai, Nadia A.; Renkema-Mills, Nynke A.; Bosman, Joost; Schmidt, Nadja; Rijkeboer, Denise; Tigchelaar, Wikky; Bosch, Klazien S.; Troost, Dirk; Jonker, Ard; Bleeker, Fonnet E.; Miletic, Hrvoje; Bjerkvig, Rolf; de Witt Hamer, Philip C.; van Noorden, Cornelis J. F.

    2011-01-01

    The somatic IDH1(R132) mutation in the isocitrate dehydrogenase 1 gene occurs in high frequency in glioma and in lower frequency in acute myeloid leukemia and thyroid cancer but not in other types of cancer. The mutation causes reduced NADPH production capacity in glioblastoma by 40% and is

  4. Overexpression of GPC6 and TMEM132D in Early Stage Ovarian Cancer Correlates with CD8+ T-Lymphocyte Infiltration and Increased Patient Survival

    Directory of Open Access Journals (Sweden)

    Athanasios Karapetsas

    2015-01-01

    Full Text Available Infiltration of cytotoxic T-lymphocytes in ovarian cancer is a favorable prognostic factor. Employing a differential expression approach, we have recently identified a number of genes associated with CD8+ T-cell infiltration in early stage ovarian tumors. In the present study, we validated by qPCR the expression of two genes encoding the transmembrane proteins GPC6 and TMEM132D in a cohort of early stage ovarian cancer patients. The expression of both genes correlated positively with the mRNA levels of CD8A, a marker of T-lymphocyte infiltration [Pearson coefficient: 0.427 (p=0.0067 and 0.861 (p<0.0001, resp.]. GPC6 and TMEM132D expression was also documented in a variety of ovarian cancer cell lines. Importantly, Kaplan-Meier survival analysis revealed that high mRNA levels of GPC6 and/or TMEM132D correlated significantly with increased overall survival of early stage ovarian cancer patients (p=0.032. Thus, GPC6 and TMEM132D may serve as predictors of CD8+ T-lymphocyte infiltration and as favorable prognostic markers in early stage ovarian cancer with important consequences for diagnosis, prognosis, and tumor immunobattling.

  5. Benzathine penicillin G once-every-3-week prophylaxis for recurrent erysipelas a retrospective study of 132 patients.

    Science.gov (United States)

    Rob, Filip; Hercogová, Jana

    2017-05-30

    To evaluate effectivity, safety and patients' adherence to benzathine penicillin G (BPG) 1,200,000 units (1.2 MU) once-every-3-week intramuscularly prophylaxis for recurrent erysipelas. Patients with documented two or more erysipelas episodes in last two years who received at least one of 10 planned doses of BPG 1.2 MU intramuscularly between January 2009 and December 2015 were analyzed in this retrospective study. Number of recurrences during the 30-week prophylaxis and in the 30-week follow-up period, frequency of adverse events, patients' adherence to the treatment and factors associated with the recurrence were analyzed. From 132 patients, 109 (82.6%) finished the 30-week prophylactic regimen successfully. The incidence of erysipelas was 8 per 100 patient-years during the prophylactic period and 28 per 100 patient-years in the follow-up period (incidence rate ratio = 0.20; 95% CI: 0.05-0.34; p < .01). In univariate analysis recurrence was significantly associated only with presence of any local risk factor concurrently with obesity (OR 3.40; 95% CI: 1.10-10.50; p < .05). Benzathine penicillin G 1.2 MU once every 3 weeks is an effective and well-tolerated prophylaxis of recurrent erysipelas with good patient adherence to the treatment. Further studies to determine the appropriate duration of prophylaxis are necessary.

  6. A progeroid syndrome with neonatal presentation and long survival maps to 19p13.3p13.2.

    Science.gov (United States)

    Akawi, Nadia; Ali, Bassam; Al Gazali, Lihadh

    2013-07-01

    We report on a Palestinian family with three affected individuals exhibiting progeroid syndrome characterized by intrauterine growth retardation, a progeroid appearance, failure to thrive, short stature, and hypotonia. The progeroid features were evident at birth. All the affected members of this family have survived beyond the neonatal period and one of them is currently a 27-year-old adult. As parental consanguinity suggested an autosomal recessive mode of inheritance, we employed homozygosity mapping using single nucleotide polymorphism arrays followed by next generation whole exome sequencing to identify the disease-causing gene. We were able to identify a single block of homozygosity shared between all the affected members of the studied family spanning 2.3 Mb on chromosome 19p13.3p13.2. However, Sanger sequencing of known genes and whole exome sequencing of the three affected sibs did not reveal a convincing causal mutation. These findings are anticipated to open the way for the identification of the molecular causes underlying this syndrome. Copyright © 2013 Wiley Periodicals, Inc.

  7. How and when plume zonation appeared during the 132 Myr evolution of the Tristan Hotspot.

    Science.gov (United States)

    Hoernle, Kaj; Rohde, Joana; Hauff, Folkmar; Garbe-Schönberg, Dieter; Homrighausen, Stephan; Werner, Reinhard; Morgan, Jason P

    2015-07-27

    Increasingly, spatial geochemical zonation, present as geographically distinct, subparallel trends, is observed along hotspot tracks, such as Hawaii and the Galapagos. The origin of this zonation is currently unclear. Recently zonation was found along the last ∼70 Myr of the Tristan-Gough hotspot track. Here we present new Sr-Nd-Pb-Hf isotope data from the older parts of this hotspot track (Walvis Ridge and Rio Grande Rise) and re-evaluate published data from the Etendeka and Parana flood basalts erupted at the initiation of the hotspot track. We show that only the enriched Gough, but not the less-enriched Tristan, component is present in the earlier (70-132 Ma) history of the hotspot. Here we present a model that can explain the temporal evolution and origin of plume zonation for both the Tristan-Gough and Hawaiian hotspots, two end member types of zoned plumes, through processes taking place in the plume sources at the base of the lower mantle.

  8. Evolution of quadrupole and octupole collectivity north-east of $^{132}$ Sn: the even Te and Xe isotopes

    CERN Multimedia

    We propose to study excited states in isotopes north-east of the doubly-magic $^{132}$Sn by $\\gamma$-ray spectroscopy following "safe" Coulomb excitation. The experiment aims to the determine B(E2) and B(E3) values to follow the evolution of quadrupole and octupole collectivity when going away from the shell closures at Z = 50 and N = 82. The B(E2; 0$^+_{gs}$ $\\rightarrow$ 2$^+_{1}$) values in the even isotopes $^{138-144}$Xe have been measured at REX-ISOLDE and the systematic trend towards neutron-rich nuclei is well described even by an empirical Grodzins-type formula. An increasing dipole moment observed for $^{140,142}$Xe is interpreted as indirect signature of increasing octupole correlations peaking at N = 88. So far, no B(E3) values are known. In contrast to the Xe isotopes, the Te ones, in particular $^{136}$Te, are known for their notoriously irregular behaviour. In order to understand the nuclear structure also on a microscopic basis, the isotope $^{136}$Te with just one pair of protons and neutrons...

  9. 132 - 135 Gabasawa

    African Journals Online (AJOL)

    DR. AMINU

    2012-12-02

    Dec 2, 2012 ... Groundnuts (Arachis hypogaea L.), in symbiosis with rhizobia, in their root nodules, fix atmospheric nitrogen (N2). A field trial was carried out at Samaru, Nigeria, in 2008 with a ... have the most favourable soil and climate conditions for groundnut production (Misari et al., 1980). Groundnut provides a safe, ...

  10. 132 - 136 Abdullahi

    African Journals Online (AJOL)

    DR. AMIN

    Clostridium perfringens,. Streptococcus faecalis, Klebsiella ozaenae, Pseudonomas aeruginosa and Salmonella typhi. On the activity of specific phytochemical components, Takeda and Fatope. (1998) isolated lawsoniaside and laliside from the ethanol extracts of the leaves of Lawsona inermis, which has medicinal value ...

  11. 132 - 135_Obahiagbon

    African Journals Online (AJOL)

    DR. AMINU

    positive effects the latter have on quality. Samples of palm oil were collected in duplicates with. 100ml screw .... Fatty Acid contents in a good quality palm oil are. 0.1% and 3-5% respectively, while the minimum permissible .... Nutraceuticals and human health. Journal of. Science and Food Agriculture. 80:1744-1756. Edem ...

  12. 132 - 135_Obahiagbon

    African Journals Online (AJOL)

    DR. AMINU

    The carotenoids in red palm oil are the most important minor constituents. When the carotene molecule is slit by ... The crude palm oil is orange- red in colour. The characteristic colour of the crude palm oil is due to the presence of ..... of red palm oil in combating vitamin deficiency in India. Food. Nutr. Bull.; Res.1961; 3: 233.

  13. An immuno-wall microdevice exhibits rapid and sensitive detection of IDH1-R132H mutation specific to grade II and III gliomas.

    Science.gov (United States)

    Yamamichi, Akane; Kasama, Toshihiro; Ohka, Fumiharu; Suzuki, Hiromichi; Kato, Akira; Motomura, Kazuya; Hirano, Masaki; Ranjit, Melissa; Chalise, Lushun; Kurimoto, Michihiro; Kondo, Goro; Aoki, Kosuke; Kaji, Noritada; Tokeshi, Manabu; Matsubara, Toshio; Senga, Takeshi; Kaneko, Mika K; Suzuki, Hidenori; Hara, Masahito; Wakabayashi, Toshihiko; Baba, Yoshinobu; Kato, Yukinari; Natsume, Atsushi

    2016-01-01

    World Health Organization grade II and III gliomas most frequently occur in the central nervous system (CNS) in adults. Gliomas are not circumscribed; tumor edges are irregular and consist of tumor cells, normal brain tissue, and hyperplastic reactive glial cells. Therefore, the tumors are not fully resectable, resulting in recurrence, malignant progression, and eventual death. Approximately 69-80% of grade II and III gliomas harbor mutations in the isocitrate dehydrogenase 1 gene (IDH1), of which 83-90% are found to be the IDH1-R132H mutation. Detection of the IDH1-R132H mutation should help in the differential diagnosis of grade II and III gliomas from other types of CNS tumors and help determine the boundary between the tumor and normal brain tissue. In this study, we established a highly sensitive antibody-based device, referred to as the immuno-wall, to detect the IDH1-R132H mutation in gliomas. The immuno-wall causes an immunoreaction in microchannels fabricated using a photo-polymerizing polymer. This microdevice enables the analysis of the IDH1 status with a small sample within 15 min with substantially high sensitivity. Our results suggested that 10% content of the IDH1-R132H mutation in a sample of 0.33 μl volume, with 500 ng protein, or from 500 cells is theoretically sufficient for the analysis. The immuno-wall device will enable the rapid and highly sensitive detection of the IDH1-R132H mutation in routine clinical practice.

  14. Evaluation of a new rapid readout biological indicator for use in 132°C and 135°C vacuum-assisted steam sterilization cycles.

    Science.gov (United States)

    Schneider, Philip M

    2014-02-01

    Sterilization is a process that cannot be inspected or tested in a practical manner to assure that all microorganisms have been inactivated. The process must therefore be validated for all of the specific items processed or monitored on a per cycle basis. A new, faster rapid readout biological indicator (RRBI) has been developed for use in 132°C and 135°C vacuum-assisted steam sterilization cycles. The aim of this study was to evaluate the performance of this new 1-hour readout RRBI at 132°C in side-by-side testing with an existing 3-hour readout RRBI and also evaluate the performance of the new RRBI in 135°C cycles. Readout responses of 1 hour (fluorescent) and 48 hours and 7 days (growth) of the new RRBI were compared with 3-hour, 48-hour, and 7-day readouts of the 3-hour RRBI following exposures in 132°C cycles using a highly controlled test vessel, ie, a steam resistometer. Additional testing of the 1-hour RRBIs was also performed in 135°C cycles. The number and percentage of fluorescent-positive 1-hour RRBIs were virtually identical to those of the 3-hour RRBIs after 1 and 3 hours of incubation, respectively. Testing of the 1-hour RRBI in 135°C cycles paralleled the results of the testing at 132°C but with the expected shorter exposure times. The results of this study suggest that the 1-hour RRBI is equivalent to the 3-hour RRBI and would be suitable for use in monitoring dynamic air removal steam sterilization cycles at both 132°C and 135°C per recommended practice guidelines. Copyright © 2014 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Mosby, Inc. All rights reserved.

  15. Agouti-related protein is posttranslationally cleaved by proprotein convertase 1 to generate agouti-related protein (AGRP)83-132: interaction between AGRP83-132 and melanocortin receptors cannot be influenced by syndecan-3.

    Science.gov (United States)

    Creemers, John W M; Pritchard, Lynn E; Gyte, Amy; Le Rouzic, Philippe; Meulemans, Sandra; Wardlaw, Sharon L; Zhu, Xiaorong; Steiner, Donald F; Davies, Nicola; Armstrong, Duncan; Lawrence, Catherine B; Luckman, Simon M; Schmitz, Catherine A; Davies, Rick A; Brennand, John C; White, Anne

    2006-04-01

    Agouti-related protein (AGRP) plays a key role in energy homeostasis. The carboxyl-terminal domain of AGRP acts as an endogenous antagonist of the melanocortin-4 receptor (MC4-R). It has been suggested that the amino-terminal domain of AGRP binds to syndecan-3, thereby modulating the effects of carboxyl-terminal AGRP at the MC4-R. This model assumes that AGRP is secreted as a full-length peptide. In this study we found that AGRP is processed intracellularly after Arg(79)-Glu(80)-Pro(81)-Arg(82). The processing site suggests cleavage by proprotein convertases (PCs). RNA interference and overexpression experiments showed that PC1/3 is primarily responsible for cleavage in vitro, although both PC2 and PC5/6A can also process AGRP. Dual in situ hybridization demonstrated that PC1/3 is expressed in AGRP neurons in the rat hypothalamus. Moreover, hypothalamic extracts from PC1-null mice contained 3.3-fold more unprocessed full-length AGRP, compared with wild-type mice, based on combined HPLC and RIA analysis, demonstrating that PC1/3 plays a role in AGRP cleavage in vivo. We also found that AGRP(83-132) is more potent an antagonist than full-length AGRP, based on cAMP reporter assays, suggesting that posttranslational cleavage is required to potentiate the effect of AGRP at the MC4-R. Because AGRP is cleaved into distinct amino-terminal and carboxyl-terminal peptides, we tested whether amino-terminal peptides modulate food intake. However, intracerebroventricular injection of rat AGRP(25-47) and AGRP(50-80) had no effect on body weight, food intake, or core body temperature. Because AGRP is cleaved before secretion, syndecan-3 must influence food intake independently of the MC4-R.

  16. CCQM-K132: low-polarity analytes in a biological matrix: vitamin D metabolites in human serum

    Science.gov (United States)

    Wise, Stephen A.; Tai, Susan S.-C.; Duewer, David L.; Bedner, Mary; Camara, Johanna E.; Lippa, Katrice A.; Qinde, Liu; Kang, Dukjin; Kim, Byungjoo; Quan, Can; Shi, Lianhua; Nammoonnoy, Jintana; Vamathevan, Veronica; Ceyhan Gören, Ahmet; Bilsel, Gökhan; Yilmaz, Hasibe

    2017-01-01

    Vitamin D is a fat-soluble vitamin that occurs primarily in two forms, vitamin D2 and vitamin D3. Vitamin D3 is produced naturally when skin is exposed to UV radiation, is naturally-occurring in foods (generally of animal origin), and is fortified in some foods and dietary supplements. Vitamin D2 occurs in food (generally plant sources) and until recently was the form most often used in dietary supplements. Vitamin D is metabolized in the body to produce several closely related, hydroxylated species (metabolites), with 25-hydroxyvitamin D3 [25(OH)D3] and 25-hydroxyvitamin D2 [25(OH)D2] as the most common metabolites measured in human serum. Concentrations of total vitamin D in human serum, calculated as the sum of 25(OH)D2 and 25(OH)D3, are typically in the 16 ng/g to 30 ng/g (40 nmol/L to 75 nmol/L) range, with 25(OH)D3 usually accounting for more than 90 % of the total. An epimer of 25(OH)D3, 3-epi-25(OH)D3, can be present at levels up to 10 % of 25(OH)D3 concentration. Seven National Metrology Institutions participated in the Track C Key Comparison CCQM-K132 low-polarity analytes in a biological matrix: vitamin D metabolites in human serum. Participants were requested to evaluate the mass fractions, expressed in ng/g, of 25(OH)D3, 25(OH)D2, and 3-epi-25(OH)D3 in two human serum materials, termed Serum Pool I and Serum Pool II. Due to the known low levels of 3-epi-25(OH)D3 in both materials and the very low level of 25(OH)D2 in Serum Pool I, the study protocol stated that key comparison reference values (KCRVs) would be assigned only to 25(OH)D3 in both materials and 25(OH)D2 in Serum Pool II. Results for 3-epi-25(OH)D3 were requested to evaluate the separation technologies employed; 3-epi-25(OH)D3 needs to be chromatographically separated from 25(OH)D3 for proper quantification of 25(OH)D3. Results for 25(OH)D2 in Serum Pool I were requested to explore measurement performance at its low level. All participants used isotope dilution liquid chromatography with

  17. Cementless, modular, distally fixed stem in hip revision arthroplasty: a single-center study of 132 consecutive hips.

    Science.gov (United States)

    Hashem, Ali; Al-Azzawi, Ammar; Riyadh, Hasan; Mukka, Sebastian; Sayed-Noor, Arkan

    2018-01-01

    The use of cementless, modular, distally fixed stem in hip revision arthroplasty has increased during the last decades. We aimed to analyze the early and late postoperative complications, re-operation rate, and survival rate of the MP stem operated at our county hospital with relatively limited caseload. In this retrospective study, we included 132 hips operated with MP stem between January 2007-2014. An independent observer reviewed patients' medical records in July 2015 (18-102 months postoperatively, median 52.5) to collect the following data: age, sex, American Society of Anesthesiologists (ASA) class, body mass index, indication of revision, type of operation, early and late complications, re-operation rate, and mortality during study period. The commonest indication for MP stem operation was aseptic loosening (72%). We found early and late postoperative complications in 29% of cases. The most common complication was prosthetic dislocation (8%), followed by intra-operative peri-prosthetic fracture (5%). The commonest indication for MP re-operation was soft tissue revision for infection (7%) followed by closed reduction for prosthetic dislocation (6%). We found no correlation between the age, sex, ASA class, and type of operation and the re-operation risk. Only one prosthesis was extracted giving a survival rate for 99% for the study period. This study showed good results of the MP prosthesis with reasonable complication and re-operation rates and negligible extraction rate, indicating the good performance of this implant even when used in the setting of a county hospital with limited caseload.

  18. Birth weight discordant twins have increased prenatal mortality and neonatal morbidity: an analysis of 1,132 twins

    Directory of Open Access Journals (Sweden)

    Sara Domingues

    2015-02-01

    Full Text Available Background: Multiple pregnancies have increased significantly over the past decades. Birth weight discordance (BWD is a common problem between twins, but its association with an increased morbidity and mortality is still unclear. The aim of this study was to determine the frequency of BWD among twins and to evaluate its impact on perinatal morbidity.Methods: Retrospective study of 1,132 twins born in a tertiary perinatal center, over a period of 8 years (2003-2010, that were divided in two groups: concordant (intrapair birth weight difference ≤ 20% or discordant (> 20%. The two groups were compared in terms of epidemiological and obstetric data, mode of delivery, perinatal morbidity and mortality.Results: During the study period, multiple gestation occurred in 2% of cases, of which 96% were twins. BWD was found in 212 (19% twins. Multivariate analysis demonstrated that maternal age ≥ 35 years and hypoxic-ischemic placental infarction were risk factors for the occurrence of BWD. The discordant group showed a significantly higher incidence of congenital skeletal and central nervous system malformations, a higher rate of hospitalization in the neonatal intensive care unit and a longer duration of hospitalization. The percentage of those requiring assisted ventilation, pulmonary surfactant, parenteral nutrition and central venous catheters was significantly higher in the discordant group compared with the concordant one. The rate of stillbirth was significantly higher in the discordant group (3% versus 1%; mortality was also higher (3% versus 2%, but this difference was not statistically significant (p = 0.405.Conclusion: BWD was associated with increased prenatal mortality and neonatal morbidity. Diagnosis and management of pregnant women with this fetal condition in tertiary perinatal centers may improve the prognosis of these infants.

  19. Diagnostic implications of IDH1-R132H and OLIG2 expression patterns in rare and challenging glioblastoma variants.

    Science.gov (United States)

    Joseph, Nancy M; Phillips, Joanna; Dahiya, Sonika; M Felicella, Michelle; Tihan, Tarik; Brat, Daniel J; Perry, Arie

    2013-03-01

    Recent work has demonstrated that nearly all diffuse gliomas display nuclear immunoreactivity for the bHLH transcription factor OLIG2, and the R132H mutant isocitrate dehydrogenase 1 (IDH1) protein is expressed in the majority of diffuse gliomas other than primary glioblastoma. However, these antibodies have not been widely applied to rarer glioblastoma variants, which can be diagnostically challenging when the astrocytic features are subtle. We therefore surveyed the expression patterns of OLIG2 and IDH1 in 167 non-conventional glioblastomas, including 45 small cell glioblastomas, 45 gliosarcomas, 34 glioblastomas with primitive neuroectodermal tumor-like foci (PNET-like foci), 23 with an oligodendroglial component, 11 granular cell glioblastomas, and 9 giant cell glioblastomas. OLIG2 was strongly expressed in all glioblastomas with oligodendroglial component, 98% of small cell glioblastomas, and all granular cell glioblastomas, the latter being particularly helpful in ruling out macrophage-rich lesions. In 74% of glioblastomas with PNET-like foci, OLIG2 expression was retained in the PNET-like foci, providing a useful distinction from central nervous system PNETs. The glial component of gliosarcomas was OLIG2 positive in 93% of cases, but only 14% retained focal expression in the sarcomatous component; as such this marker would not reliably distinguish these from pure sarcoma in most cases. OLIG2 was expressed in 67% of giant cell glioblastomas. IDH1 was expressed in 55% of glioblastomas with oligodendroglial component, 15% of glioblastomas with PNET-like foci, 7% of gliosarcomas, and none of the small cell, granular cell, or giant cell glioblastomas. This provides further support for the notion that most glioblastomas with oligodendroglial component are secondary, while small cell glioblastomas, granular cell glioblastomas, and giant cell glioblastomas are primary variants. Therefore, in one of the most challenging differential diagnoses, IDH1 positivity could

  20. Determination of specific radioactivity of samarium-153 product. 1. Quantitative determination of samarium by spectrophotometry

    Energy Technology Data Exchange (ETDEWEB)

    Izumo, Mishiroku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nemoto, Masahiro [Tokyo Nuclear Service Co., Ltd., Tokyo (Japan)

    2002-03-01

    On the specific radioactivity of Sm-153 for the radiotherapy of cancers, a simple method for determination of the amount of Sm was described. The method used Arsenazo III as a colorimetric reagent. The sample irradiated in the reactor was dissolved in 1M HCl solution. A small part of it was taken and mixed with Arsenazo III at pH 3.2, and the amount of Sm was determined by the spectrophotometric method at a wavelength of 652 nm. The molar absorptivity of Sm at 652 nm was 6.6x10{sup 3} m{sup -1}{center_dot}mm{sup -1}. The error of measurement in the partial different conditions was about 2% of the value determined. The effects of impurities, Fe, Zn and Cu mixing in the Sm during operation, were clarified. (author)

  1. The expression, induction and pharmacological activity of CYP1A2 are post-transcriptionally regulated by microRNA hsa-miR-132-5p.

    Science.gov (United States)

    Chen, Yinting; Zeng, Linjuan; Wang, Yong; Tolleson, William H; Knox, Bridgett; Chen, Si; Ren, Zhen; Guo, Lei; Mei, Nan; Qian, Feng; Huang, Kaihong; Liu, David; Tong, Weida; Yu, Dianke; Ning, Baitang

    2017-12-01

    Cytochrome P450 1A2 (CYP1A2) is one of the most abundant and important drug metabolizing enzymes in human liver. However, little is known about the post-transcriptional regulation of CYP1A2, especially the mechanisms involving microRNAs (miRNAs). This study applied a systematic approach to investigate the post-transcriptional regulation of CYP1A2 by miRNAs. Candidate miRNAs targeting the 3'-untranslated region (3'-UTR) of CYP1A2 were screened in silico, resulting in the selection of sixty-two potential miRNAs for further analysis. The levels of two miRNAs, hsa-miR-132-5p and hsa-miR-221-5p, were inversely correlated with the expression of CYP1A2 mRNA transcripts in normal human liver tissue samples represented in The Cancer Genome Atlas (TCGA) dataset. The interactions between these miRNAs and cognate CYP1A2 mRNA sequences were evaluated using luciferase reporter gene studies and electrophoretic mobility shift assays, by which a direct interaction was confirmed involving hsa-miR-132-5p and a cognate binding site present in the CYP1A2 3'-UTR. Experiments by which hsa-miR-132-5p or random miRNA controls were introduced into HepG2, Huh-7 and HepaRG hepatic cell lines showed that only hsa-miR-132-5p suppressed the endogenous and lansoprazole-induced expression of CYP1A2, at biological activity, protein production, and mRNA transcript levels. Furthermore, 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT), and lactate dehydrogenase (LDH) assays showed that hsa-miR-132-5p attenuates CYP1A2-mediated, lansoprazole-enhanced, flutamide-induced hepatic cell toxicity. Results from multilayer experiments demonstrate that hsa-miR-132-5p suppresses the expression of CYP1A2 and that this suppression is able to decrease the extent of an adverse drug-drug interaction involving lansoprazole and flutamide. Published by Elsevier Inc.

  2. Synergism between arsenite and proteasome inhibitor MG132 over cell death in myeloid leukaemic cells U937 and the induction of low levels of intracellular superoxide anion

    Energy Technology Data Exchange (ETDEWEB)

    Lombardo, Tomás [Laboratorio de Immunotoxicologia (LaITO), IDEHU-CONICET, Hospital de Clínicas, José de San Martín, Universidad de Buenos Aires (UBA), Buenos Aires (Argentina); Cavaliere, Victoria; Costantino, Susana N. [Laboratorio de Inmunología Tumoral (LIT), IDEHU-CONICET, Facultad de Farmacia y Bioquímica, UBA, Buenos Aires (Argentina); Kornblihtt, Laura [Servicio de Hematología, Hospital de Clínicas, José de San Martín (UBA), Buenos Aires (Argentina); Alvarez, Elida M. [Laboratorio de Inmunología Tumoral (LIT), IDEHU-CONICET, Facultad de Farmacia y Bioquímica, UBA, Buenos Aires (Argentina); Blanco, Guillermo A., E-mail: gblanco@ffyb.uba.ar [Laboratorio de Immunotoxicologia (LaITO), IDEHU-CONICET, Hospital de Clínicas, José de San Martín, Universidad de Buenos Aires (UBA), Buenos Aires (Argentina)

    2012-02-01

    Increased oxygen species production has often been cited as a mechanism determining synergism on cell death and growth inhibition effects of arsenic-combined drugs. However the net effect of drug combination may not be easily anticipated solely from available knowledge of drug-induced death mechanisms. We evaluated the combined effect of sodium arsenite with the proteasome inhibitor MG132, and the anti-leukaemic agent CAPE, on growth-inhibition and cell death effect in acute myeloid leukaemic cells U937 and Burkitt's lymphoma-derived Raji cells, by the Chou–Talalay method. In addition we explored the association of cytotoxic effect of drugs with changes in intracellular superoxide anion (O{sub 2}{sup −}) levels. Our results showed that combined arsenite + MG132 produced low levels of O{sub 2}{sup −} at 6 h and 24 h after exposure and were synergic on cell death induction in U937 cells over the whole dose range, although the combination was antagonistic on growth inhibition effect. Exposure to a constant non-cytotoxic dose of 80 μM hydrogen peroxide together with arsenite + MG132 changed synergism on cell death to antagonism at all effect levels while increasing O{sub 2}{sup −} levels. Arsenite + hydrogen peroxide also resulted in antagonism with increased O{sub 2}{sup −} levels in U937 cells. In Raji cells, arsenite + MG132 also produced low levels of O{sub 2}{sup −} at 6 h and 24 h but resulted in antagonism on cell death and growth inhibition. By contrast, the combination arsenite + CAPE showed high levels of O{sub 2}{sup −} production at 6 h and 24 h post exposure but resulted in antagonism over cell death and growth inhibition effects in U937 and Raji cells. We conclude that synergism between arsenite and MG132 in U937 cells is negatively associated to O{sub 2}{sup −} levels at early time points after exposure. -- Highlights: ► Arsenic combined cytotoxic and anti-proliferative effects by Chou–Talalay method. ► Cytotoxic effect

  3. ¿Quién programa las redes sociales en Internet? El caso de Twiter en el movimiento #Yosoy132 México

    Directory of Open Access Journals (Sweden)

    Torres Nabel, Luis César

    2015-08-01

    Full Text Available The article discusses the latest hypothesis that social networks and Internet social influence is spontaneous and accidental, which contradicts the old hypothesis of the initial programming of all social movements from a previously defined strategic influence. The discussion starts from analyzing of the most influential players in the movement #YoSoy132 on social network Twitter in México.El artículo discute las últimas hipótesis de que en las redes sociales e Internet la influencia social es espontánea y accidental, lo que contradice las viejas hipótesis de la programación inicial de todo movimiento social a partir de un ejercicio de influencia estratégica y previamente definida. La discusión parte del análisis de los actores más influyentes en el movimiento #YoSoy132 en la red social Twitter en México.

  4. Search for a new reaction mechanism in the system /sup 132/Xe + (nat)Fe. [5. 00, 5. 90, and 7. 15 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Westmeier, W.; Reus, U.; Esterlund, R.A.; Gilat, J.; Patzelt, P.

    1981-04-01

    Thin targets of natural Fe have been irradiated with /sup 132/Xe ions at beam energies of 5.00, 5.90, and 7.15 MeV/u. Mass yields for projectile-like and symmetric products were evaluated, and their ratio as a function of beam energy determined. The results are consistent with previously-determined thick target radiochemical data, and are not consistent with published on-line counter data for the same system.

  5. [Membrane protective properties of diastereomers of methylpheophorbide a 13(2)-n-n-octyl-N-(2-hydroxy-3-isobornyl-5-methylbenzyl)amide].

    Science.gov (United States)

    Buravlev, E V; Belykh, D V; Chukicheva, I Iu; Tarabukina, I S; Shevchenko, O G; Kutchin, A V

    2013-01-01

    Two diastereomers of methylpheophorbide a 13(2)-N-n-octyl-N-(2-hydroxy-3-isobornyl-5-methylbenzyl)amide were obtained from (+)- and (-)-enantiomers of 2-isobornyl-4-methylphenol. Evaluation of membrane protective and antioxidant activity of individual diastereomers on the model of H2O2-induced hemolysis of blood erythrocytes showed that the stereochemistry of isobornyl substituent in the synthesized conjugates has no effect on their biological activity.

  6. The evolution of B(E2) values around the doubly-magic nucleus {sup 132}Sn

    Energy Technology Data Exchange (ETDEWEB)

    Behrens, Thomas

    2009-08-24

    In this work the evolution of B(E2) values in nuclei around the N=82 shell closure has been studied. The reduced transition strength between ground state and rst excited 2{sup +} state is a good indicator for the collectivity in even-even nuclei. Former experimental and theoretical investigations of the region above N=82 indicated that the B(E2) values might be systematically lower than expected and questioned the current understanding of collective excitations. Since the experimental data concerning the proposed N=82 shell quenching for nuclei below {sup 132}Sn is not yet conclusive, a systematic investigation of neutron-rich nuclei both below and above this shell closure has been performed at the Radioactive Ion Beam Facility REX-ISOLDE at CERN. The B(E2) values of {sup 122-126}Cd (N<82) and {sup 138-144}Xe (N>82) have been measured by Coulomb excitation in inverse kinematics, applying the MINIBALL {gamma}-detector array. The values of {sup 124,126}Cd and {sup 138,142,144}Xe have been determined for the first time, whereas for {sup 140}Xe the ambiguity of the two contradicting published B(E2) values has been solved. The relative uncertainty of the B(E2) value of {sup 122}Cd could be reduced significantly. For {sup 140,142}Xe the Coulomb excitation cross section for the 2{sub 1}{sup +}{yields}4{sub 1}{sup +} transition has also been determined. Further, the deorientation e ect and the influence of the quadrupole deformation on the Coulomb excitation cross section have been taken into account for {sup 138-142}Xe. It could be shown that the latter plays an important role for the determination of the B(E2) values. Assuming only a small or even vanishing quadrupole moment, all measured B(E2) values agree with the expectations and no sign for a quenching of the N=82 gap could be seen. (orig.)

  7. A 3-Year Prospective Cohort Study on 132 Calcium Phosphate-Blasted Implants: Flap vs Flapless Technique.

    Science.gov (United States)

    Prati, Carlo; Zamparini, Fausto; Scialabba, Viviana Stella; Gatto, Maria Rosaria; Piattelli, Adriano; Montebugnoli, Lucio; Gandolfi, Maria Giovanna

    2016-01-01

    To evaluate the survival rate and marginal bone loss (MBL) of a calcium phosphate-blasted titanium implant inserted by a flap or flapless technique and to study the morphochemical characteristics of the implant surface. Sixty out of 85 patients who received one or more implants were selected as eligible for this prospective longitudinal cohort clinical study. Titanium implants (n = 132) were placed in human healthy subjects using either a flap or flapless technique, selected on the basis of the best practice. The survival rate and MBL were evaluated after 3 months (preloading stress-free healing period) and after 6, 12, 24, and 36 months in relation to implant diameter, location, sex, and smoking habits. Surface morphochemical analyses were performed by environmental scanning electron microscopy connected with energy-dispersive x-ray (ESEM/EDX). The overall survival rate was 97.72%. After 3 and 36 months, MBL was 0.36 ± 0.66 mm and 1.09 ± 1.10 mm for the flapless group and 0.29 ± 0.51 mm and 1.03 ± 0.92 mm for the flap group. MBL showed a statistically significant increase with time (P = .0001), and differences were found at all times since 6 months. No statistical differences between the flapless and flap groups and sex were observed at any time, while MBL was significantly higher in the maxillary versus mandibular location (6, 12, and 24 months) and in smokers versus nonsmokers (6 months). Higher MBL in both groups was found for a smaller diameter (3.5 mm) than larger diameter (4.1, 5 mm). The surface showed a Ti-Al-V alloy displaying a uniform nanotexture. The implant system showed a high survival rate and markedly lower MBL considering the limits for acceptable progression. Flapless and flap techniques demonstrated similar results of MBL at the preloading healing period and at the 6 months to 3 years postloading periods. Both surgical procedures induced an early MBL during the preloading stress-free period. Implant diameter, mandibular/maxillary location

  8. Spectroscopy of particle-phonon coupled states in $^{133}$Sb by the cluster transfer reaction of $^{132}$Sn on $^{7}$Li

    CERN Multimedia

    We propose to investigate, with MINIBALL coupled to T-REX, the one-valence-proton $^{133}$Sb nucleus by the cluster transfer reaction of $^{132}$Sn on $^{7}$Li. The excited $^{133}$Sb will be populated by transfer of a triton into $^{132}$Sn, followed by the emission of an $\\alpha$-particle (detected in T-REX) and 2 neutrons. The aim of the experiment is to locate states arising from the coupling of the valence proton of $^{133}$Sb to the collective low-lying phonon excitations of $^{132}$Sn (in particular the 3$^−$). According to calculations in the weak-coupling approach, these states lie in the 4$\\, - \\,$5 MeV excitation energy region and in the spin interval 1/2$\\, - \\,$ 19/2, i.e., in the region populated by the cluster transfer reaction. The results will be used to perform advanced tests of different types of nuclear interactions, usually employed in the description of particle-phonon coupled excitations. States arising from couplings of the proton with simpler core excitations, involving few nucleons...

  9. ELKS1 localizes the synaptic vesicle priming protein bMunc13-2 to a specific subset of active zones.

    Science.gov (United States)

    Kawabe, Hiroshi; Mitkovski, Miso; Kaeser, Pascal S; Hirrlinger, Johannes; Opazo, Felipe; Nestvogel, Dennis; Kalla, Stefan; Fejtova, Anna; Verrier, Sophie E; Bungers, Simon R; Cooper, Benjamin H; Varoqueaux, Frederique; Wang, Yun; Nehring, Ralf B; Gundelfinger, Eckart D; Rosenmund, Christian; Rizzoli, Silvio O; Südhof, Thomas C; Rhee, Jeong-Seop; Brose, Nils

    2017-04-03

    Presynaptic active zones (AZs) are unique subcellular structures at neuronal synapses, which contain a network of specific proteins that control synaptic vesicle (SV) tethering, priming, and fusion. Munc13s are core AZ proteins with an essential function in SV priming. In hippocampal neurons, two different Munc13s-Munc13-1 and bMunc13-2-mediate opposite forms of presynaptic short-term plasticity and thus differentially affect neuronal network characteristics. We found that most presynapses of cortical and hippocampal neurons contain only Munc13-1, whereas ∼10% contain both Munc13-1 and bMunc13-2. Whereas the presynaptic recruitment and activation of Munc13-1 depends on Rab3-interacting proteins (RIMs), we demonstrate here that bMunc13-2 is recruited to synapses by the AZ protein ELKS1, but not ELKS2, and that this recruitment determines basal SV priming and short-term plasticity. Thus, synapse-specific interactions of different Munc13 isoforms with ELKS1 or RIMs are key determinants of the molecular and functional heterogeneity of presynaptic AZs. © 2017 Kawabe et al.

  10. Dimethylarsinic acid exposure causes accumulation of Hsp72 in cell nuclei and suppresses apoptosis in human alveolar cultured (L-132) cells.

    Science.gov (United States)

    Kato, K; Yamanaka, K; Hasegawa, A; Okada, S

    1999-11-01

    We previously found that 72-kDa heat shock protein (Hsp72) was induced and accumulated in the nuclei, together with DNA damage, in human alveolar epithelial (L-132) cells by exposure to dimethylarsinic acid (DMAA), which is a main metabolite of inorganic arsenics in mammals. In the present study, the intracellular behavior of Hsp72 was investigated during the recovery from the DNA damage induced by exposure to DMAA. L-132 cells were exposed to 10 mM DMAA for 3 h, and then incubated in DMAA-free medium. The induction of Hsp72 by exposure to DMAA reached a peak at 6-9 h after removal of DMAA. However, the cell-nuclear distribution of Hsp72 was observed until 3 h after the start of DMAA-free incubation. We further investigated the appearance of apoptosis of L-132 cells after exposure to 10 mM DMAA for 3 h. Internucleosomal DNA fragmentation and morphological changes, as criteria for the evidence of apoptosis, were observed 6-22 h after the start of DMAA-free incubation. The appearance of apoptosis was followed by the release of Hsp72 from the cell nuclei. These results suggest a possibility that the cell-nuclear Hsp72 may suppress the appearance of apoptosis in DNA-damaged cells.

  11. Central administration of ghrelin and agouti-related protein (83-132) increases food intake and decreases spontaneous locomotor activity in rats.

    Science.gov (United States)

    Tang-Christensen, Mads; Vrang, Niels; Ortmann, Sylvia; Bidlingmaier, Martin; Horvath, Tamas L; Tschöp, Matthias

    2004-10-01

    Ghrelin was recently identified as an endogenous ligand of the GH secretagogue receptor. The novel peptide hormone is produced by gastric A-like cells, and circulating levels rise before feeding, suggestive of ghrelin as an endogenous hunger factor. ghrelin stimulates food intake and promotes adiposity after peripheral or central administration, likely by activating hypothalamic neurons expressing the orexigenic neuropeptides neuropeptide Y (NPY) and agouti-related protein (AGRP). To examine whether ghrelin-induced feeding resembles NPY and AGRP [AGRP fragment (83-132)] induced orexia, we compared the short- and long-term orexigenic capacity of the three peptides. A single intracerebroventricular injection of ghrelin (0.2, 1.0, and 5.0 microg) increased food intake in a dose-dependent manner. A prolonged and uncompensated increase in feeding was seen after the highest dose of ghrelin. The prolonged effects on feeding (+72 h) closely resembled those of AGRP (83-132) but not NPY. Surprisingly, ghrelin injections reduced overall locomotor activity by 20% during the first 24-h observation period. AGRP (83-132) had similar effects on locomotor behavior, whereas NPY had no effect. In summary, ghrelin causes long-term increases of food intake and, like AGRP, plays a previously unknown role as a suppressor of spontaneous physical activity. Expanding the current model of food intake control to include mechanisms regulating physical activity may promote our understanding of two major etiological factors causing obesity.

  12. Cerebrospinal Fluid Abnormalities in HIV-Negative Patients with Secondary and Early Latent Syphilis and Serum VDRL ≥ 1:32

    Science.gov (United States)

    Pastuszczak, Maciej; Zeman, Jacek; Jaworek, Andrzej K; Wojas-Pelc, Anna

    2013-01-01

    Background: Syphilis is caused by a spirochete Treponema pallidum. Invasion of the central nervous system (CNS) by T. pallidum may appear early during the course of disease. The diagnosis of confirmed neurosyphilis is based on the reactive Venereal Disease Research Laboratory (VDRL) in cerebrospinal fluid (CSF). Recent studies indicated that serum RPR ≥ 1:32 are associated with higher risk of reactivity of CSF VDRL. Aims: The main aim of the current study was to assess cerebrospinal fluid serological and biochemical abnormalities in HIV negative subjects with secondary and early latent syphilis and serum VDRL ≥ 1:32. Materials and Methods: Clinical and laboratory data of 33 HIV-negative patients with secondary and early latent syphilis, with the serum VDRL titer ≥ 1:32, who underwent a lumbar puncture and were treated in Department of Dermatology at Jagiellonian University School of Medicine in Cracow, were collected. Results: Clinical examination revealed no symptoms of CNS involvement in all patients. 18% (n = 6) of patients met the criteria of confirmed neurosyphilis (reactive CSF-VDRL). In 14 (42%) patients CSF WBC count ≥ 5/ul was found, and in 13 (39%) subjects there was elevated CSF protein concentration (≥ 45 mg/dL). 10 patients had CSF WBC count ≥ 5/ul and/or elevated CSF protein concentration (≥ 45 mg/dL) but CSF-VDRL was not reactive. Conclusions: Indications for CSF examination in HIV-negative patients with early syphilis are the subject of discussion. It seems that all patients with syphilis and with CSF abnormalities (reactive serological tests, elevated CSF WBC count, elevated protein concentration) should be treated according to protocols for neurosyphilis. But there is a need for identification of biomarkes in order to identify a group of patients with syphilis, in whom risk of such abnormalities is high. PMID:23919017

  13. Cerebrospinal fluid abnormalities in HIV-negative patients with secondary and early latent syphilis and serum VDRL ≥ 1:32

    Directory of Open Access Journals (Sweden)

    Maciej Pastuszczak

    2013-01-01

    Full Text Available Background : Syphilis is caused by a spirochete Treponema pallidum. Invasion of the central nervous system (CNS by T. pallidum may appear early during the course of disease. The diagnosis of confirmed neurosyphilis is based on the reactive Venereal Disease Research Laboratory (VDRL in cerebrospinal fluid (CSF. Recent studies indicated that serum RPR ≥ 1:32 are associated with higher risk of reactivity of CSF VDRL. Aims : The main aim of the current study was to assess cerebrospinal fluid serological and biochemical abnormalities in HIV negative subjects with secondary and early latent syphilis and serum VDRL ≥ 1:32. Materials and Methods : Clinical and laboratory data of 33 HIV-negative patients with secondary and early latent syphilis, with the serum VDRL titer ≥ 1:32, who underwent a lumbar puncture and were treated in Department of Dermatology at Jagiellonian University School of Medicine in Cracow, were collected. Results : Clinical examination revealed no symptoms of CNS involvement in all patients. 18% ( n = 6 of patients met the criteria of confirmed neurosyphilis (reactive CSF-VDRL. In 14 (42% patients CSF WBC count ≥ 5/ul was found, and in 13 (39% subjects there was elevated CSF protein concentration (≥ 45 mg/dL. 10 patients had CSF WBC count ≥ 5/ul and/or elevated CSF protein concentration (≥ 45 mg/dL but CSF-VDRL was not reactive. Conclusions : Indications for CSF examination in HIV-negative patients with early syphilis are the subject of discussion. It seems that all patients with syphilis and with CSF abnormalities (reactive serological tests, elevated CSF WBC count, elevated protein concentration should be treated according to protocols for neurosyphilis. But there is a need for identification of biomarkes in order to identify a group of patients with syphilis, in whom risk of such abnormalities is high.

  14. Erratum: Effects of Water Table Control by Farm-Oriented Enhancing Aquatic System on Photosynthesis, Nodule Nitrogen Fixation, and Yield of Soybeans [ Plant Production Science Vol.15(2012) No.2 P132-143

    National Research Council Canada - National Science Library

    Shimada, Shinji; Hamaguchi, Hideo; Kim, Yeonghoo; Matsuura, Kazuya; Kato, Masayasu; Kokuryu, Takuo; Tazawa, Junko; Fujimori, Shinsaku

    2014-01-01

    Regarding the article Vol. 15(2): 132-143, 2012. Shimada et al. “Effects of Water Table Control by Farm-oriented Enhancing Aquatic System on Photosynthesis, Nodule Nitrogen Fixation, and Yield of Soybean...

  15. Hnutí YoSoy132 v Mexiku: proměny od prezidentských voleb 2012 po současnost

    OpenAIRE

    Ungerová, Aneta

    2012-01-01

    #YoSoy132 movement was founded in May 2012 during the election campaign, after a small incident with one of the presidential candidates, Enrique Peňa Nieto, at IberoAmerican University in Mexico City. The movement gained relatively quickly a large number of supporters from many Mexican universities and also among ordinary citizens. The topic of this thesis is the transformation and evolution of the movement from presidential elections till present days. The main goal of this paper is to analy...

  16. Synthesis, characterisation and antimicrobial activity of (5-bromo-5-nitro-2-oxido-1,3,2-dioxaphosphinan-2-yl amino acid esters

    Directory of Open Access Journals (Sweden)

    CIRANDUR SURESH REDDY

    2011-05-01

    Full Text Available Synthesis of a new series of (5-bromo-5-nitro-2-oxido-1,3,2-dioxaphosphinan-2-ylamino acid esters (3a–l was accomplished via a two step process, which involves the prior preparation of the monochloride intermediate (2 and its subsequent reaction with the amino acid esters in dry tetrahydrofuran in the presence of triethylamine at reflux temperature. The title compounds (3a–l structures were established by analytical, IR, 1H-, 13C- and 31P-NMR, and mass spectral data. They exhibited significant antibacterial and antifungal activity.

  17. Remaining Sites Verification Package for 132-H-1, 116-H Reactor Stack Burial Site, Waste Site Reclassification Form 2006-053

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-06-26

    The 132-H-1 waste site includes the 116-H exhaust stack burial trench and the buried stack foundation (which contains an embedded vertical 15-cm (6-in) condensate drain line). The 116-H reactor exhaust stack and foundation were decommissioned and demolished using explosives in 1983, with the rubble buried in situ beneath clean fill at least 1 m (3.3 ft) thick. Residual concentrations support future land uses that can be represented by a rural-residential scenario and pose no threat to groundwater or the Columbia River based on RESRAD modeling.

  18. Role of the conserved amino acids of the 'SDN' loop (Ser130, Asp131 and Asn132) in a class A beta-lactamase studied by site-directed mutagenesis.

    Science.gov (United States)

    Jacob, F; Joris, B; Lepage, S; Dusart, J; Frère, J M

    1990-10-15

    Ser130, Asp131 and Asn132 ('SDN') are highly conserved residues in class A beta-lactamases forming one wall of the active-site cavity. All three residues of the SDN loop in Streptomyces albus G beta-lactamase were modified by site-directed mutagenesis. The mutant proteins were expressed in Streptomyces lividans, purified from culture supernatants and their kinetic parameters were determined for several substrates. Ser130 was substituted by Asn, Ala and Gly. The first modification yielded an almost totally inactive protein, whereas the smaller-side-chain mutants (A and G) retained some activity, but were less stable than the wild-type enzyme. Ser130 might thus be involved in maintaining the structure of the active-site cavity. Mutations of Asp131 into Glu and Gly proved to be highly detrimental to enzyme stability, reflecting significant structural perturbations. Mutation of Asn132 into Ala resulted in a dramatically decreased enzymic activity (more than 100-fold) especially toward cephalosporin substrates, kcat. being the most affected parameter, which would indicate a role of Asn132 in transition-state stabilization rather than in ground-state binding. Comparison of the N132A and the previously described N132S mutant enzymes underline the importance of an H-bond-forming residue at position 132 for the catalytic process.

  19. $\\gamma$ and fast-timing spectroscopy of the doubly magic $^{132}$Sn and its one- and two-neutron particle/hole neighbours

    CERN Multimedia

    We propose to use fast-timing and spectroscopy to study five nuclei including the doubly magic $^{132}$Sn and its four neighbours: two-neutron hole $^{130}$Sn, one-neutron hole $^{131}$Sn, one-neutron particle $^{133}$Sn and two-neutron particle $^{134}$Sn. There is an increasing interest in these nuclei since they serve to test nuclear models using state-of-the-art interactions and many body approaches, and they provide information relevant to deduce single particle states. In addition properties of these nuclei are very important to model the astrophysical $\\textit{r-process}$. The present ISOLDE facility provides unique capabilities to study these Sn nuclei populated in the $\\beta$-decay of In isomers, produced from a UCx target unit equipped with neutron converter and ionized with RILIS, capable of selective isomer ionization. The increased production yields for $^{132}$In are estimated to be 200 larger than in the previous work done at OSIRIS. We will use the recently commissioned Isolde Decay Station (I...

  20. The proteasome inhibitor MG-132 sensitizes PC-3 prostate cancer cells to ionizing radiation by a DNA-PK-independent mechanism

    Directory of Open Access Journals (Sweden)

    McBride William H

    2005-07-01

    Full Text Available Abstract Background By modulating the expression levels of specific signal transduction molecules, the 26S proteasome plays a central role in determining cell cycle progression or arrest and cell survival or death in response to stress stimuli, including ionizing radiation. Inhibition of proteasome function by specific drugs results in cell cycle arrest, apoptosis and radiosensitization of many cancer cell lines. This study investigates whether there is also a concomitant increase in cellular radiosensitivity if proteasome inhibition occurs only transiently before radiation. Further, since proteasome inhibition has been shown to activate caspase-3, which is involved in apoptosis, and caspase-3 can cleave DNA-PKcs, which is involved in DNA-double strand repair, the hypothesis was tested that caspase-3 activation was essential for both apoptosis and radiosensitization following proteasome inhibition. Methods Prostate carcinoma PC-3 cells were treated with the reversible proteasome inhibitor MG-132. Cell cycle distribution, apoptosis, caspase-3 activity, DNA-PKcs protein levels and DNA-PK activity were monitored. Radiosensitivity was assessed using a clonogenic assay. Results Inhibition of proteasome function caused cell cycle arrest and apoptosis but this did not involve early activation of caspase-3. Short-time inhibition of proteasome function also caused radiosensitization but this did not involve a decrease in DNA-PKcs protein levels or DNA-PK activity. Conclusion We conclude that caspase-dependent cleavage of DNA-PKcs during apoptosis does not contribute to the radiosensitizing effects of MG-132.

  1. A randomised placebo-controlled trial to determine the effect of iron supplementation on pregnancy outcome in pregnant women with haemoglobin > or = 13.2 g/dl.

    Science.gov (United States)

    Ziaei, S; Norrozi, M; Faghihzadeh, S; Jafarbegloo, E

    2007-06-01

    To study the effect of iron supplementation on pregnancy outcome in pregnant women with haemoglobin (Hb) > or = 13.2 g/dl. A randomised, double-blind, placebo-controlled trial. Routine health services. Seven hundred and twenty-seven pregnant women with Hb > or = 13.2 g/dl in the early stage of the second trimester. Each woman took one ferrous sulphate [DOSAGE ERROR CORRECTED] tablet (150 g tablet, containing 50 mg of elemental iron) [DOSAGE ERROR CORRECTED] daily in the case group (n = 370) or placebo in the control group (n = 357) throughout pregnancy. Pregnancy outcome. While there were no significant differences in demographic and obstetric characteristics between the two groups before any intervention, small-for-gestational-age birth rate and the number of women with hypertension disorder increased significantly in the case group in comparison with the control group (57 [15.7%] versus 36 [10.3%], P = 0.035, 10 [2.7%] versus 3 [8%], P = 0.05, respectively). Our finding proves that routine iron supplementation in nonanaemic women is not rational and may be harmful.

  2. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  3. Oculocutaneous albinism in a patient with 17p13.2-pter duplication - a review on the molecular syndromology of 17p13 duplication.

    Science.gov (United States)

    Kucharczyk, Marzena; Jezela-Stanek, Aleksandra; Gieruszczak-Bialek, Dorota; Kugaudo, Monika; Cieslikowska, Agata; Pelc, Magdalena; Krajewska-Walasek, Malgorzata

    2015-06-01

    Chromosomal duplications involving 17p13.3 have recently been defined as a new distinctive syndrome with several diagnosed patients. Some variation is known to occur in the breakpoints of the duplicated region and, consequently, in the phenotype as well. We report on a patient, the fifth to our knowledge, a 4-year-old girl with a pure de novo subtelomeric 17p13.2-pter duplication. She presents all of the facial features described so far for this duplication and in addition, a unilateral palmar transversal crease and oculocutaneous albinism which has not been reported previously. A detailed molecular description of the reported aberration and correlation with the observed phenotypical features based on a literature review. We discuss the possible molecular etiology of albinism in regard to the mode of inheritance. The new data provided here may be useful for further genotype correlations in syndromes with oculocutaneous albinism, especially of autosomal dominant inheritance.

  4. Monopole-Driven Shell Evolution below the Doubly Magic Nucleus Sn132 Explored with the Long-Lived Isomer in Pd126

    Science.gov (United States)

    Watanabe, H.; Lorusso, G.; Nishimura, S.; Otsuka, T.; Ogawa, K.; Xu, Z. Y.; Sumikama, T.; Söderström, P.-A.; Doornenbal, P.; Li, Z.; Browne, F.; Gey, G.; Jung, H. S.; Taprogge, J.; Vajta, Zs.; Wu, J.; Yagi, A.; Baba, H.; Benzoni, G.; Chae, K. Y.; Crespi, F. C. L.; Fukuda, N.; Gernhäuser, R.; Inabe, N.; Isobe, T.; Jungclaus, A.; Kameda, D.; Kim, G. D.; Kim, Y. K.; Kojouharov, I.; Kondev, F. G.; Kubo, T.; Kurz, N.; Kwon, Y. K.; Lane, G. J.; Moon, C.-B.; Montaner-Pizá, A.; Moschner, K.; Naqvi, F.; Niikura, M.; Nishibata, H.; Nishimura, D.; Odahara, A.; Orlandi, R.; Patel, Z.; Podolyák, Zs.; Sakurai, H.; Schaffner, H.; Simpson, G. S.; Steiger, K.; Suzuki, H.; Takeda, H.; Wendt, A.; Yoshinaga, K.

    2014-07-01

    A new isomer with a half-life of 23.0(8) ms has been identified at 2406 keV in Pd126 and is proposed to have a spin and parity of 10+ with a maximally aligned configuration comprising two neutron holes in the 1h11/2 orbit. In addition to an internal-decay branch through a hindered electric octupole transition, β decay from the long-lived isomer was observed to populate excited states at high spins in Ag126. The smaller energy difference between the 10+ and 7- isomers in Pd126 than in the heavier N =80 isotones can be interpreted as being ascribed to the monopole shift of the 1h11/2 neutron orbit. The effects of the monopole interaction on the evolution of single-neutron energies below Sn132 are discussed in terms of the central and tensor forces.

  5. Compact Nd:YAG laser operating at 1.06, 1.32, and 1.44 μm for dental caries effective disinfection

    Science.gov (United States)

    Dostálová, Tat'jana; Jelínková, Helena; Kadlecová, Martina; Němec, Michal; Å ulc, Jan; Fibrich, Martin; Nejezchleb, Karel; Kapitch, Nickalai; Å koda, Václav

    2017-02-01

    The analysis of the disinfection effect of Nd:YAG laser radiation was investigated for patients with high concentration of Streptococcus mutans in saliva (positive result in Saliva-check mutans test). For the interaction the Nd:YAG laser system generated separate switchable wavelengths with the maximum output energies 1.1, 0.6, and 0.3 J for wavelength 1.06 μm, 1.32, μm and 1.44 μm, respectively, was used. Our study proved that after the laser irradiation the Saliva-check test showed negative presence of Streptococcus mutans. The disinfection effect was confirmed for all used radiation wavelength. For 1.44 μm this effect was reached with a smallest energy density.

  6. Finding of IDH1 R132H mutation in histologically non-neoplastic glial tissue changes surgical strategies, a case report

    DEFF Research Database (Denmark)

    Søndergaard, Christian Baastrup; Scheie, David; Sehested, Astrid Marie

    2017-01-01

    INTRODUCTION: In 2016, the WHO classification of diffuse astrocytoma began to include isocitrate dehydrogenase (IDH) mutation in addition to histology. RESULTS: We here demonstrate a case where a 14-year-old boy presented with a parietal tumor with no histological evidence of neoplasia but with a......INTRODUCTION: In 2016, the WHO classification of diffuse astrocytoma began to include isocitrate dehydrogenase (IDH) mutation in addition to histology. RESULTS: We here demonstrate a case where a 14-year-old boy presented with a parietal tumor with no histological evidence of neoplasia...... but with an IDH1 mutation. Due to the IDH1 R132H mutation, the patient was diagnosed with diffuse astrocytoma WHO grade II and underwent successful gross total resection of this near-eloquently located tumor. CONCLUSION: This case exemplifies how inclusion of immunohistochemistry in tumor classification alters...

  7. Formación de embriones somáticos a partir de semillas inmaduras en Sorghum bicolor variedad CIAP 132-R

    Directory of Open Access Journals (Sweden)

    Mayelín Rodríguez Urquiza

    2014-08-01

    Full Text Available Existen varios protocolos de regeneración de plantas vía embriogénesis somática de Sorghum bicolor (L. Moench, sin embargo los porcentajes de formación de callos con estructuras embriogénicas y regeneración de plantas son bajos. Es por ello que esta investigación tuvo como objetivo generar embriones somáticos en sorgo rojo variedad  CIAP 132-R. Se ensayaron diferentes concentraciones de 2,4-D para la formación de callos, así como tres concentraciones de ácido ascórbico para eliminar la exudación de compuestos fenólicos por el explante. También para la formación de los embriones somáticos a partir de los callos se evaluaron diferentes concentraciones de 2,4-D y 6-BAP. El mayor porcentaje de formación de callos (57.5 % se alcanzó con 18.1 µM de 2,4-D. Con la adición al medio de cultivo de 50.0 mg.l-1 de ácido ascórbico fue posible eliminar los compuestos fenólicos en el explante y en el medio de cultivo, además permitió incrementar el porcentaje de formación de callos con estructuras embriogénicas hasta un 95 %. El número mayor de embriones somáticos por callo se alcanzó en el medio de cultivo con concentraciones de 4,52 µM de 2,4-D, combinada con 2,22 µM de 6-BAP. Por primera vez, se logró la formación eficiente de embriones somáticos a partir de los callos obtenidos de semillas inmaduras  germinadas como explante inicial en la variedad CIAP 132-R.ABSTRACTSeveral protocols of plant regeneration via somatic embryogenesis from Sorghum bicolor (L. Moench have been development, however the percentage of calluses with embryogenic structures and plant regeneration are low. Therefore this study aimed to generate somatic embryos in red sorghum variety CIAP 132-R. Different concentrations of 2,4-D for callus formation, and three concentrations of ascorbic acid to remove phenolics exudation were assayed by explant. For the formation of embryos different concentrations of 2,4-D and 6-BAP were evaluated. The highest

  8. Multidimensional effects of biologically synthesized silver nanoparticles in Helicobacter pylori, Helicobacter felis, and human lung (L132) and lung carcinoma A549 cells

    Science.gov (United States)

    Gurunathan, Sangiliyandi; Jeong, Jae-Kyo; Han, Jae Woong; Zhang, Xi-Feng; Park, Jung Hyun; Kim, Jin-Hoi

    2015-02-01

    Silver nanoparticles (AgNPs) are prominent group of nanomaterials and are recognized for their diverse applications in various health sectors. This study aimed to synthesize the AgNPs using the leaf extract of Artemisia princeps as a bio-reductant. Furthermore, we evaluated the multidimensional effect of the biologically synthesized AgNPs in Helicobacter pylori, Helicobacter felis, and human lung (L132) and lung carcinoma (A549) cells. UV-visible (UV-vis) spectroscopy confirmed the synthesis of AgNPs. X-ray diffraction (XRD) indicated that the AgNPs are specifically indexed to a crystal structure. The results from Fourier transform infrared spectroscopy (FTIR) indicate that biomolecules are involved in the synthesis and stabilization of AgNPs. Dynamic light scattering (DLS) studies showed the average size distribution of the particle between 10 and 40 nm, and transmission electron microscopy (TEM) confirmed that the AgNPs were significantly well separated and spherical with an average size of 20 nm. AgNPs caused dose-dependent decrease in cell viability and biofilm formation and increase in reactive oxygen species (ROS) generation and DNA fragmentation in H. pylori and H. felis. Furthermore, AgNPs induced mitochondrial-mediated apoptosis in A549 cells; conversely, AgNPs had no significant effects on L132 cells. The results from this study suggest that AgNPs could cause cell-specific apoptosis in mammalian cells. Our findings demonstrate that this environmentally friendly method for the synthesis of AgNPs and that the prepared AgNPs have multidimensional effects such as anti-bacterial and anti-biofilm activity against H. pylori and H. felis and also cytotoxic effects against human cancer cells. This report describes comprehensively the effects of AgNPs on bacteria and mammalian cells. We believe that biologically synthesized AgNPs will open a new avenue towards various biotechnological and biomedical applications in the near future.

  9. Conformational stability and activity analysis of two hydroxymethylbilane synthase mutants, K132N and V215E, with different phenotypic association with acute intermittent porphyria

    Science.gov (United States)

    Bustad, Helene J.; Vorland, Marta; Rønneseth, Eva; Sandberg, Sverre; Martinez, Aurora; Toska, Karen

    2013-01-01

    The autosomal dominantly inherited disease AIP (acute intermittent porphyria) is caused by mutations in HMBS [hydroxymethylbilane synthase; also known as PBG (porphobilinogen) deaminase], the third enzyme in the haem biosynthesis pathway. Enzyme-intermediates with increasing number of PBG molecules are formed during the catalysis of HMBS. In this work, we studied the two uncharacterized mutants K132N and V215E comparative with wt (wild-type) HMBS and to the previously reported AIP-associated mutants R116W, R167W and R173W. These mainly present defects in conformational stability (R116W), enzyme kinetics (R167W) or both (R173W). A combination of native PAGE, CD, DSF (differential scanning fluorimetry) and ion-exchange chromatography was used to study conformational stability and activity of the recombinant enzymes. We also investigated the distribution of intermediates corresponding to specific elongation stages. It is well known that the thermostability of HMBS increases when the DPM (dipyrromethane) cofactor binds to the apoenzyme and the holoenzyme is formed. Interestingly, a decrease in thermal stability was measured concomitant to elongation of the pyrrole chain, indicating a loosening of the structure prior to product release. No conformational or kinetic defect was observed for the K132N mutant, whereas V215E presented lower conformational stability and probably a perturbed elongation process. This is in accordance with the high association of V215E with AIP. Our results contribute to interpret the molecular mechanisms for dysfunction of HMBS mutants and to establish genotype–phenotype relations for AIP. PMID:23815679

  10. Nosotros los proles, vosotros los ricos... #Yo Soy 132 : Un acercamiento a la percepción que tienen jóvenes miembros y simpatizantes del movimiento #Yo Soy 132 sobre la participación política y la democracia en México

    OpenAIRE

    Colín Olivares, Citlali Guadalupe

    2012-01-01

    Setenta y un años de administración priísta consolidada por medio de acciones fraudulentas y doce años de mal gobierno panista produjeron en los ciudadanos (sobre todo los jóvenes) una actitud de descrédito y apatía hacia su democracia. Con las elecciones de 2012, donde se apuntaba al candidato del PRI como potencial ganador; surge el movimiento estudiantil #Yo Soy 132 tomando fuerza en la escena política, logrando sumar a otros sectores; y que ante la escasez de espacios de participación ciu...

  11. Clinical and cytogenetic features of pediatric dic(9;20)(p13.2;q11.2)-positive B-cell precursor acute lymphoblastic leukemias: a Nordic series of 24 cases and review of the literature

    DEFF Research Database (Denmark)

    Forestier, Erik; Gauffin, Fredrika; Andersen, Mette K

    2008-01-01

    Although dic(9;20)(p13.2;q11.2) is a characteristic abnormality in childhood B-cell precursor acute lymphoblastic leukemias (BCP ALL), little is known about its clinical impact or the type and frequency of additional aberrations it may occur together with. We here review the clinical and cytogene...

  12. Preparation of Silicon Rubber/2,2'-(3-methyl-4-dihydro-1,3,2-benzoxazinePropane Ablative-resistant Composites and Its Ablative Structure

    Directory of Open Access Journals (Sweden)

    DONG Yimin

    2017-10-01

    Full Text Available Benzoxazine resin is a new generation of anti-ablation resin with high char yield and high-temperature oxidation resistance. Using high temperature vulcanized silicon rubber as ablation resistance matrix and 2,2'-(3-methyl-4-dihydro-1,3,2-benzoxazinepropane as anti-ablation resin, silicon rubber/polybenzoxazine anti-ablation composite was prepared by blending method. The mechanical properties were tested,and the ablation structure and the composition of the composite were investigated by DSC,SEM,FT-IR and Raman.Experimental results show that the polybenzoxazine resin can improve the ablation resistance property of silicone rubber composite. The composite has good ablation resistance and mechanical property when the addition of polybenzoxazine resin reaches 20 phr. After ablated by oxygen acetylene flame,the ablation layer is divided into three obvious layers as surface ceramic layer,pyrolysis carbonization layer and base layer. The surface ceramic layer formed in the progress of ablation plays a positive role in the ablation property of the composite material.

  13. Epinephrine, DNA integrity and oxidative stress in workers exposed to extremely low-frequency electromagnetic fields (ELF-EMFs) at 132 kV substations.

    Science.gov (United States)

    Tiwari, Ravindra; Lakshmi, N K; Bhargava, S C; Ahuja, Y R

    2015-03-01

    There is apprehension about widespread use of electrical and electromagnetic gadgets which are supposed to emit electromagnetic radiations. Reports are controversy. These electromagnetic fields (EMFs) have considerable effect on endocrine system of exposed subjects. This study was focused to assess the possible bioeffects of extremely low-frequency (ELF)-EMFs on epinephrine level, DNA damage and oxidative stress in subjects occupationally exposed to 132 kV high-voltage substations. The blood sample of 142 exposed subjects and 151 non-exposed individuals was analyzed. Plasma epinephrine was measured by enzyme-linked immunosorbent assay, DNA damage was studied by alkaline comet assay along with oxidative stress. Epinephrine levels of sub-groups showed mean concentration of 75.22  ±  1.46, 64.43  ±  8.26 and 48.47  ±  4.97 for high, medium and low exposed groups, respectively. DNA damage ranged between 1.69 µm and 9.91 µm. The oxidative stress levels showed significant increase. The individuals employed in the live-line procedures were found to be vulnerable for EM stress with altered epinephrine concentrations, DNA damage and increased oxidative stress.

  14. What proportion of AQP4-IgG-negative NMO spectrum disorder patients are MOG-IgG positive? A cross sectional study of 132 patients.

    Science.gov (United States)

    Hamid, Shahd H M; Whittam, Daniel; Mutch, Kerry; Linaker, Samantha; Solomon, Tom; Das, Kumar; Bhojak, Maneesh; Jacob, Anu

    2017-08-24

    Antibodies to myelin oligodendrocyte glycoprotein (MOG-IgG) have been described in patients with neuromyelitis optica spectrum disorders (NMOSD) without aquaporin-4 antibodies (AQP4-IgG). We aimed to identify the proportion of AQP4-IgG-negative NMOSD patients who are seropositive for MOG-IgG. In a cross sectional study, we reviewed all patients seen in the National NMO clinic over the last 4 years (after the availability of MOG-IgG testing), including clinical information, MRI, and antibody tests. 261 unique patients were identified. 132 cases satisfied the 2015 NMOSD diagnostic criteria. Of these, 96 (73%) were AQP4-IgG positive and 36 (27%) were AQP4-IgG negative. These 36 patients were tested for MOG-IgG and 15/36 (42%) tested positive. 20% (25/125) of the patients who did not satisfy NMOSD criteria had MOG-IgG. Approximately half of seronegative NMOSD is MOG-Ig seropositive and one in five of non-NMOSD/non-MS demyelination is MOG-IgG positive. Since MOG-associated demyelinating disease is likely different from AQP4-IgG disease in terms of underlying disease mechanisms, relapse risk and possibly treatment, testing for MOG-IgG in patients with AQP4-IgG-negative NMOSD and other non-MS demyelination may have significant implications to management and clinical trials.

  15. The Proteasome Inhibitor MG-132 Protects Hypoxic SiHa Cervical Carcinoma Cells after Cyclic Hypoxia/Reoxygenation from Ionizing Radiation

    Directory of Open Access Journals (Sweden)

    Frank Pajonk

    2006-12-01

    Full Text Available INTRODUCTION: Transient hypoxia and subsequent reoxygenation are common phenomena in solid tumors that greatly influence the outcome of radiation therapy. This study was designed to determine how varying cycles of hypoxia/reoxygenation affect the response of cervical carcinoma cells irradiated under oxic and hypoxic conditions and whether this could be modulated by proteasome inhibition. MATERIALS AND METHODS: Plateau-phase SiHa cervical carcinoma cells in culture were exposed to varying numbers of 30-minute cycles of hypoxia/reoxygenation directly before irradiation under oxic or hypoxic conditions. 26S Proteasome activity was blocked by addition of MG-132. Clonogenic survival was measured by a colonyforming assay. RESULTS: Under oxic conditions, repeated cycles of hypoxia/reoxygenation decreased the clonogenic survival of SiHa cells. This effect was even more pronounced after the inhibition of 26S proteasome complex. In contrast, under hypoxic conditions, SiHa cells were radioresistant, as expected, but this was increased by proteasome inhibition. CONCLUSIONS: Proteasome inhibition radiosensitizes oxygenated tumor cells but may also protect tumor cells from ionizing radiation under certain hypoxic conditions.

  16. The analysis of the possible thermal emission at radio frequencies from an evolved supernova remnant HB 3 (G132.7+1.3: Revisited

    Directory of Open Access Journals (Sweden)

    Onić D.

    2008-01-01

    Full Text Available It has recently been reported that some of the flux density values for an evolved supernova remnant (SNR HB 3 (G132.7+1.3 are not accurate enough. In this work we therefore revised the analysis of the possible thermal emission at radio frequencies from this SNR using the recently published, corrected flux density values. A model including the sum of non-thermal (purely synchrotron and thermal (bremsstrahlung components is applied to fit the integrated radio spectrum of this SNR. The contribution of thermal component to the total volume emissivity at 1 GHz is estimated to be ≈ 37%. The ambient density is also estimated to be n ≈ 9 cm-3 for T = 104 K. Again we obtained a relatively significant presence of thermal emission at radio frequencies from the SNR, which can support interaction between SNR HB 3 and adjacent molecular cloud associated with the H ii region W3. Our model estimates for thermal component contribution to total volume emissivity at 1 GHz and ambient density are similar to those obtained earlier (≈ 40 %, ≈ 10 cm-3 . It is thus obvious that the corrected flux density values do not affect the basic conclusions.

  17. The Analysis of the Possible Thermal Emission at Radio Frequencies from an Evolved Supernova Remnant HB 3 (G132.7+1.3: Revisited

    Directory of Open Access Journals (Sweden)

    Onić, D.

    2008-12-01

    Full Text Available It has recently been reported that some of the flux density values for an evolved supernova remnant (SNR HB 3 (G132.7$+$1.3 are not accurate enough. In this work we therefore revised the analysis of the possible thermal emission at radio frequencies from this SNR using the recently published, corrected flux density values. A model including the sum of non-thermal (purely synchrotron and thermal (bremsstrahlung components is applied to fit the integrated radio spectrum of this SNR. The contribution of thermal component to the total volume emissivity at $1 mathrm{GHz}$ is estimated to be $approx37 \\%$. The ambient density is also estimated to be $napprox 9 mathrm{cm}^{-3}$ for $mathrm{T}=10^{4} mathrm{K}$. Again we obtained a relatively significant presence of thermal emission at radio frequencies from the SNR, which can support interaction between SNR HB 3 and adjacent molecular cloud associated with the mbox{H,{sc ii}} region W3. Our model estimates for thermal component contribution to total volume emissivity at $1 mathrm{GHz}$ and ambient density are similar to those obtained earlier ($approx40 \\%$, $approx10 mathrm{cm^{-3}}$. It is thus obvious that the corrected flux density values do not affect the basic conclusions.

  18. Liver Fat, Hepatic Enzymes, Alkaline Phosphatase and the Risk of Incident Type 2 Diabetes: A Prospective Study of 132,377 Adults.

    Science.gov (United States)

    Chen, Sean Chun-Chang; Tsai, Shan Pou; Jhao, Jing-Yun; Jiang, Wun-Kai; Tsao, Chwen Keng; Chang, Ly-Yun

    2017-07-05

    Previous studies have reported inconsistent results of the associations of alanine transaminase (ALT), aspartate transaminase (AST), gamma-glutamyltransferase (GGT) and alkaline phosphatase (ALP) with incident type 2 diabetes (diabetes hereafter). We aimed to resolve the controversy by taking nonalcoholic fatty liver disease (NAFLD) into account. The study population comprised 132,377 non-diabetic individuals (64,875 men and 67,502 women) aged 35-79 who had two or more health examinations during 1996-2014. A total of 6,555 incident diabetes (3,734 men and 2,821 women) were identified, on average, over 5.8 years of follow-up. Cox regression was used to calculate the hazard ratio (HR) for incident diabetes, adjusting for classical confounders. The risk of incident diabetes was significantly associated with NAFLD [HR = 2.08 (men) and 2.65 (women)]. Elevated ALT, AST, GGT and ALP were also significantly associated with the increased risk of diabetes, with HRs of 1.27, 1.23, 1.58 and 1.37, respectively, in men, and 1.56, 1.18, 1.48 and 1.44, respectively in women. Our results suggest that NAFLD, ALT, AST, GGT and ALP are independent predictors for incident diabetes in both men and women.

  19. Human CYP2A13 and CYP2F1 Mediate Naphthalene Toxicity in the Lung and Nasal Mucosa of CYP2A13/2F1-Humanized Mice.

    Science.gov (United States)

    Li, Lei; Carratt, Sarah; Hartog, Matthew; Kovalchik, Nataliia; Jia, Kunzhi; Wang, Yanan; Zhang, Qing-Yu; Edwards, Patricia; Winkle, Laura Van; Ding, Xinxin

    2017-06-08

    The potential carcinogenicity of naphthalene (NA), a ubiquitous environmental pollutant, in human respiratory tract is a subject of intense debate. Chief among the uncertainties in risk assessment for NA is whether human lung CYP2A13 and CYP2F1 can mediate NA's respiratory tract toxicity. We aimed to assess the in vivo function of CYP2A13 and CYP2F1 in NA bioactivation and NA-induced respiratory tract toxicity in mouse models. Rates of microsomal NA bioactivation and the effects of an anti-CYP2A antibody were determined for lung and nasal olfactory mucosa (OM) from Cyp2abfgs-null, CYP2A13-humanized, and CYP2A13/2F1-humanized mice. The extent of NA respiratory toxicity was compared among wild-type, Cyp2abfgs-null, and CYP2A13/2F1-humanized mice following inhalation exposure at an occupationally relevant dose (10 ppm for 4 hr). In vitro studies indicated that the NA bioactivation activities in OM and lung of the CYP2A13/2F1-humanized mice were primarily contributed by, respectively, CYP2A13 and CYP2F1. CYP2A13/2F1-humanized mice showed greater sensitivity to NA than Cyp2abfgs-null mice, with greater depletion of nonprotein sulfhydryl and occurrence of cytotoxicity (observable by routine histology) in the OM, at 2 or 20 hr after termination of NA exposure, in humanized mice. Focal, rather than gross, lung toxicity was observed in Cyp2abfgs-null and CYP2A13/2F1-humanized mice; however, the extent of NA-induced lung injury (shown as volume fraction of damaged cells) was significantly greater in the terminal bronchioles of CYP2A13/2F1-humanized mice than in Cyp2abfgs-null mice. CYP2F1 is an active enzyme. Both CYP2A13 and CYP2F1 are active toward NA in the CYP2A13/2F1-humanized mice, where they play significant roles in NA-induced respiratory tract toxicity. https://doi.org/10.1289/EHP844.

  20. (E-13-(2-Bromophenylmicheliolide

    Directory of Open Access Journals (Sweden)

    Narsimha Reddy Penthala

    2014-03-01

    Full Text Available The title compound, C21H23BrO3 [systematic name: (3E,3aS,6Z,9R,9aS,9bS-3-(2-bromobenzylidene-9-hydroxy-6,9-dimethyl-3,3a,4,5,7,8,9,9a-octahydroazuleno[4,5-b]furan-2(9bH-one] was prepared by the reaction of 1-bromo-2-iodobenzene with micheliolide [systematic name: (3aS,R,9aS,9bS,Z-9-hydroxy-6,9-dimethyl-3-methylene-3,3a,4,5,7,8,9,9a-octahydroazuleno[4,5-b]furan-2(9bH-one] under Heck reaction conditions. The title compound exhibits intramolecular O—H...O hydrogen bonding between the hydroxy group and the lactone ring O atom, forming a ring of graph-set motif S(6. The 2-bromophenyl group is trans to the lactone ring, indicating that this is the E isomer (geometry of the exocyclic C=C bond. The dihedral angle between the benzene ring of the 2-bromophenyl moiety and the mean plane of the lactone ring is 51.68 (7°.

  1. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    2016-10-07

    Oct 7, 2016 ... 1Department of Physics, Faculty of Science, Taif University, Taif 888, Saudi Arabia. 2Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo, Egypt. 3Materials Science Unit, Department of Chemistry, Faculty of Science, Tanta University, 31725 Tanta, Egypt. 4Department of ...

  2. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    The optical properties of a new family of Sm2O3–(40–)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at ... The refractive index, molar refraction and polarizability of oxide ions have been calculated by using Lorentz–Lorentz relations. The non-linear variations of the above optical ...

  3. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. The optical properties of a new family of xSm2O3–(40–x)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at room temperature in the UV-visible region. From the absorption edge studies, the values of optical bandgap energies have been evaluated. The refractive index, molar ...

  4. Measurement of radiative lifetime in atomic samarium using ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... In this paper, we report the investigations of lifetime measurement of odd-parity energy level 19009.52 cm. −1 .... introduced by an electronic delay generator between the two Q-switch pulses of Nd-YAG laser. The slope of the .... Our values of the lifetimes are free from the common systematic errors. Thus ...

  5. A novel samarium complex with interesting photoluminescence and ...

    African Journals Online (AJOL)

    The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

  6. Lithium samarium polyphosphate, LiSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-02-01

    Full Text Available The mixed-metal rare-earth polyphosphate LiSm(PO34 consists of a three-dimensional framework in which zigzag [(PO3n]n− chains with a periodicity of four PO4 tetrahedra are connected through Li+ and Sm3+ ions (both with 2. symmetry.

  7. Sodium samarium tetrakis(polyphosphate, NaSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-07-01

    Full Text Available NaSm(PO34 has been prepared by solid state reactions. It belongs to type II of the structural family of MILnIII(PO34 compounds (MI = alkali metal and LnIII = rare earth metal and is composed of ∞(PO3n]n− polyphosphate chains with a repeating unit of four PO4 tetrahedra. The chains extend parallel to [100] and share O atoms with irregular SmO8 polyhedra, forming a three-dimensional framework which delimits tunnels occupied by Na+ cations in a distorted octahedral environment.

  8. Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

    Energy Technology Data Exchange (ETDEWEB)

    Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-08

    The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

  9. Synthesis of copper, silver, and samarium chalcogenides by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Ohtani, T.; Maruyama, K.; Ohshima, K. [Okayama Univ. of Science (Japan). Lab. for Solid State Chemistry

    1997-03-01

    CuInX{sub 2} (X = S, Se, Te), Ag{sub 2}S, Ag{sub 2}Se, Ag{sub 3}Te{sub 2}, Ag{sub 1.9}Te, AgCuSe, Sm{sub 3}Se{sub 4}, Sm{sub 2}Se{sub 3}, and SmTe were synthesized by a mechanical alloying method, using a high-energy planetary ball mill. The compounds were obtained by milling mixtures of the elements with desired ratios in agate or Cu-Be vials for 60--180 min.

  10. Oriented growth of thin films of samarium oxide by MOCVD

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Thin films of Sm2O3 have been grown on Si(100) and fused quartz by low-pressure chemical va- pour deposition using an adducted β-diketonate precursor. The films on quartz are cubic, with no preferred orientation at lower growth temperatures (~ 550°C), while they grow with a strong (111) orientation as the.

  11. 150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

    Science.gov (United States)

    1978-12-01

    considerable hand labor. Addition of a provision for suitable electrical connection by the SCR manufacturer wou;d be desirable for production runs. Predicted...licen- sing the holder or any other person or corporation, or conveying any rights or permission to manufacture , use, or sell any patented invent,’n...tesile strength to contain the magnets and pole pieces up through the overspeed rating of the rotor. The cho.;en process uses maraging steel as the

  12. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Glasses with the composition, (Sm2O3)(ZnO)(40–)(TeO2)(60), were prepared by conventional melt quenching method. The density, molar volume, and optical energy band gap of these glasses have been measured. The refractive index, molar refraction and polarizability of oxide ion have been calculated by using ...

  13. Determinación de la Posición Angular de Motor de Reluctancia Conmutada MFR132.5 con Estimador de Horizonte Deslizante

    Directory of Open Access Journals (Sweden)

    Ariel O. Cepero Díaz

    2014-10-01

    Full Text Available Resumen: La determinación de la posición angular instantánea del rotor es parte integral del control en los accionamientos de Motores de Reluctancia Conmutada (MRC. La medición directa de esta variable adiciona complejidad y costo al sistema y no siempre da buenos resultados. Esto ha motivado el desarrollo y prueba de estimadores de la posición angular del rotor que utilicen solamente las mediciones de las variables eléctricas del MRC. En este trabajo se presentan dos variantes del Estimador de Horizonte Deslizante (MHE para estimar la velocidad y la posición angular del rotor del MRC MFR 132.5, empleando dos modelos distintos del motor, uno de caja blanca y otro de caja gris. Se muestran los resultados de la simulación de los estimadores diseñados para estimar la velocidad y la posición angular del rotor durante el arranque hasta haber activado consecutivamente todas las fases y para estimar estas variables cuando el motor trabaja regularmente y aparecen perturbaciones en el torque de la carga, considerando en ambos casos un error en la estimación de la posición angular de partida y la presencia de ruidos en las mediciones. Los resultados demuestran que este tipo de estimadores realiza estimaciones satisfactorias del estado del motor, aún ante la presencia de perturbaciones en el torque de la carga, siendo mejores cuando se utiliza un modelo gris del sistema. Copyright © 2014 CEA. Publicado por Elsevier España, S.L. Todos los derechos reservados. Abstract: The measure of the instant angular position of the rotor is integral part of the control of Switching Reluctance Motors (SRM drivers. The direct measurement of this variable adds complexity and cost to the system and it doesn’t give good results sometimes. That has motivated the development and test of estimators for the rotor angular position that only use the measurements of the electrical variables of the SRM. In this work are presented two

  14. Expression of e-cadherin, n-cadherin and snail and their correlation with clinicopathological variants: an immunohistochemical study of 132 invasive ductal breast carcinomas in Egypt

    Directory of Open Access Journals (Sweden)

    Hanan Mohamed Abd ElMoneim

    2011-01-01

    Full Text Available OBJECTIVE: To evaluate the expression of the cell adhesion molecules E-cadherin and N-cadherin and the transcription factor Snail in invasive ductal breast carcinomas and to determine their relationships with clinicopathological features. METHODS: Immunohistochemistry was used to examine E-cadherin, N-cadherin, and Snail protein expression in 132 invasive breast carcinomas. RESULTS: The expression of E-cadherin was decreased (negative or weak in 37.1% of invasive carcinomas, while N-cadherin and Snail overexpression were detected in 51.9% and 40.9% of carcinomas, respectively. Low E-cadherin expression was significantly correlated with poorly differentiated carcinoma (53.1%, positive node status (80.9%, poor Nottingham Prognostic Index (64.7%, and the presence of estrogen and progesterone receptors. Overexpression of N-cadherin and Snail were also significantly correlated with poorly differentiated carcinoma, positive node status, and poor Nottingham Prognostic Index but were correlated with the absence of hormone receptors. Loss of E-cadherin immunoexpression was strongly associated with the presence of membranous N-cadherin (87.8% and nuclear Snail (69.4%. CONCLUSION: Loss of E-cadherin and overexpression of N-cadherin and Snail in breast carcinomas may play a central role in the development of invasive ductal breast carcinoma. These biomarkers may provide a valuable reference for the study of invasive ductal carcinoma progression and to characterize the biological behavior of the tumor. In the future, increased N-cadherin and decreased E-cadherin expression may be used as indicators of the progression and prognosis of invasive ductal carcinoma.

  15. Functional metagenomic discovery of bacterial effectors in the human microbiome and isolation of commendamide, a GPCR G2A/132 agonist.

    Science.gov (United States)

    Cohen, Louis J; Kang, Hahk-Soo; Chu, John; Huang, Yun-Han; Gordon, Emma A; Reddy, Boojala Vijay B; Ternei, Melinda A; Craig, Jeffrey W; Brady, Sean F

    2015-09-01

    The trillions of bacteria that make up the human microbiome are believed to encode functions that are important to human health; however, little is known about the specific effectors that commensal bacteria use to interact with the human host. Functional metagenomics provides a systematic means of surveying commensal DNA for genes that encode effector functions. Here, we examine 3,000 Mb of metagenomic DNA cloned from three phenotypically distinct patients for effectors that activate NF-κB, a transcription factor known to play a central role in mediating responses to environmental stimuli. This screen led to the identification of 26 unique commensal bacteria effector genes (Cbegs) that are predicted to encode proteins with diverse catabolic, anabolic, and ligand-binding functions and most frequently interact with either glycans or lipids. Detailed analysis of one effector gene family (Cbeg12) recovered from all three patient libraries found that it encodes for the production of N-acyl-3-hydroxypalmitoyl-glycine (commendamide). This metabolite was also found in culture broth from the commensal bacterium Bacteroides vulgatus, which harbors a gene highly similar to Cbeg12. Commendamide resembles long-chain N-acyl-amides that function as mammalian signaling molecules through activation of G-protein-coupled receptors (GPCRs), which led us to the observation that commendamide activates the GPCR G2A/GPR132. G2A has been implicated in disease models of autoimmunity and atherosclerosis. This study shows the utility of functional metagenomics for identifying potential mechanisms used by commensal bacteria for host interactions and outlines a functional metagenomics-based pipeline for the systematic identification of diverse commensal bacteria effectors that impact host cellular functions.

  16. Use of image registration and fusion algorithms and techniques in radiotherapy: Report of the AAPM Radiation Therapy Committee Task Group No. 132.

    Science.gov (United States)

    Brock, Kristy K; Mutic, Sasa; McNutt, Todd R; Li, Hua; Kessler, Marc L

    2017-07-01

    Image registration and fusion algorithms exist in almost every software system that creates or uses images in radiotherapy. Most treatment planning systems support some form of image registration and fusion to allow the use of multimodality and time-series image data and even anatomical atlases to assist in target volume and normal tissue delineation. Treatment delivery systems perform registration and fusion between the planning images and the in-room images acquired during the treatment to assist patient positioning. Advanced applications are beginning to support daily dose assessment and enable adaptive radiotherapy using image registration and fusion to propagate contours and accumulate dose between image data taken over the course of therapy to provide up-to-date estimates of anatomical changes and delivered dose. This information aids in the detection of anatomical and functional changes that might elicit changes in the treatment plan or prescription. As the output of the image registration process is always used as the input of another process for planning or delivery, it is important to understand and communicate the uncertainty associated with the software in general and the result of a specific registration. Unfortunately, there is no standard mathematical formalism to perform this for real-world situations where noise, distortion, and complex anatomical variations can occur. Validation of the software systems performance is also complicated by the lack of documentation available from commercial systems leading to use of these systems in undesirable 'black-box' fashion. In view of this situation and the central role that image registration and fusion play in treatment planning and delivery, the Therapy Physics Committee of the American Association of Physicists in Medicine commissioned Task Group 132 to review current approaches and solutions for image registration (both rigid and deformable) in radiotherapy and to provide recommendations for quality

  17. Inhibition of miRNA-212/132 improves the reprogramming of fibroblasts into induced pluripotent stem cells by de-repressing important epigenetic remodelling factors.

    Science.gov (United States)

    Pfaff, Nils; Liebhaber, Steffi; Möbus, Selina; Beh-Pajooh, Abbas; Fiedler, Jan; Pfanne, Angelika; Schambach, Axel; Thum, Thomas; Cantz, Tobias; Moritz, Thomas

    2017-04-01

    MicroRNAs (miRNAs) repeatedly have been demonstrated to play important roles in the generation of induced pluripotent stem cells (iPSCs). To further elucidate the molecular mechanisms underlying transcription factor-mediated reprogramming we have established a model, which allows for the efficient screening of whole libraries of miRNAs modulating the generation of iPSCs from murine embryonic fibroblasts. Applying this model, we identified 14 miRNAs effectively inhibiting iPSC generation, including miR-132 and miR-212. Intriguingly, repression of these miRNAs during iPSC generation also resulted in significantly increased reprogramming efficacy. MiRNA target evaluation by qRT-PCR, Western blot, and luciferase assays revealed two crucial epigenetic regulators, the histone acetyl transferase p300 as well as the H3K4 demethylase Jarid1a (KDM5a) to be directly targeted by both miRNAs. Moreover, we demonstrated that siRNA-mediated knockdown of either p300 or Jarid1a recapitulated the miRNA effects and led to a significant decrease in reprogramming efficiency. Thus, conducting a full library miRNA screen we here describe a miRNA family, which markedly reduces generation of iPSC and upon inhibition in turn enhances reprogramming. These miRNAs, at least in part, exert their functions through repression of the epigenetic modulators p300 and Jarid1a, highlighting these two molecules as an endogenous epigenetic roadblock during iPSC generation. Copyright © 2017. Published by Elsevier B.V.

  18. Nuclear deformation and the two-neutrino double- {beta} decay in {sup 124,126}Xe, {sup 128,130}Te, {sup 130,132}Ba and {sup 150}Nd isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Singh, S.; Chandra, R.; Rath, P.K. [University of Lucknow, Department of Physics, Lucknow (India); Raina, P.K. [IIT, Department of Physics and Meteorology, Kharagpur (India); Hirsch, J.G. [Universidad Nacional Autonoma de Mexico, Instituto de Ciencias Nucleares, A.P. 70-543, Mexico (Mexico)

    2007-09-15

    The two-neutrino double-beta decay of {sup 124,126}Xe, {sup 128,} {sup 130}Te,{sup 130,132}Ba and {sup 150}Nd isotopes is studied in the Projected Hartree-Fock-Bogoliubov (PHFB) model. Theoretical 2 {nu} {beta}{sup -}{beta}{sup -} half-lives of {sup 128,130}Te, and {sup 150}Nd isotopes, and 2{nu}{beta}{sup +}{beta}{sup +}, 2 {nu} {beta}{sup +}EC and 2{nu}ECEC for {sup 124,126}Xe and {sup 130,132}Ba nuclei are presented. Calculated quadrupolar transition probabilities B(E2:0{sup +}{yields}2{sup +}), static quadrupole moments and g-factors in the parent and daughter nuclei reproduce the experimental information, validating the reliability of the model wave functions. The anticorrelation between nuclear deformation and the nuclear transition matrix element M{sub 2{nu}} is confirmed. (orig.)

  19. Synthesis, spectral and antimicrobial activity of [3-(4-chloro-phenoxy-2,4-diisopropyl-2,3,4,5-tetrahydro-1H-3l5-benzo[e][1,3,2]diazaphosphepin-3-ylidene]-alkyl-amine

    Directory of Open Access Journals (Sweden)

    R. Usha Nagalakshmi

    2009-11-01

    Full Text Available 3-(4-chlorophenoxy-2,4-diisopropyl-2,3,4,5-tetrahydro-1H-benzo[e][1,3,2]diaza-phosphepine was synthesized starting from 1,2-bis(bromomethylbenzene by reacting with 2 equimolar isopropyl amine, one equimolar PBr3 and then one equimolar 4-chlorophenol, respectively. The Staudinger reaction of the diazaphphosphine with a series of alkyl azides gave the corresponding iminophosphoranes. Antibacterial activities of the synthesized iminophosphoranes were screened

  20. A very peculiar family of N-heterocyclic phosphines: unusual structures and the unique reactivity of 1,3,2-diazaphospholenes.

    Science.gov (United States)

    Gudat, D

    2016-04-14

    This Perspective gives an account of the peculiar electronic and molecular structures of N-heterocyclic phosphines featuring either a single 1,3,2-diazaphospholene (DAP) ring with an exocyclic P-substituent X or two DAP rings linked by a P-P bond (bis-diazaphospholenyls), respectively, and their impact on the chemical properties of these molecules. The bonding situation in simple DAPs is epitomized by strong hyperconjugation between endocyclic π-type electrons and the exocyclic P-X bond. This interaction may induce a perceptible ionic polarization of the P-X bond which can persist even in the limit of a vanishing electronegativity gradient between P and X, and becomes visible in unusual geometric distortions of molecular structures and a unique chemical behaviour. Structural distortions are particularly evident in bond lengthening effects in P-halogen and P-phosphino derivatives R2P-DAP (with R2P ≠ DAP) which span the whole range from covalent molecules to contact ion pairs with a close relation to frustrated Lewis-pairs. The most significant impact on the chemical properties is found for P-phosphino- and P-hydrogen derivatives where reactions at substantially accelerated rates or totally new reaction modes can be observed, and new stoichiometric and first catalytic processes exploiting these features are currently emerging. The recently discovered bis-diazaphospholenyls differ from the simple derivatives as their central bond remains unpolarised as a consequence of the symmetric molecular structure. The occurrence of low-energy P-P bond homolysis that was nonetheless observed in one case is according to the results of thermochemical studies of P-P bond fission reactions attributable to the effects of steric congestion and induces chemical reactivity that can be considered complementary to that of the simple R2P-DAPs. Some concluding remarks will pay attention to a facet of DAP reactivity that has so far been widely neglected but is currently receiving

  1. WASP-South transiting exoplanets: WASP-130b, WASP-131b, WASP-132b, WASP-139b, WASP-140b, WASP-141b and WASP-142b

    Science.gov (United States)

    Hellier, C.; Anderson, D. R.; Cameron, A. Collier; Delrez, L.; Gillon, M.; Jehin, E.; Lendl, M.; Maxted, P. F. L.; Neveu-VanMalle, M.; Pepe, F.; Pollacco, D.; Queloz, D.; Ségransan, D.; Smalley, B.; Southworth, J.; Triaud, A. H. M. J.; Udry, S.; Wagg, T.; West, R. G.

    2017-03-01

    We describe seven exoplanets transiting stars of brightness V = 10.1-12.4. WASP-130b is a 'warm Jupiter' having an orbital period of 11.6 d around a metal-rich G6 star. Its mass and radius (1.23 ± 0.04 MJup and 0.89 ± 0.03 RJup) support the trend that warm Jupiters have smaller radii than hot Jupiters. WASP-131b is a bloated Saturn-mass planet (0.27 MJup and 1.22 RJup). Its large scaleheight and bright (V = 10.1) host star make it a good target for atmospheric characterization. WASP-132b (0.41 MJup and 0.87 RJup) is among the least irradiated and coolest of WASP planets, having a 7.1-d orbit around a K4 star. WASP-139b is a 'super-Neptune' akin to HATS-7b and HATS-8b, being the lowest mass planet yet found by WASP (0.12 MJup and 0.80 RJup). The metal-rich K0 host star appears to be anomalously dense, akin to HAT-P-11. WASP-140b is a 2.4-MJup planet in an eccentric (e = 0.047 ± 0.004) 2.2-d orbit. The planet's radius is large (1.4 RJup), but uncertain owing to the grazing transit (b = 0.93). The 10.4-d rotation period of the K0 host star suggests a young age, and the time-scale for tidal circularization is likely to be the lowest of all known eccentric hot Jupiters. WASP-141b (2.7 MJup, 1.2 RJup and P = 3.3 d) and WASP-142b (0.84 MJup, 1.53 RJup and P = 2.1 d) are typical hot Jupiters orbiting metal-rich F stars. We show that the period distribution within the hot-Jupiter bulge does not depend on the metallicity of the host star.

  2. Decreased Shoulder External Rotation and Flexion Are Greater Predictors of Injury Than Internal Rotation Deficits: Analysis of 132 Pitcher-Seasons in Professional Baseball.

    Science.gov (United States)

    Camp, Christopher L; Zajac, John M; Pearson, David B; Sinatro, Alec M; Spiker, Andrea M; Werner, Brian C; Altchek, David W; Coleman, Struan H; Dines, Joshua S

    2017-09-01

    The primary aims of this work were to (1) describe normal range of motion (ROM) profiles for elite pitchers, (2) describe the characteristics of shoulder and elbow injuries in professional pitchers over a 6-year period in one Major League Baseball organization, and (3) identify ROM measures that were independently associated with a future shoulder or elbow injury. Over 6 seasons (2010-2015), a preseason assessment was performed on all pitchers invited to Major League Baseball Spring Training for a single organization. ROM measures included shoulder flexion, horizontal adduction, external rotation (ER), internal rotation, as well as elbow flexion and extension, were measured for both the dominant and nondominant arm, and total range of motion and deficits were calculated. All noncontact shoulder and elbow injuries were identified. Using multivariate binomial logistic regression analysis to control for age, height, weight, and all other ROM measures, the factors associated with an increased risk of subsequent shoulder or elbow injury were identified. A total of 53 shoulder (n = 25) and elbow (n = 28) injuries occurred during 132 pitcher seasons (n = 81 pitchers). The most significant categorical risk factor associated with increased elbow injury rates was the presence of a shoulder flexion deficit >5° (odds ratio [OR] 2.83; P = .042). For continuous variables, the risk of elbow injury increased by 7% for each degree of increased shoulder ER deficit (OR 1.07; P = .030) and 9% for each degree of decreased shoulder flexion (OR 1.09; P = .017). None of the measures significantly correlated with shoulder injuries. Preseason shoulder ER and flexion deficits are independent risk factors for the development of elbow injuries during the upcoming season. Although prior work has supported the importance of reducing glenohumeral internal rotation deficits in pitchers, this study demonstrates that deficits in shoulder ER and flexion are more significant predictors of

  3. Design and Control of a 13.2 kV/10 kVA Single-Phase Solid-State-Transformer with 1.7 kV SiC Devices

    Directory of Open Access Journals (Sweden)

    Jeong-Woo Lim

    2018-01-01

    Full Text Available This paper describes the power stage design, control, and performance evaluation of a 13.2 kV/10 kVA solid-state-transformer (SST for a power distribution system. The proposed SST consists of 10 modules where each individual module contains a unidirectional three-level power factor correction (PFC converter for the active-front-end (AFE stage and an LLC resonant converter for the isolated DC-DC stage. The operating principles of the converters are analyzed and the modulation and the control schemes for the entire module are described in detail. The DC-link voltage imbalance is also less than other SST topologies due to the low number of uncontrollable switching states. In order to simplify the control of the power stage, a modulation strategy for the AFE stage is proposed, and the modulation frequency of the LLC converter is also fixed. In addition, a compensation algorithm is suggested to eliminate the current measurement offset in the AFE stage. The proposed SST achieves the unity power factor at the input AC current regardless of the reactive or nonlinear load and a low voltage regulation at the AC output. In order to verify the effectiveness of the SST, the 13.2 kV/10 kV SST prototype is built and tested. Both the simulation and the experimental results under actual 13.2 kV line show the excellent performance of the proposed SST scheme.

  4. Influence of i{sub 13/2} proton and j{sub 15/2} neutron intruding orbitals on the behaviour of 190 mass region superdeformed nuclei; Influence des orbitales intruses proton i{sub 13/2} et neutron j{sub 15/2} sur le comportement des noyaux superdeformes de la region de masse 190

    Energy Technology Data Exchange (ETDEWEB)

    Duprat, J.

    1995-01-01

    This work concerns the study of the nuclear superdeformation phenomenon in the A = 190 mass region. The superdeformed (SD) states in {sup 193}Tl, {sup 194}Tl {sup 195}Tl were produced via heavy-ion induced reactions and studied with the EUROGAM gamma multidetector array. The analysis of high-multiplicity events allowed the study of the magnetic properties of the SD states in these nuclei. For the first time, the g-factor of a proton orbital in a SD nucleus in the A = 190 mass region has been extracted. This measurement indicates that the two known bands in {sup 195}Tl-SD are built on the i{sub 13/2} proton intruder orbital. A new SD band has been found in this isotope: it is the first SD band built on an excited proton state found in the A = 190 region. Finally an interaction between two pairs of bands has been established in {sup 194}Tl; this interaction indicate the crossing of two neutron orbitals above the N = 112 gap. The magnetic properties of the states of the SD bands in {sup 194}Tl reveals that these bands are built on configurations in which the single proton and neutron intrinsic spins are aligned. Comparison between different SD bands in the Thallium isotopes shows the prominent role of the i{sub 13/2} proton and the j{sub 15/2} neutron intruder orbitals in the smooth increase of the dynamical moment of inertia as a function of the rotational frequency. In addition, this work reports on the first observation of a SD rotational band produced in a (HI, {alpha}xn) reaction channel. The study of the maximum spin reached by the SD bands indicates both a competition between alpha emission and fission of the compound nucleus, and the limitation due to the fission process in the population of the SD nuclei in the A = 190 region. (author). 120 refs., 112 figs., 22 tabs., 2 ann.

  5. Comment on "Anomalous wave propagation in a one-dimensional acoustic metamaterial having simultaneously negative mass density and Young's modulus" [J. Acoust. Soc. Am. 132, 2887-2895 (2012)].

    Science.gov (United States)

    Marston, Philip L

    2014-03-01

    The phase and group velocities of elastic guided waves are important in the physical interpretation of high frequency scattering by fluid-loaded elastic shells. Outside the context of scattering, those properties are also important for understanding the energy flow in acoustic metamaterials. In a recent investigation of acoustic metamaterials exhibiting anomalous wave propagation [J. Acoust. Soc. Am. 132, 2887-2895 (2012)] criticism of negative group velocity terminology was generalized to elastic waves guided on ordinary materials. Some context and justification for retaining the identification of negative group velocities associated with a type of backscattering enhancement for shells are explained here. The phase evolution direction is determined by the boundary conditions.

  6. Nuclear structure of tellurium 133 via beta decay and shell model calculations in the doubly magic tin 132 region. [J,. pi. , transition probabilities, neutron and proton separation, g factors

    Energy Technology Data Exchange (ETDEWEB)

    Lane, S.M.

    1979-08-01

    An experimental investigation of the level structure of /sup 133/Te was performed by spectroscopy of gamma-rays following the beta-decay of 2.7 min /sup 133/Sb. Multiscaled gamma-ray singles spectra and 2.5 x 10/sup 7/ gamma-gamma coincidence events were used in the assignment of 105 of the approximately 400 observed gamma-rays to /sup 133/Sb decay and in the construction of the /sup 133/Te level scheme with 29 excited levels. One hundred twenty-two gamma-rays were identified as originating in the decay of other isotopes of Sb or their daughter products. The remaining gamma-rays were associated with the decay of impurity atoms or have as yet not been identified. A new computer program based on the Lanczos tridiagonalization algorithm using an uncoupled m-scheme basis and vector manipulations was written. It was used to calculate energy levels, parities, spins, model wavefunctions, neutron and proton separation energies, and some electromagnetic transition probabilities for the following nuclei in the /sup 132/Sn region: /sup 128/Sn, /sup 129/Sn, /sup 130/Sn, /sup 131/Sn, /sup 130/Sb, /sup 131/Sb, /sup 132/Sb, /sup 133/Sb, /sup 132/Te, /sup 133/Te, /sup 134/Te, /sup 134/I, /sup 135/I, /sup 135/Xe, and /sup 136/Xe. The results are compared with experiment and the agreement is generally good. For non-magic nuclei: the lg/sub 7/2/, 2d/sub 5/2/, 2d/sub 3/2/, 1h/sub 11/2/, and 3s/sub 1/2/ orbitals are available to valence protons and the 2d/sub 5/2/, 2d/sub 3/2/, 1h/sub 11/2/, and 3s/sub 1/2/ orbitals are available to valence neutron holes. The present CDC7600 computer code can accommodate 59 single particle states and vectors comprised of 30,000 Slater determinants. The effective interaction used was that of Petrovich, McManus, and Madsen, a modification of the Kallio-Kolltveit realistic force. Single particle energies, effective charges and effective g-factors were determined from experimental data for nuclei in the /sup 132/Sn region. 116 references.

  7. #YoSoy132: l’experiència dels nous moviments socials a Mèxic i el paper de les xarxes socials des d’una perspectiva crítica

    OpenAIRE

    Treré, Emiliano

    2013-01-01

    Aquest article aborda l’experiència del moviment social #YoSoy132, a partir de l’exploració del seu sorgiment en el context polític, social i mediàtic mexicà i de l’anàlisi de les seves característiques, demandes i paral·lelismes amb els nous moviments socials globals. A més, l’article problematitza el paper dels nous mitjans digitals –en particular de les xarxes socials– dins del moviment, trencant amb cinc narratives dominants en la literatura. Finalment, es realitza un balanç de l’abast i ...

  8. Subtelomeric study of 132 patients with mental retardation reveals 9 chromosomal anomalies and contributes to the delineation of submicroscopic deletions of 1pter, 2qter, 4pter, 5qter and 9qter

    DEFF Research Database (Denmark)

    Sogaard, Marie; Tümer, Zeynep; Hjalgrim, Helle

    2005-01-01

    BACKGROUND: Cryptic chromosome imbalances are increasingly acknowledged as a cause for mental retardation and learning disability. New phenotypes associated with specific rearrangements are also being recognized. Techniques for screening for subtelomeric rearrangements are commercially available...... dysmorphic features. Five had imbalances leading to recognizable phenotypes. CONCLUSION: Subtelomeric screening is a useful adjunct to conventional cytogenetic analyses, and should be considered in mentally retarded subjects with dysmorphic features and unknown cause......., allowing the implementation in a diagnostic service laboratory. We report the diagnostic yield in a series of 132 subjects with mental retardation, and the associated clinical phenotypes. METHODS: We applied commercially available subtelomeric fluorescence in situ hybridization (FISH). All patients...

  9. Cascade alkylarylation of substituted N-allylbenzamides for the construction of dihydroisoquinolin-1(2H-ones and isoquinoline-1,3(2H,4H-diones

    Directory of Open Access Journals (Sweden)

    Ping Qian

    2016-02-01

    Full Text Available An oxidative reaction for the synthesis of 4-alkyl-substituted dihydroisoquinolin-1(2H-ones with N-allylbenzamide derivatives as starting materials has been developed. The radical alkylarylation reaction proceeds through a sequence of alkylation and intramolecular cyclization. The substituent on the C–C double bond was found to play a key role for the progress of the reaction to give the expected products with good chemical yields. Additionally, N-methacryloylbenzamides were also suitable substrates for the current reaction and provided the alkyl-substituted isoquinoline-1,3(2H,4H-diones in good yield.

  10. Pre- and post-operative sagittal balance in idiopathic scoliosis: a comparison over the ages of two cohorts of 132 adolescents and 52 adults.

    Science.gov (United States)

    Roussouly, Pierre; Labelle, Hubert; Rouissi, Jihane; Bodin, Arnaud

    2013-03-01

    Retrospective study of a prospective clinical and radiological database of subjects with adolescent (AIS) and adult (AS) idiopathic scoliosis undergoing surgical correction by posterior approach. To evaluate the differences in sagittal alignment of the spine and pelvis in AIS and AS before surgery and changes after surgery in both populations. The relationship between the spine and pelvis highly influences the sagittal balance in adults and adolescents. However, the sagittal alignment of the spine and pelvis before and after surgery in idiopathic scoliosis, whatever the age, is poorly defined in the literature. Clinical and radiological data were extracted from a prospective database of 132 AIS patients and 52 AS before and at last follow-up after surgical correction. Sagittal parameters were evaluated on AP and lateral radiographs using a custom software: pelvic incidence (PI), sacral slope (SS), pelvic tilt (PT), lumbar lordosis (LL), thoracic kyphosis (TK), C7 Barrey's ratio, spino-sacral angle (SSA). A new algorithm of combination of balance parameters was proposed to characterize and compare the various pathological spino-pelvic settings. Based on PI subdivision in high (55°), then on a range of PT indexed on PI giving the pelvis positioning (anteverted, normal or retroverted), the population was finally characterized by the C7 plumbline position with regard to the posterior edge of the sacrum and the center of the femoral heads, in balanced, slightly unbalanced and unbalanced. More specifically, the AIS study included the cervical shape alignment with cervical lordosis (CL) and sagittal thoracic profile assessment (hypo vs. normokyphotic). In AS, the study focused on thoraco-lumbar kyphosis (TLK) occurrence (LL length). Paired Student t tests were used for comparison (α = 0.02). Pre-operatively, in AIS there was a prevalence of lower PI (57 %). Whatever the PI, PT remained anteverted or normal. Positioning of C7 was much more unbalanced, forward of the

  11. KEDUDUKAN BPN RI DALAM MENGHADAPI PROBLEMATIK PUTUSAN NON-EXECUTABLE PENGADILAN TATA USAHA NEGARA TENTANG PEMBATALAN SERTIPIKAT HAK ATAS TANAH (ANOTASI PUTUSAN MAHKAMAH AGUNG RI NO. 158/PK/TUN/2011 TENTANG PEMBATALAN SERTIPIKAT HAK GUNA BANGUNAN NO. 132

    Directory of Open Access Journals (Sweden)

    Rani Arvita

    2016-06-01

    Full Text Available The existence of a lawsuit in court against the certificate is not a new thing anymore , given stelsel adopted in the system of land registration in Indonesia is negative stelsel positive tendency . If on the certificate that was sued earlier , based on court decisions that have permanent legal force ( inkracht van gewisjde should be revoked and canceled by the National Land Agency, but de facto the decision can not be implemented by the National Land Agency with some particular reason , then this is where the role of National Pertanahann Agency to be able to realize the judgment which can not be implemented as Non - Executable decision. In this study will answer perrmasalahan , namely : Why is the National Land Agency wants the Indonesian Supreme Court Decision 158 / PK / TUN / 2011 on Cancellation of Certificate Broking No. 132 on behalf of PT . TOP As the verdict of Non - Executable ?, How the National Land Agency Role In Delivering the Indonesian Supreme Court Decision 158 / PK / TUN / 2011 As a verdict of Non - Executable ? How Legal Certainty The winner of the Indonesian Supreme Court Decision 158 / PK / TUN / 2011 and the Justice and Legal Protection against the owner of Certificate Broking No. 132 Certificate of derivatives and their owners ? To address this problem used approach Legislation , Case Approach , Conceptual Approach , Approach Sociology of Law and Political Law. Based on the survey results revealed that : First , there are two main reasons why the National Land Agency wants the Supreme Court Decision No. 158 / PK / TUN / 2011 as Non - Executable ruling that reasons are normative juridical considerations and Juridical Technical . Pertimbangann normative juridical reason is that the decision of cancellation of the Certificate Broking No. 132 on behalf of PT . TOP is overdue / expired / verjaring , Ultra Petita and filed by the plaintiffs who do not have other interests and there is a decision in the administrative court ruling

  12. Female patient with autistic disorder, intellectual disability, and co-morbid anxiety disorder: Expanding the phenotype associated with the recurrent 3q13.2-q13.31 microdeletion.

    Science.gov (United States)

    Quintela, Ines; Gomez-Guerrero, Lorena; Fernandez-Prieto, Montse; Resches, Mariela; Barros, Francisco; Carracedo, Angel

    2015-12-01

    In recent years, the advent of comparative genomic hybridization (CGH) and single nucleotide polymorphism (SNP) arrays and its use as a first genetic test for the diagnosis of patients with neurodevelopmental phenotypes has allowed the identification of novel submicroscopic chromosomal abnormalities (namely, copy number variants or CNVs), imperceptible by conventional cytogenetic techniques. The 3q13.31 microdeletion syndrome (OMIM #615433) has been defined as a genomic disorder mainly characterized by developmental delay, postnatal overgrowth, hypotonia, genital abnormalities in males, and characteristic craniofacial features. Although the 3q13.31 CNVs are variable in size, a 3.4 Mb recurrently altered region at 3q13.2-q13.31 has been recently described and non-allelic homologous recombination (NAHR) mediated by flanking human endogenous retrovirus (HERV-H) elements has been suggested as the mechanism of deletion formation. We expand the phenotypic spectrum associated with this recurrent deletion performing the clinical description of a 9-year-old female patient with autistic disorder, total absence of language, intellectual disability, anxiety disorder and disruptive, and compulsive eating behaviors. The array-based molecular karyotyping allowed the identification of a de novo recurrent 3q13.2-q13.31 deletion encompassing 25 genes. In addition, we compare her clinical phenotype with previous reports of patients with neurodevelopmental and behavioral disorders and proximal 3q microdeletions. Finally, we also review the candidate genes proposed so far for these phenotypes. © 2015 Wiley Periodicals, Inc.

  13. Signature inversion in πh{sub 11/2} x νi{sub 13/2} band of {sup 152}Eu and {sup 154,156}Tb

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sushil [Akal University, Department of Physics, Talwandi Sabo (India); Maharishi Markandeshwar University, Department of Physics, Mullana (India); Singh, Sukhjeet [Akal University, Department of Physics, Talwandi Sabo (India); Sharma, Vandana; Sharma, J.K. [Maharishi Markandeshwar University, Department of Physics, Mullana (India)

    2017-04-15

    The phenomenon of signature inversion observed in the πh{sub 11/2} x νi{sub 13/2} band of {sup 152}Eu and {sup 156}Tb nuclides is revisited through the axially symmetric two quasiparticle plus rotor model approach. The magnitude of experimentally observed signature splitting and point of signature inversion, which could not be explicitly reproduced in the earlier calculations, is successfully reproduced in the present study. Some of the critical issues, such as violation of the well-established Gallagher Moszkowski (GM) rule for eight GM doublets appearing in the basis space of earlier calculations of {sup 152}Eu and {sup 156}Tb, are fixed and also the ambiguity regarding spin assignment to this band observed in {sup 156}Tb is resolved. These calculations are further extended to the same band (πh{sub 11/2} x νi{sub 13/2}) observed in {sup 154}Tb nuclide and signature inversion observed in this band is successfully reproduced. (orig.)

  14. Fibrose pulmonar idiopática: características clínicas e sobrevida em 132 pacientes com comprovação histológica Pulmonary idiopathic fibrosis: clinical findings and survival in 132 histologically-proven patients

    Directory of Open Access Journals (Sweden)

    ADALBERTO SPERB RUBIN

    2000-04-01

    Full Text Available Com o objetivo de avaliar as características clínicas e sobrevida de pacientes portadores de fibrose pulmonar idiopática, foram analisados 132 casos com confirmação histológica, internados no Pavilhão Pereira Filho entre 1970 e 1996. O diagnóstico foi realizado em 120 casos por biópsia a céu aberto e em 12 casos por biópsia transbrônquica. A idade média do grupo estudado foi de 56 anos; 78 eram do sexo masculino; 126 eram brancos e 6, negros. O tabagismo estava presente em 61 casos. A duração média dos sintomas antes do diagnóstico foi de 22,7 meses. O hipocratismo digital esteve presente em 75 pacientes e estertores teleinspiratórios foram verificados em 100 casos. Dispnéia só não foi constatada em dois pacientes e tosse esteve presente em 89 casos. As provas de função pulmonar apresentaram os seguintes valores médios: CVF, 62%; VEF1, 70%; DCO, 43,4%; CPT, 76,7%; PaO2, 67,3mmHg; PaCO2, 39,1mmHg e SaO2, 92,3%. O lavado broncoalveolar apresentou os seguintes valores médios: macrófagos, 83,8%; neutrófilos, 9,1%; linfócitos; 6,1% e eosinófilos, 0,6%. Na radiologia convencional de tórax, foi observado faveolamento em 79 casos, redução da capacidade pulmonar total em 107 e alargamento da traquéia intratorácica em 50. Na TC de tórax, o grau médio de profusão do padrão reticular foi de 42,3% e do padrão de granularidade, de 43,6%. O padrão histológico usual esteve presente em 128 casos, sendo apenas quatro pacientes portadores de padrão descamativo. Em 121 casos foram obtidas informações quanto à sobrevida em dezembro de 1997. A sobrevida média total desta série foi de 28 meses, sendo de 24 meses para os pacientes que foram a óbito. Os pacientes desta série apresentaram características associadas a um estágio avançado da doença. Este fato, mais a presença maciça de pacientes com padrão usual e a rígida seleção de casos muito provavelmente contribuíram para os resultados encontrados quanto

  15. Solvent hold tank sample results for MCU-17-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017): Quarterly Report

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-09-13

    A trend summary of four Solvent Hold Tank (SHT) monthly samples; MCU-16-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017) are reported. Analyses of the June SHT sample (MCU-17-141-149) indicated that the modifier (CS-7SB) and the extractant (MaxCalix) concentrations were slightly below (4% each) their nominal recommended levels (169,000 mg/L and 46,400 mg/L respectively). The suppressor (TiDG) level has decreased since the January 2017 measurement but has remained steady in the range of 666 to 705 mg/L, well above the minimum recommended level (479 mg/L), but below the nominal level. The “flat” trends observed in the TiDG, MaxCalix, modifier, and Gamma measurement are consistent with the solvent being idle since January 10, 2017.

  16. Diode-end-pumped Nd3+-doped oxyorthosilicate GYSO lasers operating on 4F3/2  →  4I13/2 transition

    Science.gov (United States)

    Guan, Xiaofeng; Zhou, Zhiyong; Huang, Xiaoxu; Xu, Bin; Xu, Huiying; Cai, Zhiping; Xu, Xiaodong; Li, Dongzhen; Xu, Jun

    2017-12-01

    We report on diode-pumped continuous-wave Nd:GdYSiO5 lasers, operating on the 4F3/2  →  4I13/2 transition around the 1.3 µm spectral domain, for the first time to our knowledge. In free-running laser operation, a maximum output power of up to 0.81 W can be obtained at 1357.45 nm with a corresponding slope efficiency of about 10.9%. Wavelength tuning is also realized by using an etalon with a tuning range of about 4 nm. The low-gain emission line at 1386.23 nm is explored with a maximum output power of 0.21 W and a slope efficiency of about 5.3%, using an output coupler coated in a particular way.

  17. RETRACTED: Granular and intergranular conduction in La{sub 1.32}Sr{sub 1.68}Mn{sub 2}O{sub 7} layered manganite system

    Energy Technology Data Exchange (ETDEWEB)

    Narjis, A., E-mail: NARJIS78@gmail.com [Research Group ESNPS, Physics department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco); El kaaouachi, A.; Dlimi, S. [Research Group ESNPS, Physics department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco); Biskupski, G. [Laboratoire de Spectroscopie Hertzienne LSH, Bâtiment P5, Université des Sciences et Technologies, de Lille I 59 655 Villeneuve d’Ascq Cedex (France); Daoudi, E.; Errai, M.; Sybous, A.; Limouny, L. [Research Group ESNPS, Physics department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco)

    2013-06-15

    This article has been retracted: please see Elsevier Policy on Article Withdrawal ( (http://www.elsevier.com/locate/withdrawalpolicy)). This article has been retracted at the request of the Editors. The authors have plagiarized part of a paper that had already appeared in J. Appl. Phys. 106, 093709 (2009); (10.1063/1.3256182) (6 pages): Title: Effects of pressure on charge transport and magnetic properties of La1.32Sr1.68Mn2O7 layered manganite by M. Kumaresavanji, M. S. Reis, Y. T. Xing, and M. B. Fontes. One of the conditions of submission of a paper for publication is that authors declare explicitly that their work is original and has not appeared in a publication elsewhere. Re-use of any data should be appropriately cited. As such this article represents a severe abuse of the scientific publishing system. The scientific community takes a very strong view on this matter and apologies are offered to readers of the journal that this was not detected during the submission process.

  18. Kinetics and Mechanism of the Pyridinolysis of (2R,4R,5S)-(+)-2-Chloro-3,4-dimethyl- 5-phenyl-1,3,2-oxazaphospholidine 2-Sulfide in Acetonitrile

    Energy Technology Data Exchange (ETDEWEB)

    Barai, Hasi Rani; Lee, Hai Whang [Inha University, Incheon (Korea, Republic of)

    2012-03-15

    The nucleophilic substitution reactions of (2R,4R,5S)-(+)-2-chloro-3,4-dimethyl-5-phenyl-1,3,2-oxazaphospholidine 2-sulfide with X-pyridines are investigated kinetically in acetonitrile at 5.0 .deg. C. The free energy relationships for substituent X variations in the nucleophiles exhibit biphasic concave upwards with a break point at X = 3-Ac. Unusual positive {rho}{sub X} (= +4.73) and negative {beta}{sub X} (= .0.75) values are obtained with the weakly basic pyridines, and rationalized by the isokinetic relationship with isokinetic temperature at t{sub ISOKINETIC} = 39.3 .deg. C. A concerted mechanism involving a change of nucleophilic attacking direction from a frontside attack with the strongly basic pyridines to a backside attack with the weakly basic pyridines is proposed on the basis of greater magnitudes of selectivity parameters ({rho}{sub X} = -6.15 and {beta}{sub X} = 1.11) with the strongly basic pyridines compared to those ({rho}{sub X} = 4.73 and {beta}{sub X} = -0.75) with the weakly basic pyridines

  19. [4,4‧-bi(1,3,2-dioxathiolane)] 2,2‧-dioxide: A novel cathode additive for high-voltage performance in lithium ion batteries

    Science.gov (United States)

    Lee, Sang Hyun; Yoon, Sukeun; Hwang, Eui-Hyung; Kwon, Young-Gil; Lee, Young-Gi; Cho, Kuk Young

    2018-02-01

    High-voltage operation of lithium-ion batteries (LIBs) is a facile approach to obtaining high specific energy density, especially for LiNi0·5Mn0·3Co0·2O2 (NMC532) cathodes currently used in mid- and large-sized energy storage devices. However, high-voltage charging (>4.3 V) is accompanied by a rapid capacity fade over long cycles due to severe continuous electrolyte decomposition and instability at the cathode surface. In this study, the sulfite-based compound, [4,4‧-bi(1,3,2-dioxathiolane)] 2,2‧-dioxide (BDTD) is introduced as a novel electrolyte additive to enhance electrochemical performances of alumina-coated NMC532 cathodes cycled in the voltage range of 3.0-4.6 V. X-ray photoelectron spectroscopy (XPS) and AC impedance of cells reveal that BDTD preferentially oxidizes prior to the electrolyte solvents and forms stable film layers on to the cathode surface, preventing increased impedance caused by repeated electrolyte solvent decomposition in high-voltage operation. The cycling performance of the Li/NMC532 half-cell using an electrolyte of 1.0 M LiPF6 in ethylene carbonate/ethyl methyl carbonate (3/7, in volume) can be improved by adding a small amount of BDTD into the electrolyte. BDTD enables the usage of sulfite-type additives for cathodes in high-voltage operation.

  20. 3,4-Dihydro-1,3-2H-benzoxazines: Novel reducing agents through one electron donation mechanism and their application as the formation of nano-metallic silver coating

    Energy Technology Data Exchange (ETDEWEB)

    Kaewvilai, Attaphon [Department of Materials Engineering, Faculty of Engineering, Kasetsart University, Chatuchak, Bangkok, 10900 (Thailand); Wattanathana, Worawat [Department of Chemistry, Faculty of Science, Kasetsart University, Chatuchak, Bangkok, 10900 (Thailand); Jongrungruangchok, Suchada [Department of Pharmaceutical Chemistry, Faculty of Pharmacy, Rangsit University, Pathumthani, 12000 (Thailand); Veranitisagul, Chatchai [Department of Material and Metallurgical Engineering, Faculty of Engineering, Rajamangala University of Technology Thanyaburi, Klong 6, Thanyaburi, Pathumthani, 12110 (Thailand); Koonsaeng, Nattamon [Department of Chemistry, Faculty of Science, Kasetsart University, Chatuchak, Bangkok, 10900 (Thailand); Laobuthee, Apirat, E-mail: fengapl@ku.ac.th [Department of Materials Engineering, Faculty of Engineering, Kasetsart University, Chatuchak, Bangkok, 10900 (Thailand)

    2015-11-01

    3,4-dihydro-1,3-2H-benzoxazines as novel one-electron donators for silver(I) ion into nano-metallic silver was firstly found and reported. The silver formation from nano-spherical particles to coral-like and dendrite-like structures was presented. With respect to the characterization results, the feasible reaction mechanism of the silver formation was proposed as an electron donated from benzoxazine to silver(I) ion, resulting in a radical cationic species of benzoxazine and silver(0). Based on this reduction process, a new approach for nano-silver coating on various surfaces such as fumed silica (SiO{sub 2}), titanium dioxide (TiO{sub 2}), carbon black (CB), chitosan (CS) including plastic sheet (polycarbonate, PC) and pellet (polyvinyl alcohol, PVA), was also revealed. Besides the nano-silver coated products were applied as antimicrobials fillers for Staphylococcus aureus ATCC 25923, Bacillus subtilis ATCC 6633, Micrococcus luteus ATCC 9341, Escherichia coli ATCC 25922, Pseudomonas aeruginosa ATCC 2785 and Candida albicans ATCC 10231. - Highlights: • Benzoxazines were discovered to be novel reducing agents for silver(I) ion. • The speculated mechanism of the one electron donation process was investigated. • Dendrite structure of silver was formed from spherical silver nanoparticles. • A new approach for nano metallic-silver coating on various surfaces was revealed. • The nano-silver coated products were applied as antimicrobials fillers.

  1. Ramadi 132-Kilovolt Substation Ramadi, Iraq

    Science.gov (United States)

    2009-01-27

    commissioned. On 30 November 2008, the USACE received an email from Areva , the vendor, that stated that the GIS casings were not opened. Areva’s worst...that if this is done, the commissioning of the system would need to be reviewed and the warranty time with Areva may be increased

  2. 40 CFR Appendix - Tables to Part 132

    Science.gov (United States)

    2010-07-01

    ... EPA recommends that metals criteria be expressed as dissolved concentrations (see appendix A, I.A.4... concentrations (see appendix A, I.A.4 for more information regarding metals criteria). (a) Chemical CCC(µg/L...

  3. Publications | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Labor dependence, income diversification, rural credit and agricultural production efficiency : case studies of smallholder coffee farms in the Cu Mgar district, Dak Lak province, Vietnam; research report (restricted access). Income diversification and degree of labor dependence negatively and significantly affected technical ...

  4. Experiment information: 132 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available of AIDS in HIV-1-infected individuals, and the CCR5 or CXCR4, which are used by HIV to gain entry into cell...s. This result may explain why AIDS takes longer to develop in HIV-1-infected individuals carrying the CCR2V64I mutation. 10466720

  5. 40 CFR 92.132 - Calculations.

    Science.gov (United States)

    2010-07-01

    ...)) CCH3CHOe=((2.774)(10−2) (CADE)(VAE)(Q)(TEF))/((VSE)(PB) CCH3CHOd=((2.774)(10−2) (CADA)(VAA)(Q)(TDF))/(VSA... concentration in dilution air, ppm. CADE=Concentration of DNPH derivative of acetaldehyde from dilute exhaust...

  6. Publications | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gains from trade facilitation accrue to large and small firms alike: all size classes of firms export more in response to improved trade facilitation. ... Two training workshops were conducted in knowledge sharing methods and in video documentation, with 42 participants attending; three meetings with potential members of the ...

  7. GPCR Interaction: 132 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available Lutropin ... LHR A Lutropin ... mLHR Experiment Signaling inactive hLHR mutants (D405N and Y546F), which is trafficked...localizes wild type hLHR and the constitutively active hLHR through the formation of hetero dimers. 19616090

  8. QTL Information Table: 132 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Physiological trait Source activity delta13 (2001 grain) RFLP C)Interval RIL IR72 I...R69093-41-3-2 C335 pha Laza, M.R., Kondo, M., Ideta, O., Barlaan, E., and Imbe, T. (2006). Identification of Quantitative Trai

  9. 40 CFR 440.132 - General definitions.

    Science.gov (United States)

    2010-07-01

    ..., removal, or recovery of metal ore is being conducted, except, with respect to surface mines, any area of... natural dissolution of uranium by ground waters, the incidental leaching of uranium by mine drainage, nor the rehabilitation of aquifiers and the monitoring of these aquifiers. (f) “Mill” is a preparation...

  10. 40 CFR 141.132 - Monitoring requirements.

    Science.gov (United States)

    2010-07-01

    ... least average residence time in the distribution system and representing the entire distribution system... quarter, taken at a point reflecting the maximum residence time in the distribution system, until the... treatment plant per quarter, taken at a point reflecting the maximum residence time in the distribution...

  11. 29 CFR 1910.132 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... encountered in a manner capable of causing injury or impairment in the function of any part of the body... boots; or (iii) Ordinary clothing, skin creams, or other items, used solely for protection from weather...

  12. Operation IVY. Joint Task Force 132, 1952

    Science.gov (United States)

    1985-09-01

    34 roport on Operation 13 i hereby cade a matter of z- scord and is afct2.ve upon reC~ipt. PaG3 2 - ’Jndor ?cLE.T:,paragraph 9, 2-nd line, c.,.ange the...objective of MIKE sot was to test by actual detonation the theory of design for a theranuclear reactiop. on a large scale, the results of which could be used...experiments were de- signrd to measure certain specific reactions in an effort to confirm the predictions of theories that went into the design of this

  13. 19 CFR 132.25 - Undeliverable shipment.

    Science.gov (United States)

    2010-04-01

    ... reasonable time, but not to exceed 30 days, the addressee fails to indicate to the port director an intention to receive delivery of the packages or a portion thereof in accordance with the notice on Customs Form 3509 which was sent to him by the port director, the importation shall be treated in the same...

  14. 6 CFR 13.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... representation, certification, affirmation, Document, record, or accounting or bookkeeping entry Made: (1) With... bid or proposal for a contract with the Authority, or any State, political subdivision of a State, or... contract or for such grant, loan, or Benefit, or if the Government will reimburse such State, political...

  15. 10 CFR 13.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... minimum rate of basic pay for grade GS-16 under the General Schedule. Statement means any representation..., political subdivision of a State, or other party, if the United States government provides any portion of... will reimburse such State, political subdivision, or party for any portion of the money or property...

  16. Contribution to the study of samarium-151 excited levels; Contribution a l'etude des niveaux excites du samarium-151

    Energy Technology Data Exchange (ETDEWEB)

    Locard, P. [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

    1967-07-01

    The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces transitions, nous avons donc entrepris des experiences de coincidences gamma-gamma (et de ''spectre de somme'') a l'aide d'un ensemble de spectrometrie a scintillation realise au laboratoire (chapitre 2). L'etude des intensites de ces coincidences (chapitre 3) nous amene a modifier le dernier schema propose: nous supprimons les niveaux a 405,5 et 650 keV, nous ajoutons des niveaux a 245,6 - 306,6 - 522 - 952 et 962 keV. Nous avons egalement verifie la multipolarite des principales transitions et mesure la duree de vie de certains des niveaux (chapitre 3) (nous trouvons une periode de 1,1 {+-} 0,5) nanoseconde pour le niveau a 167,7 keV). Le chapitre 4 est enfin consacre a la comparaison de nos resultats avec les predictions des differents modeles decrits au chapitre 1. (auteur)

  17. The proteosome inhibitor MG132 attenuates Retinoic Acid Receptor trans-activation and enhances trans-repression of Nuclear Factor κB. Potential relevance to chemo-preventive interventions with retinoids

    Directory of Open Access Journals (Sweden)

    Rosier Randy N

    2004-03-01

    Full Text Available Abstract Background Nuclear factor kappa B (NFκB is a pro-malignant transcription factor with reciprocal effects on pro-metastatic and anti-metastatic gene expression. Interestingly, NFκB blockade results in the reciprocal induction of retinoic acid receptors (RARs. Given the established property of RARs as negative regulators of malignant progression, we postulated that reciprocal interactions between NFκB and RARs constitute a signaling module in metastatic gene expression and malignant progression. Using Line 1 tumor cells as a model for signal regulation of metastatic gene expression, we investigated the reciprocal interactions between NFκB and RARs in response to the pan-RAR agonist, all-trans retinoic acid (at-RA and the pan-RAR antagonist, AGN193109. Results At-RA [0.1–1 μM] dose-dependently activated RAR and coordinately trans-repressed NFκB, while AGN193109 [1–10 μM] dose-dependently antagonized the effects of at-RA. At-RA and AGN193109 reciprocally regulate pro-metastatic matrix metalloprotease 9 (MMP 9 and its endogenous inhibitor, the tissue inhibitor of metalloprotease 1 (TIMP 1, in a manner consistent with the putative roles of NFκB and RAR in malignant progression. Activation of RAR concurs with its ubiquitination and proteosomal degradation. Accordingly, the proteosome inhibitor, MG132 [5 μM], blocked RAR degradation, quelled RAR trans-activation and enhanced RAR trans-repression of NFκB. Conclusion We conclude that reciprocal interactions between NFκB and RARs constitute a signaling module in metastatic gene expression and malignant progression and propose that the dissociative effect of proteosome inhibitors could be harnessed towards enhancing the anticancer activity of retinoids.

  18. Areva excellent business volume: backlog as of december 31, 2008: + 21.1% to 48.2 billion euros. 2008 revenue: + 10.4% to 13.2 billion euros; Areva excellent niveau d'activite: carnet de commandes au 31/12/2008: + 21,1% a 48,2 Mds d'euros. Chiffre d'affaires de l'exercice 2008: + 10,4% a 13,2 Mds d'euros

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-07-01

    AREVA's backlog stood at 48.2 billion euros as of December 31, 2008, for 21.1% growth year-on-year, including 21.8% growth in Nuclear and 16.5% growth in Transmission and Distribution. The Nuclear backlog came to 42.5 billion euros at December 31, 2008. The Transmission and Distribution backlog came to 5.7 billion euros at year-end. The group recognized revenue of 13.2 billion euros in 2008, for year-on-year growth of 10.4% (+9.8% like-for-like). Revenue outside France was up 10.5% to 9.5 billion euros, representing 72% of total revenue. Revenue was up 6.5% in the Nuclear businesses (up 6.3% LFL), with strong performance in the Reactors and Services division (+10.9% LFL) and the Front End division (+7.2% LFL). The Transmission and Distribution division recorded growth of 17% (+15.8% LFL). Revenue for the fourth quarter of 2008 rose to 4.1 billion euros, up 5.2% (+1.6% LFL) from that of the fourth quarter of 2007. Revenue for the Front End division rose to 3.363 billion euros in 2008, up 7.1% over 2007 (+7.2% LFL). Foreign exchange (currency translations) had a negative impact of 53 million euros. Revenue for the Reactors and Services division rose to 3.037 billion euros, up 11.8% over 2007 (+10.9% LFL). Foreign exchange (currency translations) had a negative impact of 47 million euros. Revenue for the Back End division came to 1.692 billion euros, a drop of 2.7% (-2.5% LFL). Foreign exchange (currency translations) had a negative impact of 3.5 million euros. Revenue for the Transmission and Distribution division rose to 5.065 billion euros in 2008, up 17.0% (+15.8% LFL)

  19. LMNA Sequences of 60,706 Unrelated Individuals Reveal 132 Novel Missense Variants in A-Type Lamins and Suggest a Link between Variant p.G602S and Type 2 Diabetes

    Directory of Open Access Journals (Sweden)

    Alyssa Florwick

    2017-06-01

    Full Text Available Mutations in LMNA, encoding nuclear intermediate filament proteins lamins A and C, cause multiple diseases (‘laminopathies’ including muscular dystrophy, dilated cardiomyopathy, familial partial lipodystrophy (FPLD2, insulin resistance syndrome and progeria. To assess the prevalence of LMNA missense mutations (‘variants’ in a broad, ethnically diverse population, we compared missense alleles found among 60,706 unrelated individuals in the ExAC cohort to those identified in 1,404 individuals in the laminopathy database (UMD-LMNA. We identified 169 variants in the ExAC cohort, of which 37 (∼22% are disease-associated including p.I299V (allele frequency 0.0402%, p.G602S (allele frequency 0.0262% and p.R644C (allele frequency 0.124%, suggesting certain LMNA mutations are more common than previously recognized. Independent analysis of LMNA variants via the type 2 diabetes (T2D Knowledge Portal showed that variant p.G602S associated significantly with type 2 diabetes (p = 0.02; odds ratio = 4.58, and was more frequent in African Americans (allele frequency 0.297%. The FPLD2-associated variant I299V was most prevalent in Latinos (allele frequency 0.347%. The ExAC cohort also revealed 132 novel LMNA missense variants including p.K108E (limited to individuals with psychiatric disease; predicted to perturb coil-1B, p.R397C and p.R427C (predicted to perturb filament biogenesis, p.G638R and p.N660D (predicted to perturb prelamin A processing, and numerous Ig-fold variants predicted to perturb phenotypically characteristic protein–protein interactions. Overall, this two-pronged strategy— mining a large database for missense variants in a single gene (LMNA, coupled to knowledge about the structure, biogenesis and functions of A-type lamins— revealed an unexpected number of LMNA variants, including novel variants predicted to perturb lamin assembly or function. Interestingly, this study also correlated novel variant p.K108E with psychiatric

  20. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    Administrator

    Key Laboratory for Special Functional Aggregate Materials of Education Ministry,. School of Chemistry and Chemical ... been flourishing since its excellent electric properties were discovered in the 1980s.1 At present SDC is ... absolute ethanol three times and dried in an electric oven at 60°C overnight, and then calcined at ...

  1. Trichloridotris{N-[phenyl(pyridin-2-ylmethylidene]hydroxylamine-κ2N,N′}samarium(III

    Directory of Open Access Journals (Sweden)

    Yahong Li

    2012-03-01

    Full Text Available The SmIII ion in the title compound, [SmCl3(C12H10N2O3], shows a coordination number of nine with a slightly distorted tricapped trigonal prismatic geometry based on a Cl3N6 donor set. The molecular structure is stabilized by three intramolecular O—H...Cl hydrogen bonds.

  2. Biological studies of samarium-153 bleomycin complex in human breast cancer murine xenografts for therapeutic applications

    Energy Technology Data Exchange (ETDEWEB)

    Bahrami-Samani, A. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Ghannadi-Maragheh, M. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran); Jalilian, A.R.; Mazidi, M. [Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran)

    2010-07-01

    In this work, a potential therapeutic DNA targeting agent, {sup 153}Sm-bleomycin complex ({sup 153}Sm-BLM), was developed and the tumor accumulation studies were performed using single photon emission computed tomography (SPECT) and scarification studies. {sup 153}Sm-BLM was prepared at optimized conditions (room temperature, 4-8 h, 0.1 mg bleomycin for 740-3700 MBq {sup 153}SmCl{sub 3}, radiochemical purity over 98%, HPLC, specific activity = 55 TBq/mmol). {sup 153}Sm-BLM was administered into human breast cancer murine xenografts and the biodistribution and imaging studies were performed up to 48 h. {sup 153}Sm-BLM demonstrated superior tumor accumulation properties in contrast with the other radiolabeled bleomycins with tumor:blood ratios of 41, 72 and 182 at 4, 24 and 48 h, respectively, and tumor:muscle ratios of 23, 33 and > 1490 at 4, 24 and 48 h, respectively, while administered intravenously. The SPECT images also demonstrated the obvious tumor uptake at the chest region of the breast-tumor bearing mice. These initial experiments demonstrate significant accumulation of {sup 153}Sm-BLM in tumor tissues. (orig.)

  3. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    CSIR Research Space (South Africa)

    Mandiwana, V

    2015-09-01

    Full Text Available .63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems...

  4. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    National Research Council Canada - National Science Library

    Gangu, Kranthi Kumar; Maddila, Suresh; Maddila, Surya Narayana; Jonnalagadda, Sreekantha B

    2016-01-01

    ...) and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp) were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine...

  5. Samarium(III) picrate tetraethylene glycol complex: Photoluminescence study and active material in monolayer electroluminescent

    Energy Technology Data Exchange (ETDEWEB)

    Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I. [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Za' aba, Noor K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)

    2011-09-15

    A mononuclear Sm(III) complex involving Pic and EO4 (where Pic=picrate anion and EO4=tetraethylene glycol) has been studied. It shows a bright-orange emission when used as active material in a monolayer electroluminescent device of ITO/EO4-Sm-Pic/Al. The crystal structure of the complex consists of [Sm(Pic){sub 2}(H{sub 2}O)(EO4)]{sup +} cation and [Pic]{sup -} anion. The Sm(III) ion is coordinated with nine oxygen atoms from one EO4 ligand in a pentadentate mode, two Pic anions each in bidentate and monodentate modes, and one water molecule. Both the terminal alcohol groups of the acyclic EO4 ligand were involved in the O-H...O hydrogen bonding by infinite one-dimensional (1D) chain within a symmetry direction [0 1 0]. The photoluminescence (PL) spectrum of the thin film shows the typical spectral features of the Sm(III) ion ({sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} transitions). The root-mean-square (rms) of the roughness of thin film is 30.605 nm and indicates that the formation of the monolayer electroluminescent device is not uniform and retains a high crystallinity. Typical semiconductor current-voltage (I-V) property was also observed in this device with threshold and turn voltages of 2.8 and 6.2 V, respectively. The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex can be applied as a luminescent center in OLED for bright-orange emission. - Highlights: > The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in monolayer device structure of ITO/EO4-Sm-Pic/Al. > The photoluminescence spectrum of the crystalline and thin film shows a bright-orange emission. > The current-voltage property showed the turn on voltage of 6.2 V.

  6. Pulsed laser deposition and optical characterizations of the magnetic samarium orthoferrite

    Energy Technology Data Exchange (ETDEWEB)

    Berini, Bruno, E-mail: bruno.berini@uvsq.fr [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France); Mistrik, Jan [Institute of Applied Physics and Mathematics, Faculty of Chemical Technology, University of Pardubice, Studentska 84, 532 10 Pardubice (Czech Republic); Dumont, Yves; Popova, Elena; Fouchet, Arnaud; Scola, Joseph; Keller, Niels [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France)

    2012-01-01

    Pulsed Laser Deposition of magnetically ordered polycrystalline SmFeO{sub 3} films has been optimized onto SiO{sub 2} glass substrates as function of substrate temperature, oxygen pressure and pulsed laser fluency. Using a KrF excimer laser, crystallization temperature is found to be about 1048 K for a weak fluency of only 1.7 J cm{sup -2}. We show that this growth temperature can be reduced using higher fluency and that it is possible to obtain a film texturation along the c axis by reducing the oxygen pressure at given temperature and fluency. In a second part, we focus on the SmFeO{sub 3} optical constants determined by in situ ellipsometry using a stacking model and the Cauchy dispersion relation for SmFeO{sub 3} layer. We show a good correlation between the transmission and reflection calculated from these data and measured by ex situ spectrophotometry in the visible range.

  7. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    Directory of Open Access Journals (Sweden)

    Kranthi Kumar Gangu

    2016-09-01

    Full Text Available An investigation was conducted into the influence of the amino acids as organic modifiers in the facile synthesis of metal incorporated fluorapatites (FAp and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine. The materials were characterized by various techniques including X-ray diffraction (XRD, Fourier transform infra-red spectroscopy (FT-IR, field emission scanning electron microscopy (FE-SEM, energy-dispersive X-ray spectroscopy (EDX, high resolution transmission electron microscopy (HR-TEM, N2-adsorption/desorption isotherm, temperature programmed desorption (TPD and fluorescence spectrophotometry. Under similar conditions, Sm-FAp prepared using different amino acids exhibited distinctly different morphological structures, surface area and pore properties. Their activity as catalysts was assessed and Sm-FAp/Glycine displayed excellent efficiency in the synthesis of 1,2,4-triazole catalyzing the reaction between 2-nitrobenzaldehyde and thiosemicarbazide with exceptional selectivity and 98% yield in a short time interval (10 min. The study provides an insight into the role of organic modifiers as controllers of nucleation, growth and aggregation which significantly influence the nature and activity of the catalytic sites on Sm-FAp. Sm-FAp could also have potential as photoactive material.

  8. Body composition analysis by DEXA by using dynamically changing samarium filtration

    DEFF Research Database (Denmark)

    Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

    1997-01-01

    , which depends on the current-absorber thickness. With this system we found a good agreement (r = 0.99) between reference and measured amounts of tissue or fat percentages in a plastic phantom and in smaller (approximately 0.5-4 kg) and larger (approximately 5-20 kg) piles of tissue (ox muscle and lard......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

  9. Synthesis, thermal and photoluminescent properties of ZnSe- based oxyfluoride glasses doped with samarium

    Science.gov (United States)

    Kostova, I.; Okada, G.; Pashova, T.; Tonchev, D.; Kasap, S.

    2014-12-01

    Rare earth (RE) doped glasses and glass ceramic materials have recently received considerable attention because of their potential or realized applications as X-ray intensifying screens, phosphors, detectors, waveguides, lasers etc. [1]. In this work, we present a new RE doped ZnO-ZnSe-SrF2-P2O5-B2O3-Sm2O3-SmF3 (ZSPB) glass system synthesized by melt quenching technique. The resulting glasses were visually fully transparent and stable with glass the transition temperatures around 530°C. The thermal properties of this glass system were characterized by Modulated Differential Scanning Calorimetry (MDSC) measurements before and after annealing at 650°C. We have characterized these glasses by Raman spectroscopy and photoluminescence (PL) measurements over the UV-VIS range using light emitting diodes (LED) and laser diodes (LD) excitation sources. We have also irradiated thermally treated and non-treated glass samples by X-rays and have studied the resulting PL. We discuss the results in terms of previously reported models for Sm-doped Zn-borophosphate oxide, oxyfluoride and oxyselenide glasses.

  10. Laser-Induced Luminescence Study of Samarium(III) Thiodiglycolate Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Dong Yong; Lee, Eil Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kimura, Takaumi [Japan Atomic Energy Research Institute, Ibaraki-ken (Japan)

    2003-09-15

    The hydration number of Sm(III) has been obtained by using the difference in the decay rate constants in H{sub 2}O and D{sub 2}O solutions. In general, k{sub obs}(H{sub 2}O) >> k{sub obs}(D{sub 2}O), k{sub obs}(D{sub 2}O) ≅ constant, and ligands are not as effective in causing non-radiative de-excitation of the excited state. For Sm(III), a relationship has been proposed in which the hydration number is related directly to the decay rate constant in H{sub 2}O. If there is no contribution from the ligand to the de-excitation of the luminescence excited state, the hydration of Sm(III) in the different complexes can be obtained directly from the values of k{sub obs} measured in H{sub 2}O. The number and the geometric distribution of solvent molecules around a metal ion in solution are an important factor in the structural and chemical behavior of cation. Indeed, such information has been utilized to design novel ionophores and receptors. However, there have been few studies of hydration structure for lanthanides. The fact that many f-element salts which have relatively large lattice energies are fairly soluble in water is a reflection of the strength of the interactions between the metal cations and water molecules.

  11. Oxygen Fugacity of the Martian Mantle from Pigeonite/Melt Partitioning of Samarium, Europium and Gadolinium

    Science.gov (United States)

    Musselwhite, S.; Jones, J. H.; Shearer, C.

    2004-01-01

    This study is part of an ongoing effort to calibrate the pyroxene/melt Eu oxybarometer for conditions relevant to the martian meteorites. There is fairly good agreement between a determinations using equilibria between Fe-Ti oxides and the estimates from Eu anomalies in shergottite augites in tenns of which meteorites are more or less oxidized. The Eu calibration was for angrite composition pyroxenes which are rather extreme. However, application of a calibration for martian composition augites 113 does not significantly reduce the discrepancy between the two methods. One possible reason for this discrepancy is that augites are non-liquidus. The use of pigeonite rather than augite as the oxy-barometer phase is considered. We have conducted experiments on martian composition pigeonite/melt REE partitioning as a function of fO2.

  12. Doping controlled spin reorientation in dysprosium-samarium orthoferrite single crystals

    Science.gov (United States)

    Cao, Shixun; Zhao, Weiyao; Kang, Baojuan; Zhang, Jincang; Ren, Wei

    2015-03-01

    As one of the most important phase transitions, spin reorientation (SR) in rare earth transition metal oxides draws much attention of emerging materials technologies. The origin of SR is the competition between different spin configurations which possess different free energy. We report the control of spin reorientation (SR) transition in perovskite rare earth orthoferrite Dy1-xSmxFeO3, a whole family of single crystals grown by optical floating zone method from x =0 to 1. Temperature dependence of the magnetizations under zero-field-cooling (ZFC) and field-cooling (FC) processes are studied. We have found a remarkable linear change of SR transition temperature in Sm-rich samples for x>0.2, which covers an extremely wide temperature range including room temperature. The a-axis magnetization curves under FCC process bifurcate from and then jump down to that of warming process (ZFC and FCW curves) in single crystals when x =0.5-0.9, suggesting complicated 4f-3d electron interactions among Dy3+-Sm3+, Dy3+-Fe3+, and Sm3+-Fe3+ sublattices of diverse magnetic configurations for materials physics and design. The magnetic properties and the doping effect on SR transition temperature in these single crystals might be useful in the spintronics device application. This work is supported by the National Key Basic Research Program of China (Grant No. 2015CB921600), and the National Natural Science Foundation of China (NSFC, Nos. 51372149, 50932003, 11274222).

  13. Synthesis, crystal structure and luminescent properties of a new samarium-fluorescein metal-organic framework

    Science.gov (United States)

    Thomas, Jesty; Ambili, K. S.

    2015-10-01

    A new metal-organic framework with empirical formula C43H30NO12Sm was solvothermally synthesized using SmCl3, fluorescein and N, N-Dimethyl formamide (DMF) and characterized by single crystal X-ray diffraction, powder X-ray diffraction, infrared spectroscopy, UV-Visible spectroscopy, scanning electron microscopy, optical microscopy, photoluminescence spectroscopy, CHN elemental analysis and thermogravimetric analysis. Single crystal X-ray diffraction revealed that the crystal structure belongs to the triclinic system, P-1 space group with a = 12.113 (6) Å, b = 12.1734 (7) Å, c = 13.2760(8) Å, α = 67.930(3)⁰, β = 87.779(3)⁰, γ = 77.603(3)⁰ and V = 1769.71 (17) Å3. The photoluminescence spectrum showed emission peaks at 550 nm, 600 nm and 647 nm due to the characteristic transitions 4G5/2 to 6H5/2, 4G5/2 to 6H7/2 and 4G5/2 to 6H9/2 respectively, when excited at 398 nm.

  14. High-temperature heat capacity of samarium and erbium titanates with pyrochlore structure

    Science.gov (United States)

    Denisova, L. T.; Chumilina, L. G.; Denisov, V. M.; Ryabov, V. V.

    2017-12-01

    Titanates Sm2Ti2O7 and Er2Ti2O7 with pyrochlore structure have been prepared by solid-phase synthesis in air from stoichiometric Sm2O3 (Er2O3)-TiO2 mixtures sequentially at 1673 and 1773 K. Hightemperature heat capacity of the oxide compounds has been determined by differential scanning calorimetry. Their thermodynamic properties have been calculated from experimental temperature dependence C p = f( T).

  15. El movimiento #YoSoy132 en Xalapa (México): la construcción de la acción colectiva y el estado de la participación en un contexto local de heterogeneidad y conflicto social

    OpenAIRE

    Chaguaceda Noriega, Armando; Ortega Sánchez,Héctor Manuel

    2015-01-01

    El objetivo de este texto es analizar –a partir de la combinación de un trabajo etnográfico y la utilización de un modelo analítico específico– el complejo proceso de construcción de la acción colectiva y la participación del movimiento #YoSoy132 en Xalapa (México). En la primera parte se menciona de manera general al movimiento nacional para enseguida exponer algunas particularidades a nivel local. Posteriormente se plantean las aproximaciones teóricas que explican a nivel ...

  16. High-spin structures in Xe132 and Xe133 and evidence for isomers along the N=79 isotones

    Energy Technology Data Exchange (ETDEWEB)

    Vogt, A.; Siciliano, M.; Birkenbach, B.; Reiter, P.; Hadyńska-Klęk, K.; Wheldon, C.; Valiente-Dobón, J. J.; Teruya, E.; Yoshinaga, N.; Arnswald, K.; Bazzacco, D.; Blazhev, A.; Bracco, A.; Bruyneel, B.; Chakrawarthy, R. S.; Chapman, R.; Cline, D.; Corradi, L.; Crespi, F. C. L.; Cromaz, M.; de Angelis, G.; Eberth, J.; Fallon, P.; Farnea, E.; Fioretto, E.; Fransen, C.; Freeman, S. J.; Fu, B.; Gadea, A.; Gelletly, W.; Giaz, A.; Görgen, A.; Gottardo, A.; Hayes, A. B.; Hess, H.; Hetzenegger, R.; Hirsch, R.; Hua, H.; John, P. R.; Jolie, J.; Jungclaus, A.; Karayonchev, V.; Kaya, L.; Korten, W.; Lee, I. Y.; Leoni, S.; Liang, X.; Lunardi, S.; Macchiavelli, A. O.; Menegazzo, R.; Mengoni, D.; Michelagnoli, C.; Mijatović, T.; Montagnoli, G.; Montanari, D.; Müller-Gatermann, C.; Napoli, D.; Pearson, C. J.; Podolyák, Zs.; Pollarolo, G.; Pullia, A.; Queiser, M.; Recchia, F.; Regan, P. H.; Régis, J. -M.; Saed-Samii, N.; Şahin, E.; Scarlassara, F.; Seidlitz, M.; Siebeck, B.; Sletten, G.; Smith, J. F.; Söderström, P. -A.; Stefanini, A. M.; Stezowski, O.; Szilner, S.; Szpak, B.; Teng, R.; Ur, C.; Warner, D. D.; Wolf, K.; Wu, C. Y.; Zell, K. O.

    2017-08-01

    The transitional nuclei 132 Xe and 133 Xe are investigated after multinucleon-transfer (MNT) and fusion-evaporation reactions. Both nuclei are populated (i) in 136 Xe + 208 Pb MNT reactions employing the high-resolution Advanced GAmma Tracking Array (AGATA) coupled to the magnetic spectrometer PRISMA, (ii) in the 136 Xe + 198 Pt MNT reaction employing the GAMMASPHERE spectrometer in combination with the gas-detector array CHICO, and (iii) as an evaporation residue after a 130 Te ( α , x n ) 134 - x n Xe fusion-evaporation reaction employing the HORUS γ -ray array at the University of Cologne. The high-spin level schemes are considerably extended above the J π = ( 7 - ) and ( 10 + ) isomers in 132 Xe and above the 11 / 2 - isomer in 133 Xe . The results are compared to the high-spin systematics of the Z = 54 as well as the N = 78 and N = 79 chains. Furthermore, evidence is found for a long-lived ( T 1 / 2 >> 1 μ s ) isomer in 133 Xe which closes a gap along the N = 79 isotones. Shell-model calculations employing the SN100PN and PQM130 effective interactions reproduce the experimental findings and provide guidance to the interpretation of the observed high-spin features.

  17. O movimento #YoSoy132 em Xalapa (México: a construção de uma ação coletiva e condição de participação em um contexto local de heterogeneidade e conflito social

    Directory of Open Access Journals (Sweden)

    Armando Chaguaceda Noriega

    2015-11-01

    Full Text Available El objetivo de este texto es analizar –a partir de la combinación de un trabajo etnográfico y la utilización de un modelo analítico específico– el complejo proceso de construcción de la acción colectiva y la participación del movimiento #YoSoy132 en Xalapa (México. En la primera parte se menciona de manera general al movimiento nacional para enseguida exponer algunas particularidades a nivel local. Posteriormente se plantean las aproximaciones teóricas que explican a nivel conceptual dicho trabajo y finalmente se analiza la acción colectiva y el estado de la participación tomando en cuenta las relaciones sociales internas del movimiento.

  18. Intense near-infrared and midinfrared luminescence from the Dy3+-doped GeSe2-Ga2Se3-MI (M=K, Cs, Ag) chalcohalide glasses at 1.32, 1.73, and 2.67 μm

    Science.gov (United States)

    Ren, Jing; Wagner, Tomas; Bartos, Miroslav; Frumar, Miloslav; Oswald, Jiri; Kincl, Miloslav; Frumarova, Bozena; Chen, Guorong

    2011-02-01

    The intense 1.32, 1.73, and 2.67 μm near-infrared and midinfrared emissions were observed from the Dy3+-doped GeSe2-Ga2Se3-MI (M=K, Cs, Ag) chalcohalide glasses. These glasses are red light transparent therefore can be pumped by a semiconductor lasers operating at ˜808 nm. The 2.67 μm emission has not been reported yet which corresponds to an absorption minimum in fluoride fibers and can be very useful for long distance communications. The intensity of emissions is very sensitive to the local chemical environment of Dy3+ ions embedded in these metal halide modified glasses. A plausible correspondence between the emission intensity and the average oscillator strength was found.

  19. Decay of {sup 185}Tl, {sup 185m+g}Hg, {sup 189m+g}Pb and energy location of the 13/2{sup +} isomeric states in {sup 185}Hg, {sup 189}Pb, {sup 193}Po and {sup 197}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Sauvage, J.; Roussiere, B.; Franchoo, S.; Barre, N.; Bourgeois, C.; Clavelin, J.F.; Grave, X.; Kilcher, P.; Oms, J. [IN2P3-CNRS/Universite Paris-Sud, Institut de Physique Nucleaire, Orsay Cedex (France); Genevey, J. [IN2P3-CNRS/Universite Joseph Fourier, Laboratoire de Physique Subatomique et de Cosmologie, Grenoble Cedex (France); Andreyev, A.N. [University of York, Department of Physics, York (United Kingdom); Ben Braham, A. [Faculte des sciences de Tunis, Tunis (Tunisia); Witte, H. de; Huyse, M.; Mukha, I.; Vel, K.V. de; Duppen, P. van [Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Fedorov, D.V.; Volkov, Yu.M. [Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Fedoseyev, V.N.; Marsh, B.A. [ISOLDE, CERN, Geneve (Switzerland); Fraile, L.M. [Universidad Complutense, Grupo de Fisica Nuclear, Madrid (Spain); Huber, G. [Johannes Gutenberg Universitaet, Institut fuer Physik, Mainz (Germany); Koester, U. [Institut Laue-Langevin, Grenoble Cedex 9 (France); Kunz, P. [TRIUMF, Vancouver (Canada); Lesher, S.R. [University of Wisconsin-La Crosse, La Crosse (United States); Porquet, M.G. [Centre de Sciences Nucleaires et de Sciences de la Matiere, Orsay (France); Seliverstov, M. [Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Johannes Gutenberg Universitaet, Institut fuer Physik, Mainz (Germany); Stefanescu, I. [Technische Universitaet Muenchen, Forschungs-Neutronenquelle Heinz Maier-Leibnitz, Garching (Germany); Wojtasiewicz, A. [University of Warsaw, Institute of Experimental Physics, Warsaw (Poland)

    2013-09-15

    The {beta}{sup +} /EC decay of {sup 185}Tl was studied at the ISOLDE facility, the {gamma} -rays belonging to {sup 185}Hg have been identified and a partial low-spin level scheme of {sup 185}Hg has been built. The decay of {sup 185m+g}Hg was studied at the ISOCELE facility. Conversion electron lines of very low-energy transitions were observed for the first time. Electron data have been obtained for four transitions in {sup 185}Au and two transitions in {sup 185}Hg. From the analysis performed using an internal energy calibration procedure the energy location of the {sup 185m}Hg has been determined to be E{sub IS}= 103.7(4) keV. This E{sub IS} value is consistent with that determined independently, E{sub IS}=94(13) keV, using {sup 185m+g}Hg {alpha} -decay data from literature. New {alpha} particles emitted from {sup 189m+g}Pb have been detected and their origins determined by in-source laser spectroscopy at the ISOLDE facility. {alpha} - {gamma} coincidence results have served to locate the 13/2{sup +} isomeric state of {sup 189}Pb at E{sub IS}=40(4) keV. This latter E{sub IS} value added to {alpha} -decay data from literature have allowed the energy location of the 13/2{sup +} isomeric states of {sup 193}Po and {sup 197}Rn at 95(7)keV and 194(12)keV, respectively. The nuclear structure of the isomeric and ground states in the nuclei of the three {alpha} -emitter chains starting with {sup 195m+g,} {sup 197m+g,} {sup 199m+g}Rn are discussed. (orig.)

  20. Dicty_cDB: SFD132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf70a03.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-1541 5' similar to TR:P93358...sac08f03.y1 Gm-c1040 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1040-4086 5' similar to SW:ERP5_MEDSA...sj98c05.y1 Gm-c1023 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1023-2625 5' similar to SW:ERP5_MEDSA...si40c04.y1 Gm-r1030 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-r1030-1375 5' similar to TR:P93358

  1. Dicty_cDB: VHC132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LNYEGIDAK LKQFXLHHNKPLTLA--- ---GHLDNISNXMLXGXINFENGKXNAVFNQFXGEIGPVPTVGCEYKKXGVXWXVVGDEX XGEGXFCEXX...sttkvlmln *nnsxsittnhspll--- ---GHLDNISNXMLXGXINFENGKXNAVFNQFXGEIGPVPTVGCEYKKXGVXWXVVGDEX XGEGXFCEXX

  2. Dicty_cDB: VSG132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) EST from adult infected midgut library, clone Tse38d05_q1c. 52 2e-09 2 BX564787 |BX564787.1 Glossina morsi...na morsitans morsitans (Tseatse fly) EST from adult infected midgut library, clone Tse3e12_q1c. 46 6e-08 2 B

  3. Dicty_cDB: CFD132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kvfhqinnvsfslvnn*kmvvlxc *lqhckrnatxxi*xxxx Translated Amino Acid sequence (All Frames) Frame A: fty*limqifv...itlkmskpkfktkkvfhqinkd*fslvnn*kmvvlslttifkrnplsi*fsd* evvcksllkl*qvklspwkskvvitlkmlkpksktkkvfhqinnvsfslvnn*kmvvlxc *lqhckrnatx

  4. 7 CFR 457.132 - Cranberry crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... if you are unable to market due to quarantine, boycott, or refusal of any person to accept production... abandon or no longer care for, if you and we agree on the appraised amount of production. Upon such... use the appraised amount of production or defer the claim if you agree to continue to care for the...

  5. 12 CFR 308.132 - Assessment of penalties.

    Science.gov (United States)

    2010-01-01

    ... violation, practice, or breach continues. (x) Civil money penalties assessed pursuant to the International Banking Act of 1978. Pursuant to the International Banking Act of 1978 (IBA) (12 U.S.C. 3108(b)), civil... paragraph (c)(3)(i) of this section. (xii) Civil money penalties assessed pursuant to International Lending...

  6. 26 CFR 1.132-4 - Line of business limitation.

    Science.gov (United States)

    2010-04-01

    ... Budget. An employer is considered to have more than one line of business if the employer offers for sale...; hotels and other lodging places; auto repair, services, and garages; and food stores. (3) Aggregation of...

  7. FCJ-132 Towards a Performative Aesthetics of Interactivity

    Directory of Open Access Journals (Sweden)

    Simon Penny

    2011-12-01

    Full Text Available This paper places contemporary modalities of digital interaction in an historical context of sixty years of intersections between technological development and artistic experimentation. Specific technological developments are identified as context-defining historical markers and specific works are discussed as exemplars of significant milestones in the engineering and the aesthetics of interaction. The shortage of theorisation of non-instrumental interaction is lamented. The process of naturalisation to increasingly sophisticated digital tools and appliances in the current period of ubiquitous computing is noted. A number of theoretical issues are drawn out and discussed in terms of cognitive and sensorimotor dynamics. Woven through the discussion is the proposal that a synthesis of performance theory and neuro-cognitive studies might provide a basis for a performative ontology around which an aesthetics of interaction might be constructed. As the paper progresses a theoretical framework for an ontologically performative aesthetics of interaction and ubiquity is formulated.

  8. 132 Studying Religion for Sustainable Development in Nigeria ...

    African Journals Online (AJOL)

    Ike Odimegwu

    S. I. Udoidem made an inciting study of the place of religion in the political life of. Nigeria by carrying out a survey of religious-related crises in. Nigeria since independence. For him, religion and politics are related. After all, it is often said that all power belongs to God. Islam sees a fusion of religion and politics. Christianity,.

  9. All projects related to | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This project will propose concrete recommendations, based on applied research that will help Latin America's border regions tackle illicit drug activity. Topic: LATIN AMERICA, DRUG CONTROL, RESEARCH NETWORKS, CRIME PREVENTION, VIOLENCE. Region: Argentina, Bolivia, Brazil, Colombia, Ecuador, Guatemala, ...

  10. PODAAC-GHG13-2PO02

    Data.gov (United States)

    National Aeronautics and Space Administration — The Geostationary Operational Environmental Satellites (GOES) operated by the United States National Oceanic and Atmospheric Administration (NOAA) support weather...

  11. 40 CFR 86.132-96 - Vehicle preconditioning.

    Science.gov (United States)

    2010-07-01

    ... to prevent entry of water or other contaminants into the fuel tank. During storage in the test area... canisters are equipped with a functional service port designed for vapor load or purge steps, the service port shall be used during testing to precondition the canister. In addition, for model year 1998 and...

  12. Bull. Chem. Soc. Ethiop. 1999, 13(2)

    African Journals Online (AJOL)

    1999-07-01

    Chemistry Department, University of Ilotin, P.M.B. 1515. Ilorin. Nigeria. (Received July 1, 1999; revised November 29, 1999). ABSTRACT. The catalytic hydrogenolysis of n-butane by alumina-supported osmium derived from chloroosmic acid (H,OsCl,), mononuclear osmium carbonyl (H,Os(CO)J and triosmium dodecarbonyl.

  13. 26 CFR 1.132-8 - Fringe benefit nondiscrimination rules.

    Science.gov (United States)

    2010-04-01

    ... classification that is based on factors such as seniority, full-time vs. part-time employment, or job description.... Similarly, if a greater discount is given to employees with more seniority, full-time work status, or a... $50,000 and was in the top-paid group of employees for such year, or (iv) Was at any time an officer...

  14. 1935 15' Quad #132 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  15. The NRS Transect 13:2 (winter 1995)

    OpenAIRE

    UC Natural Reserve System

    1995-01-01

    IN THIS ISSUE OF TRANSECT - (feature article) Mono Lake and Other Eco-studies Find Home Sweet Lab at SNARL - Ancestral Wetlands Restored - Hastings GIS Progresses - "Most Productive Habitat" Discovered - Marine Mammals Monitored

  16. 20 CFR 220.132 - Physical exertion requirements.

    Science.gov (United States)

    2010-04-01

    ... determine the physical exertion requirements of work in the national economy, jobs are classified as... determinations the Board uses the following definitions: (a) Sedentary work. Sedentary work involves lifting no...

  17. South of Sahara | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Read more about La préservation, atout essentiel pour contrer la précarité des moyens de subsistance en Afrique de l'Est. Language French. Read more about Taxes sur les cigarettes en Tanzanie. Language French. Read more about Cigarette Taxation in Tanzania. Language English. Read more about Vers une structure ...

  18. 40 CFR 86.132-00 - Vehicle preconditioning.

    Science.gov (United States)

    2010-07-01

    ... vehicle on test fuel and the US06 cycle. Upon request from a manufacturer, the administrator will also... preconditioned using the fuel remaining in the tank (see paragraph (c)(2)(ii) of this section). The test vehicle may be pushed or driven onto the test dynamometer. Acceptable cycles for preconditioning are as...

  19. 26 CFR 1.132-5 - Working condition fringes.

    Science.gov (United States)

    2010-04-01

    ... employee are— (A) A threat of death or kidnapping of, or serious bodily harm to, the employee or a... multinational corporation. Assume further that there have been kidnapping attempts and other terrorist...

  20. Dicty_cDB: SSA132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available norvegicus clone RP31-392N9 strain Brown Norway, WORKING DRAFT SEQUENCE, 2 ordered pieces. 44 0.11 2 AC129135...|AC129135.4 Rattus norvegicus clone CH230-23C19, WORKING DRAFT SEQUENCE, 2 unordered pieces. 44 0.15 2 AQ112874...Mus musculus chromosome UNK clone RP23-312E2, WORKING DRAFT SEQUENCE, 3 unordered pieces. 50 0.51 2 AC140217...Mus musculus chromosome UNK clone RP23-279O5, WORKING DRAFT SEQUENCE, 14 unordered pieces. 50 0.67 2...norvegicus clone RP31-409E6 strain Brown Norway, WORKING DRAFT SEQUENCE, 10 ordered pieces. 44 1.1 1 AC121674

  1. Dicty_cDB: SLJ132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -1, comp... 32 6.8 AY935938_1( AY935938 |pid:none) Sloanea australis isolate 44 matur... 32 6.8 AY724338_1( ...AY724338 |pid:none) Ungnadia speciosa maturase K (matK... 32 8.9 protein update 2

  2. What we do | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Point-of-sale advertising refers to the display of promotional materials where tobacco products are sold. Americas, Argentina, South America, ... Violent conflict has been repeatedly shown to result in severe, long-term social and mental health problems for exposed children and adolescents. Asia, Middle East, Palestine.

  3. Dicty_cDB: SSD132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F250284.1 Amsacta moorei entomopoxvirus, complete genome. 38 0.12 6 BQ515038 |BQ515038.1 EST622453 Generation...TMIP71 3' end, mRNA sequence. 48 0.13 1 BQ515037 |BQ515037.1 EST622452 Generation

  4. 26 CFR 1.132-9 - Qualified transportation fringes.

    Science.gov (United States)

    2010-04-01

    ... costs of operating the vans, including maintenance, liability insurance and other operating expenses. (c... parking prime member. If an employee obtains a qualified parking space as a result of membership in a car... consequences to the prime member, the statutory monthly limit amounts of each car pool member may not be...

  5. 15 CFR 922.132 - Prohibited or otherwise regulated activities.

    Science.gov (United States)

    2010-01-01

    ..., clean vessel generator cooling water, clean bilge water, or anchor wash; (D) For a vessel less than 300... anchor wash. (iii) Discharging or depositing from beyond the boundary of the Sanctuary any material or... injury resulting incidentally from kelp harvesting, aquaculture, or lawful fishing activities. (4...

  6. 26 CFR 1.132-6 - De minimis fringes.

    Science.gov (United States)

    2010-04-01

    ... normally works from 8:00 am to 4:00 pm). Another example of unusual circumstances is a temporary change in...; occasional cocktail parties, group meals, or picnics for employees and their guests; traditional birthday or... performance, or family crisis). (2) Benefits not excludable as de minimis fringes. Examples of fringe benefits...

  7. Publications | Page 132 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Des études de cas démontrent comment utiliser les SIG pour surveiller des maladies tropicales, la qualité de l... Un mur contre la malaria : Du nouveau dans la prévention des décès dus au paludisme. Pour la première fois depuis les années 1950, l'espoir renaît de pouvoir contrôler le paludisme dans les zones hautement ...

  8. 132 Studying Religion for Sustainable Development in Nigeria ...

    African Journals Online (AJOL)

    Ike Odimegwu

    alcohol, sex, abortion, birth control and employment. These are social norms that may be given credence or rejected by any religion in a religiously pluralistic ..... build bridges for religions in Nigeria, especially between Islam and Christianity. They do this through dialogue and communication. Since religion is relational; and ...

  9. What we do | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ). Point-of-sale advertising refers to the ... Currently, the United Nations and other agencies advance a broad set of empirical claims concerning the power of transitional justice to promote peace in post-conflict situations. Middle East, Palestine ...

  10. What we do | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Telecentre.org : Content and Services Channel. This project aims to build telecentre networks that are financially sustainable and allow users to obtain goods and services that would otherwise be inaccessible to them through economies of scale. Brazil, South America, Chile, Colombia, North And Central America, Panama ...

  11. What we do | Page 132 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Palestinian Adolescents Coping with Trauma (PACT) - Phase III. Topic(s): Conflicts, Violence, Mental Stress, Social Psychology. Region(s): Asia, Middle East, Palestine. Violent conflict has been repeatedly shown to result in severe, long-term social and mental health problems for exposed children and adolescents.

  12. Publications | Page 132 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  13. 46 CFR Form Fmc-132b to Subpart B... - Form FMC-132B to Subpart B of Part 540

    Science.gov (United States)

    2010-10-01

    ... bound unto the United States of America in the penal sum of ______, for which payment, well and truly to... to or from U.S. ports, and Whereas, this bond is written to assure compliance by the Principal as an...

  14. 46 CFR Form Fmc-132a to Subpart A... - Form FMC-132A to Subpart A of Part 540

    Science.gov (United States)

    2010-10-01

    ... America in the penal sum of ______, for which payment, well and truly to be made, we bind ourselves and... to assure compliance by the Principal as an authorized holder of a Certificate (Performance) pursuant...

  15. Nuclear-spectroscopic studies in the {sup 132}Sn region; Kernspektroskopische Untersuchungen in der {sup 132}Sn-Region

    Energy Technology Data Exchange (ETDEWEB)

    Arndt, Oliver

    2007-10-15

    In this work investigations on r-process nuclides around the N = 82 shell closure are done. The so far unknown half-lives and P{sub n}-values of {sup 137-139}Sb and {sup 139}Te and their impact to r-process theory are given. Further the results of Shergur et. al. of neutron rich tin ({sup 137,138}Sn) are verified and in some points improved. New data on {gamma}-decay spectroscopy for {sup 136}Sn from single spectra is published. To improve beam quality and solve long known problems on ISOL-facilities with isobaric contamination, new techniques are discussed. A special focus is on molecular sidebands, which is first time adapted to a target/ion source unit in a mass separation facility. It was possible to create a strong SnS{sup +} sideband and in this way to reduce isobaric background with good beam intensities. On the other hand, a target with temperature controlled transfer line was build and its characteristics are discussed. To improve selectivity of a given experiment on neutron rich nuclei a new detector system for n{gamma}-coincidences was developed. Due to a special electronically setup of the new system it was possible to downsize the coincidence window compared to earlier attempts. (orig.)

  16. Combinatorial antileukemic disruption of oxidative homeostasis and mitochondrial stability by the redox reactive thalidomide 2-(2,4-difluoro-phenyl)-4,5,6,7-tetrafluoro-1H-isoindole-1,3(2H)-dione (CPS49) and flavopiridol.

    Science.gov (United States)

    Ge, Yun; Byun, Jung S; De Luca, Paola; Gueron, Geraldine; Yabe, Idalia M; Sadiq-Ali, Sara G; Figg, William D; Quintero, Jesse; Haggerty, Cynthia M; Li, Quentin Q; De Siervi, Adriana; Gardner, Kevin

    2008-09-01

    2-(2,4-Difluoro-phenyl)-4,5,6,7-tetrafluoro-1H-isoindole-1,3(2H)-dione (CPS49) is a member of a recently identified class of redox-reactive thalidomide analogs that show selective killing of leukemic cells by increasing intracellular reactive oxygen species (ROS) and targeting multiple transcriptional pathways. Flavopiridol is a semisynthetic flavonoid that inhibits cyclin-dependent kinases and also shows selective lethality against leukemic cells. The purpose of this study is to explore the efficacy and mechanism of action of the combinatorial use of the redox-reactive thalidomide CPS49 and the cyclin-dependent kinase inhibitor flavopiridol as a selective antileukemic therapeutic strategy. In combination, CPS49 and flavopiridol were found to induce selective cytotoxicity associated with mitochondrial dysfunction and elevations of ROS in leukemic cells ranging from additive to synergistic activity at low micromolar concentrations. Highest synergy was observed at the level of ROS generation with a strong correlation between cell-specific cytotoxicity and reciprocal coupling of drug-induced ROS elevation with glutathione depletion. Examination of the transcriptional targeting of CPS49 and flavopiridol combinations reveals that the drugs act in concert to initiate a cell specific transcriptional program that manipulates nuclear factor-kappaB (NF-kappaB), E2F-1, and p73 activity to promote enhanced mitochondrial instability by simultaneously elevating the expression of the proapoptotic factors BAX, BAD, p73, and PUMA while depressing expression of the antiapoptotic genes MCL1, XIAP, BCL-xL, SURVIVIN, and MDM2. The coadministration of CPS49 and flavopiridol acts through coordinate targeting of transcriptional pathways that enforce selective mitochondrial dysfunction and ROS elevation and is therefore a promising new therapeutic combination that warrants further preclinical exploration.

  17. Design and synthesis of (S)- and (R)-enantiomers of [4-(2-hydroxy-1-phenylethylimino)pent-2-ol]dimethyltin(iv) and 2,2-dimethyl-4-phenyl-1,3,2-oxazastannolidine: in vitro antitumor activity against human tumor cell lines and in vivo assay of (S)-enantiomers.

    Science.gov (United States)

    Arjmand, Farukh; Sayeed, Fatima; Parveen, Shazia; Tabassum, Sartaj; Juvekar, Aarti S; Zingde, Surekha M

    2013-03-14

    New dimethyltin derived antitumor drug candidates (S)- and (R)-[4-(2-hydroxy-1-phenylethylimino)pent-2-ol]dimethyltin(iv), 1 and (S)- and (R)-[2,2-dimethyl-4-phenyl-1,3,2-oxazastannolidine], 2 derived from (R)- and (S)-enantiomers of [4-(2-hydroxy-1-phenylethylimino)pent-2-ol] and 2-amino-2-phenylethanol, respectively, were synthesized and thoroughly characterized. Preliminary complex-DNA interaction studies employing various optical methods revealed that the (S)-enantiomer displayed a higher propensity towards the drug target DNA double helix. This was quantified by K(b) and K(sv) values of ligands L and L' and (S)-/(R)-1 and (S)-/(R)-2 complexes, which demonstrated a multifold increase in the case of the (S)-enantiomers in comparison to their (R)-enantiomeric forms. This clearly demonstrates the chiral preference of the (S)-enantiomer over the (R)-enantiomer, and its potency to act as a chemotherapeutic agent. Therefore, the in vitro antitumor activity of the (S)-enantiomer of 1 and 2 was evaluated by the sulforhodamine-B (SRB) assay to assess cellular proliferation against five different human cell lines viz., Hop62, DWD, K562, DU145 and MCF-7. The complex (S)-1 displayed a remarkably pronounced and specific activity for K562, while complex (S)-2 exhibited significant activity towards Hop62, DWD, DU145 and MCF-7. The in vivo antitumor activity of (S)-1 and (S)-2 was carried out, which revealed significant regression in human lung tumors.

  18. Fluorescence enhancement of samarium (III) perchlorate by 1,10-phenanthroline on Phenylnaphthoylmethyl sulfoxide complex and luminescence mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com; Feng, Shu-Yan; Liu, Yu; Zhang, Jing; Xin, Xiao-Dong; Ao, Bo-Yang; Li, Ying-Jie

    2013-11-15

    A novel ligand, Phenylnaphthoylmethyl sulfoxide, was synthesized by a new method. Its novel binary complex, SmL{sub 5}·(ClO{sub 4}){sub 3}·2H{sub 2}O, and the ternary complex, SmL{sub 4}·L′(ClO{sub 4}){sub 3}·2H{sub 2}O, had been synthesized (using Phenylnaphthoylmethyl sulfoxide as the first ligand L, 1,10-phenanthroline as the second ligand L′). The complexes were characterized by element analysis, coordination titration, molar conductivity, IR, TG-DSC, {sup 1}HNMR and UV spectra. Their fluorescence emission mechanism, fluorescence intensities and phosphorescence spectra of the two ligands were also investigated by comparison. Fluorescent spectra illustrated that the ternary rare-earth complex presented stronger fluorescence intensity than the binary rare-earth complex in such material. The strongest characteristic fluorescence emission intensity of the ternary system was 1.81 times as strong as that of the binary system. By the analysis of fluorescence and phosphorescence spectra, it was found that the Phenylnaphthoylmethyl sulfoxide and phen had the advantage to absorb and transfer energy to Sm (III) ions effectively, and then the complexes emitted the characteristic fluorescence of Sm (III) ions. The phosphorescence spectra and fluorescence lifetime of the complexes were also measured. -- Highlights: • A novel ligand, Phenylnaphthoylmethyl sulfoxide, has been synthesized. • Its novel ternary complex and the binary complex have been synthesized. • The fluorescence emission intensity of ternary rare earth complex exhibit obvious enhancement. • The fluorescence emission mechanism and phosphorescence spectra are also investigated.

  19. Polypropylene oil as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-03-01

    The research focusses on converting polypropylene oil as pyrolysis product of polypropylene plastic into an electricity. The converter was a direct liquid fuel-solid oxide fuel cell (SOFC) with cerium oxide based material as electrolyte. The polypropylene vapor flowed into fuel cell, in the anode side and undergo oxidation reaction, meanwhile, the Oxygen in atmosphere reduced into oxygen ion at cathode. The fuel cell test was conducted at 400 - 600 °C. According to GC-MS analysis, the polypropylene oil consist of C8 to C27 hydrocarbon chain. The XRD analysis result shows that Na2CO3 did not change the crystal structure of SDC even increases the electrical conductivity. The maximum power density is 0.079 mW.cm-2 at 773 K. The open circuite voltage is 0.77 volt. Chemical stability test by analysing the single cell at before and after fuel cell test found that ionic migration occured during fuel cell operation. It is supported by the change of elemental composition in the point position of electrolyte and at the electrolyte-electrode interface

  20. A distribution pattern of cadmium, gadolinium and samarium in Phaseolus vulgaris (L) plants as assessed by dynamic neutron radiography

    Science.gov (United States)

    Kőrösi, Ferenc; Balaskó, Márton; Sváb, Erzsébet

    1999-11-01

    The qualitative and semi-quantitative distributions, presumably apoplast transport patterns for the Gd, Sm and Cd were investigated in the primordial leaf tissues of the bean using dynamic neutron radiography. According to the applied 3D, 2D images and the pixel count distribution histograms of the considered gray levels, peculiar distribution patterns were postulated for the elements. Main and lateral vascular systems for Gd, the cell walls as well as intercellular spaces for Sm and the main leaf vein for Cd assumed to be the apoplast transport spaces and volumes.

  1. Ab initio calculation of the migration free energy of oxygen diffusion in pure and samarium-doped ceria

    Science.gov (United States)

    Koettgen, Julius; Schmidt, Peter C.; Bučko, Tomáš; Martin, Manfred

    2018-01-01

    We have studied the free energy migration barriers Δ F‡ for oxygen diffusion in pure ceria and Sm-doped ceria for the temperatures 300, 700, and 1000 K. We used the density functional theory in the generalized gradient approximation and an additional Hubbard U parameter for the Ce 4 f electronic states. We compare the results for the free energy deduced from three different methods. First, a static harmonic approach is applied in which the temperature dependent vibrational contributions to energy and entropy are deduced from the phonon frequencies of supercells with a fixed volume. Second, a static quasiharmonic approach is used in which a part of the anharmonicity effect is introduced via an implicit dependence of the harmonic frequencies on the thermally expanding cell volume. Third, the free energy barriers are calculated using metadynamics and molecular dynamics in which anharmonicity effects are naturally taken into account. The three methods examined in this study lead to distinctly different results. According to the harmonic approximation, the migration free energy difference Δ F‡ increases with increasing temperature due to an increasing entropic contribution. According to the quasiharmonic approximation, the migration free energy is independent of temperature. Finally, molecular dynamics predicts a thermally induced increase in the migration free energy. We conclude that temperature dependent experimental lattice constants cancel out the increasing entropic contribution with increasing temperature in the static quasiharmonic approach. The full consideration of anharmonicity effects in the metadynamics method again leads to a temperature dependent migration free energy.

  2. Studies on the preparation and stability of samarium-153 propylene diamine tetramethylene phosphonate (PDTMP) complex as a bone seeker

    Energy Technology Data Exchange (ETDEWEB)

    Majali, M.A. E-mail: mythili@magnum.barc.ernet.in; Mathakar, A.R.; Shimpi, H.H.; Banerjee, Sharmila; Samuel, Grace

    2000-12-15

    Propylene diamine tetra methylene phosphonate (PDTMP) was synthesised by modifying a method reported for the synthesis of EDTMP. Complexation of the synthesised phosphonate ligand with {sup 153}Sm was carried out by varying the experimental parameters and the complex was radiochemically characterized. Biodistribution studies showed that the uptake by bone in rats was 2% per g of bone, which was retained up to 48 h. The uptake by other organs was insignificant, except by the liver which showed a slightly higher absorption.

  3. Crystal structure of a samarium(III nitrate chain cross-linked by a bis-carbamoylmethylphosphine oxide ligand

    Directory of Open Access Journals (Sweden)

    Julie A. Stoscup

    2014-10-01

    Full Text Available In the title compound poly[aquabis(μ-nitrato-κ4O,O′:O,O′′tetrakis(nitrato-κ2O,O′{μ4-tetraethyl [(ethane-1,2-diylbis(azanediylbis(2-oxoethane-2,1-diyl]diphosphonate-κ2O,O′}disamarium(III], [Sm2(NO36(C14H30N2O8P2(H2O]n, a 12-coordinate SmIII and a nine-coordinate SmIII cation are alternately linked via shared bis-bidentate nitrate anions into a corrugated chain extending parallel to the a axis. The nine-coordinate SmIII atom of this chain is also chelated by a bidentate, yet flexible, carbamoylmethylphoshine oxide (CMPO ligand and bears one water molecule. This water molecule is hydrogen bonded to nitrate groups bonded to the 12-coordinate SmIII cation. The CMPO ligand, which lies about an inversion center, links neighboring chains along the c axis, forming sheets parallel to the ac plane. Hydrogen bonds between the amide NH group and metal-bound nitrate anions are also present in these sheets. The sheets are packed along the b axis through only van der Waals interactions.

  4. Structure, reactivity, electronic configuration and magnetism of samarium atomic layers deposited on Si(0 0 1) by molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Gheorghe, Nicoleta G.; Lungu, George A.; Husanu, Marius A.; Costescu, Ruxandra M.; Macovei, Dan [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania); Teodorescu, Cristian M., E-mail: teodorescu@infim.ro [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania)

    2013-02-15

    The surface structure, interface reactivity, electron configuration and magnetic properties of Sm layers deposited on Si(0 0 1) at various temperatures are investigated by low-energy electron diffraction (LEED), X-ray photoelectron spectroscopy (XPS), X-ray absorption spectroscopy (XAS) and magneto-optical Kerr effect (MOKE). It is found that metal Sm is present on samples prepared at low temperature, with an interface layer containing SmSi{sub 2} and Sm{sub 4}Si{sub 3}. When samples are prepared at high temperature, much less metal Sm is found, with an increasing amount of SmSi{sub 2}. Room temperature ferromagnetism is observed for all prepared layers, with a decrease of the saturation magnetization when samples are prepared at high temperature. It is found that ferromagnetism implies mostly a compound with approximate stoichiometry Sm{sub 4}Si{sub 3}. Also, the decrease in the intensity of the XAS 2p{sub 3/2} → 3d white lines with the corresponding increasing amount of SmSi{sub 2} may be explained by assuming a higher occupancy of Sm 5d orbitals (5d{sup 2} configuration), most probably due to hybridation effects.

  5. Calculation and comparison of xenon and samarium reactivities of the HEU, LEU core in the low power research reactor.

    Science.gov (United States)

    Dawahra, S; Khattab, K; Saba, G

    2015-07-01

    Comparative studies for the conversion of the fuel from HEU to LEU in the Miniature Neutron Source Reactor (MNSR) have been performed using the MCNP4C and GETERA codes. The precise calculations of (135)Xe and (149)Sm concentrations and reactivities were carried out and compared during the MNSR operation time and after shutdown for the existing HEU fuel (UAl4-Al, 90% enriched) and the potential LEU fuels (U3Si2-Al, U3Si-Al, U9Mo-Al, 19.75% enriched and UO2, 12.6% enriched) in this paper using the MCNP4C and GETERA codes. It was found that the (135)Xe and (149)Sm reactivities did not reach their equilibrium reactivities during the daily operating time of the reactor. The (149)Sm reactivities could be neglected compared to (135)Xe reactivities during the reactor operating time and after shutdown. The calculations for the UAl4-Al produced the highest (135)Xe reactivity in all the studied fuel group during the reactor operation (0.39 mk) and after the reactor shutdown (0.735 mk), It followed by U3Si-Al (0.34 mk, 0.653 mk), U3Si2-Al (0.33 mk, 0.634 mk), U9Mo-Al (0.3 mk, 0.568 mk) and UO2 (0.24 mk, 0.448 mk) fuels, respectively. Finally, the results showed that the UO2 was the best candidate for fuel conversion to LEU in the MNSR since it gave the lowest (135)Xe reactivity during the reactor operation and after shutdown. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Development of samarium [{sup 32}P] phosphate colloid for radiosynoviorthesis applications: Preparation, biological and preliminary clinical studies experience

    Energy Technology Data Exchange (ETDEWEB)

    Prabhakar, G. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India)], E-mail: gantipk47@rediffmail.com; Sachdev, Satbir S.; Umamaheswari, S.; Sivaprasad, N.; Bhatia, Manohar H. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India); Chaudhari, Pradip R. [Laboratory Nuclear Medicine Services, BARC, Mumbai 400 012 (India); Solav, Srikant V. [Spect Lab, Nuclear Medicine Services, Opposite Dinanath Mangeshkar Hospital, Pune 411004 (India)

    2007-12-15

    A new therapeutic radio colloid for radiosynoviorthesis (RS) applications is reported. The method of preparation involves the reaction of SmCl{sub 3} carrier with carrier added [{sup 32}P]H{sub 3}PO{sub 4} in the presence of gelatin. The pure colloid was recovered by dialysis purification leading to radiochemical yield of around 90%. The radiochemical purity of the pure colloid formulated in isotonic saline was over 98%, for the usage period of 14 days, as assessed by paper chromatography. Ninety percent of colloid particles were in the size of 1-10 {mu}m as evident from the laser diffraction particle size analysis, ideally suitable for the intended end use. Animal studies revealed complete retention of the radio colloid in the rabbit knee joint. The results of clinical trials in humans are satisfactory and encouraging, satisfactory retention of the colloid in the knee joint and negligible leakage into the systemic circulation.

  7. Tetrakis(μ-propanoato-κ2O:O′bis[(1,10-phenanthroline-κ2N,N′(propanoato-κ2O,O′samarium(III

    Directory of Open Access Journals (Sweden)

    Chun-Xiang Wang

    2008-01-01

    Full Text Available The title complex, [Sm2(C3H5O26(C12H8N22], is a dinuclear centrosymmetric molecule, in which two crystallographically equivalent Sm atoms, separated by 3.9502 (2 Å, are bridged by four propanoate anions. Each Sm atom is coordinated by two N atoms from one chelating phenanthroline ligand and seven carboxylate O atoms from five propanoate anions, to form a distorted tricapped trigonal prism.

  8. Processing of composites based on NiO, samarium-doped ceria and carbonates (NiO-SDCC as anode support for solid oxide fuel cells

    Directory of Open Access Journals (Sweden)

    Lily Siong Mahmud

    2017-09-01

    Full Text Available NiO-SDCC composites consisting of NiO mixed with Sm-doped ceria (SDC and carbonates (Li2CO3 and Na2CO3 were sintered at different temperatures and reduced at 550 °C. The influence of reduction on structure of the NiO-SDCC anode support for solid oxide fuel cells (SOFCs was investigated. Raman spectra of the NiO-SDCC samples sintered at 500, 600 and 700 °C showed that after reducing at 550 °C NiO was reduced to Ni. In addition, SDC and carbonates (Li2CO3 and Na2CO3 did not undergo chemical transformation after reduction and were still detected in the samples. However, no Raman modes of carbonates were identified in the NiO-SDCC pellet sintered at 1000 °C and reduced at 550 °C. It is suspected that carbonates were decomposed at high sintering temperature and eliminated due to the reaction between the CO32– and hydrogen ions during reduction in humidified gases at 550 °C. The carbonate decomposition increased porosity in the Ni-SDCC pellets and consequently caused formation of brittle and fragile structure unappropriated for SOFC application. Because of that composite NiO-SDC samples without carbonates were also analysed to determine the factors affecting the crack formation. In addition, it was shown that the different reduction temperatures also influenced the microstructure and porosity of the pellets. Thus, it was observed that Ni-SDC pellet reduced at 800 °C has higher electrical conductivity of well-connected microstructures and sufficient porosity than the pellet reduced at 550 °C.

  9. The single cell of low temperature solid oxide fuel cell with sodium carbonate-SDC (samarium-doped ceria) as electrolyte and biodiesel as fuel

    Science.gov (United States)

    Rahmawati, F.; Nuryanto, A.; Nugrahaningtyas, K. D.

    2016-02-01

    In this research NSDC (composite of Na2CO3-SDC) was prepared by the sol-gel method to produce NSDC1 and also by the ceramic method to produce NSDC2. The prepared NSDC then were analyzed by XRD embedded with Le Bail refinement to study the change of characteristic peaks, their crystal structure, and their cell parameters. Meanwhile, the measurement of impedance was conducted to study the electrical conductivity of the prepared materials. A single cell was prepared by coating NSDC-L (a composite of NSDC with Li0.2Ni0.7Cu0.1O2) on both surfaces of NSDC. The NSDC-L was used as anode and cathode. The ionic conductivity of NSDC1 and NSDC2 at 400 oC are 4.1109 x 10-2 S.cm-1 and 1.6231 x 10-2 S.cm-1, respectively. Both electrolytes have ionic conductivity higher than 1 x 10-4 S.cm-1, therefore, can be categorized as good electrolyte [1]. However, the NSDC1 shows electrodeelectrolyte conduction. It indicates the existence of electronic migration from electrolyte- electrode or vice versa. Those may cause a short circuit during fuel cell operation and will reduce the fuel cell performance fastly. The single cell tests were conducted at 300, 400, 500 and 600 °C. The single fuel cell with NSDC1 and NSDC2 as electrolyte show maximum power density at 400 °C with the power density of 3.736 x 10-2 mW.cm-2 and 2.245 x 10-2 mW.cm-2, respectively.

  10. Samarium-neodymium chronology and rubidium-strontium systematics of an Allende calcium-aluminum-rich inclusion with implications for 146Sm half-life

    Science.gov (United States)

    Marks, N. E.; Borg, L. E.; Hutcheon, I. D.; Jacobsen, B.; Clayton, R. N.

    2014-11-01

    Calcium-aluminum-rich inclusions (CAIs) are primitive objects that formed within the protoplanetary disk surrounding the young Sun. Recent Pb-Pb chronologic studies have demonstrated that CAIs are the oldest solar system solids, crystallizing 4567 Ma ago (Amelin et al., 2002; Connelly et al., 2012). The isotope systematics of CAIs therefore provide critical insight into the earliest history of the Solar System. Although Sm-Nd and Rb-Sr geochronometers are highly effective tools for investigating cosmochemical evolution in the early Solar System, previous studies of CAIs have revealed evidence for isotopically disturbed systems. Here we report new age data for Allende CAI Al3S4 derived from both the long-lived (147Sm-143Nd) and short-lived (146Sm-142Nd) isotopic systems. The 147Sm-143Nd chronometer yields an age of 4560 ± 34 Ma that is concordant with 207Pb-206Pb ages for CAIs and indicates that the Sm-Nd system was not significantly disturbed by secondary alteration or nucleosynthetic processes. The slope of the 146Sm-142Nd isochron defines the Solar System initial 146Sm/144Sm of 0.00828 ± 0.00044. This value is significantly different from the value of 0.0094 determined by Kinoshita et al. (2012). Ages recalculated from all published 146Sm-142Nd isochron data using the traditional 103 Ma half-life and the initial 146Sm/144Sm value determined here closely match Pb-Pb and 147Sm-143Nd ages determined on the same samples. In contrast, ages recalculated using the 68 Ma half-life determined by Kinoshita et al. (2012) and either of the initial 146Sm/144Sm values are often anomalously old. This is particularly true for the youngest samples with 146Sm-142Nd isochron ages that are most sensitive to the choice of 146Sm half-life used in the age calculation. In contrast to the Sm-Nd isotope system, the Rb-Sr system is affected by alteration but yields an apparent isochron with a slope corresponding to a much younger age of 4247 ± 110 Ma. Although the Rb-Sr system in CAIs appears to be disturbed, the initial 87Sr/86Sr value determined from the isochron is 0.698942 ± 0.000008, and closely approximates estimates of the initial Solar System value. Although this isochron may be a mixing line, it might also record alteration on the Allende parent body in which Rb was added to the Al3S4 CAI that was initially largely devoid of Rb.

  11. Anthropogenic dissolved and colloid/nanoparticle-bound samarium, lanthanum and gadolinium in the Rhine River and the impending destruction of the natural rare earth element distribution in rivers

    Science.gov (United States)

    Kulaksız, Serkan; Bau, Michael

    2013-01-01

    The strong increase in the consumption of rare earth elements (REE) in high-tech products and processes is accompanied by increasing amounts of REE released into the environment. Following the first report of Gd contamination of the hydrosphere in 1996, anthropogenic Gd originating from contrast agents has now been reported worldwide from river and estuarine waters, coastal seawater, groundwater and tap water. Recently, microcontamination with La, that is derived from a point source where catalysts for petroleum refining are produced, has been detected in the Rhine River in Germany and the Netherlands. Here we report the occurrence of yet another REE microcontamination of river water: in addition to anthropogenic Gd and La, the Rhine River now also shows significant amounts of anthropogenic Sm. The anthropogenic Sm, which enters the Rhine River north of Worms, Germany, with the same industrial wastewater that carries the anthropogenic La, can be traced through the Middle and Lower Rhine to the Netherlands. At Leverkusen, Germany, some 250 km downstream from the point source at Worms, anthropogenic Sm still contributes up to 87% of the total dissolved Sm concentration of the Rhine River. Results from ultrafiltration suggest that while the anthropogenic Gd is not particle-reactive and hence exclusively present in the truly dissolved REE pool (Worms get close to and well-above, respectively, the levels at which ecotoxicological effects have been documented. Because of the increasing use of REE and other formerly "exotic" trace elements in high-tech applications, these critical metals have now become emerging contaminants that should be monitored, and it appears that studies of their biogeochemical behavior in natural freshwaters might soon no longer be possible.

  12. Ultra-Sensitive Nano Optical Sensor Samarium-Doxycycline Doped in Sol Gel Matrix for Assessment of Glucose Oxidase Activity in Diabetics Disease.

    Science.gov (United States)

    Tharwat, Marwa M; Attia, M S; Alghamdi, M S; Mahros, Amr M

    2017-07-11

    A low cost and very sensitive method for the determination of the activity of glucose oxidase enzyme in different diabetics serum samples was developed. The method based on the assessment of the H2O2 concentration produced from the reaction of the glucose oxidase (GOx) enzyme with glucose as substrate in the serum of diabetics patients by nano optical sensor Sm-doxycycline doped in sol gel matrix. H2O2 enhances the luminescence intensity of all bands of the nano Sm-doxycycline complex [Sm-(DC)2](+) doped in sol-gel matrix, especially the 645 nm band at λex = 400 nm and pH 7.0 in water. The influence of the different analytical parameters that affect the luminescence intensity of the nano optical sensor, e.g. pH, H2O2 concentration and foreign ions concentrations were studied. The remarkable enhancement of the luminescence intensity of nano optical sensor [Sm-(DC)2](+) complex in water at 645 nm by the addition of various concentrations of H2O2 was successfully used as an optical sensor for the assessment of the activity of the glucose oxidase enzyme in different diabetics serum samples. The calibration plot was achieved over the activity range 0.1-240 U/L with a correlation coefficient of 0.999 and a detection limit of 0.05 U/L.

  13. Effect of Mg doping and sintering temperature on structural and morphological properties of samarium-doped ceria for IT-SOFC electrolyte

    Science.gov (United States)

    Ahmad, Syed Ismail; Mohammed, Tasneem; Bahafi, Amal; Suresh, Madireddy Buchi

    2017-06-01

    Samples of Sm and Mg co-doped ceria electrolyte of Ce1- x Sm x- y Mg y O2- δ ( x = 0.2; y = 0.00, 0.05, 0.1, 0.15, and 0.175) were synthesized by sol-gel process. The prepared samples were sintered at 1100 and 1400 °C for 4 h. The bulk densities were measured by Archimedes method. XRD measurements indicate that the synthesized samples were in single-phase cubic fluorite structure (space group Fm3m). The cell parameters decrease with the concentration of Mg, and 2 θ values slightly shift towards right. The particle sizes obtained were between 7.14 and 17.44 nm. The sintered sample achieved 95% of theoretical density. FTIR spectra of samples sintered at 1400 °C indicates weak interactions between 3550-3400 cm-1 and 1600-1300 cm-1 are attributed to O-H stretching modes and strong bonds 850-450 cm-1 are assigned to characteristic Ce-O vibrations. The surface morphology and chemical composition were analyzed by SEM and EDS, SEM micrographs show spherical faceted grains, and the samples were crack free, dense material with some pores on surface which are inconsistent with density results. The average grain size obtained was 0.5 μm. Particle size obtained by TEM was in agreement with that obtained by XRD. The high-density ceria co-doped ceramic can be used as electrolyte in SOFC.

  14. Synthesis, spectroscopic, thermal and antimicrobial studies of neodymium(III) and samarium(III) complexes derived from tetradentate ligands containing N and S donor atoms

    Science.gov (United States)

    Ain, Qurratul; Pandey, S. K.; Pandey, O. P.; Sengupta, S. K.

    2015-04-01

    Trivalent lanthanide complexes of the type [Ln(L)Cl(H2O)2] (where Ln = Nd(III) or Sm(III) and LH2 = Schiff bases derived by the condensation of 3-(phenyl/substitutedphenyl)-4-amino-5-mercapto-1,2,4-triazole with diacetyl/benzil) have been synthesized by the reactions of anhydrous lanthanide(III) chloride with Schiff bases in methanol. The structures of the complexes have been proposed on the basis of elemental analysis, electrical conductance, magnetic moment, spectroscopic measurements (IR, 1H, 13C NMR and UV-vis spectra) and X-ray diffraction studies. The spectral data reveal that the Schiff base ligands behave as dibasic tetradentate chelating agents having coordination sites at two thiol sulfur atoms and two azomethine nitrogen atoms. The presence of coordinated water in metal complexes was confirmed by thermal and IR data of the complexes. All the Schiff bases and their metal complexes have also been screened for their antibacterial activity against Bacillus subtilis, Staphylococcus aureus and antifungal activities against Aspergillus niger, Curvularia pallescens and Colletotrichum capsici.

  15. Logarithmic temperature dependence of samarium ion valence in the heavy-fermion S mxL a1 -xO s4S b12

    Science.gov (United States)

    Fushiya, Kengo; Miyazaki, Ryoichi; Higashinaka, Ryuji; Yamada, Akira; Mizumaki, Masaichiro; Tsutsui, Satoshi; Nitta, Kiyofumi; Uruga, Tomoya; Suemitsu, Bunya; Sato, Hideyuki; Aoki, Yuji

    2015-08-01

    We have measured x-ray absorption spectra at the Sm L3 edge to investigate the Sm-ion valence of (S mxL a1 -x) O s4S b12 , in which field-insensitive heavy-fermion behavior appears at low temperatures for x =1 . It has been found that the Sm-ion valance shifts to 2 + with La ion substitution; from v =+2.78 (x =1 ) to v =+2.73 (x =0.2 ) at 10 K. For all x investigated, its temperature dependence shows a logT behavior, indicating that the valence change is caused by "an unconventional Kondo effect" associated with Sm 4 f -electron charge degrees of freedom. Almost x independence of "the associated Kondo temperature" (T˜K=56 ±10 K ) indicates that the Kondo effect has a local nature, attributable to the cage structure of the filled skutterudite.

  16. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water

    Energy Technology Data Exchange (ETDEWEB)

    Merschel, Gila, E-mail: g.merschel@jacobs-university.de; Bau, Michael

    2015-11-15

    High-technology metals — such as the rare earth elements (REE) — have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. - Highlights: • Corbicula fluminea shells are bioarchives of dissolved geogenic REE in rivers. • Anthropogenic La and Sm in the Rhine River are bioavailable, hence incorporated. • Anthropogenic Gd from contrast agents is not incorporated, i.e. not bioavailable. • REE concentrations in Corbicula shells decrease with increasing size, i.e. age.

  17. Mechanically induced strong red emission in samarium ions doped piezoelectric semiconductor CaZnOS for dynamic pressure sensing and imaging

    Science.gov (United States)

    Wang, Wei; Peng, Dengfeng; Zhang, Hanlu; Yang, Xiaohong; Pan, Caofeng

    2017-07-01

    Piezoelectric semiconductor with optical, electrical and mechanical multifunctions has great potential applications in future optoelectronic devices. The rich properties and applications mainly encompass the intrinsic structures and their coupling effects. Here, we report that lanthanide ions doped piezoelectric semiconductor CaZnOS:Sm3+ showing strong red emission induced by dynamic mechanical stress. Under moderate mechanical load, the doped piezoelectric semiconductor exhibits strong visible red emission to the naked eyes even under the day light. A flexible dynamic pressure sensor device is fabricated based on the prepared CaZnOS:Sm3+ powders. The mechanical-induced emission properties of the device are investigated by the optical fiber spectrometer. The linear characteristic emissions are attributed to the 4G5/2→6H5/2 (566 nm), 4G5/2→6H7/2 (580-632 nm), 4G5/2→6H9/2 (653-673 nm) and 4G5/2→6H11/2 (712-735 nm) f-f transitions of Sm3+ ions. The integral emission intensity is proportional to the value of applied pressure. By using the linear relationship between integrated emission intensity and the dynamic pressure, the real-time pressure distribution is visualized and recorded. Our results highlight that the incorporation of lanthanide luminescent ions into piezoelectric semiconductors as smart materials could be applied into the flexible mechanical-optical sensor device without additional auxiliary power, which has great potential for promising applications such as mapping of personalized handwriting, smart display, and human machine interface.

  18. Investigation of oxidative coupling of methane over bismuth oxychloride, samarium chloride, or manganese chloride supported on lithium carbonate-magnesia systems

    Energy Technology Data Exchange (ETDEWEB)

    Khan, A.Z.; Ruckenstein, E. (State Univ. of New York, Buffalo, NY (United States))

    1992-11-01

    The magnesia-supported bismuth oxychloride with lithium carbonate present is significantly more effective and stable with time-on-stream than the unsupported or supported systems free of Li[sub 2]CO[sub 3] in the oxidative coupling of methane at 750[degrees]C, P[sub CH[sub 4

  19. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water.

    Science.gov (United States)

    Merschel, Gila; Bau, Michael

    2015-11-15

    High-technology metals - such as the rare earth elements (REE) - have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Samario-153-Lexidronam (EDTMP) en el tratamiento de las metástasis óseas Samarium-153-Lexidronam (EDTMP) for the management of bone metastases

    OpenAIRE

    F. Torre; C. Gómez-Vega; A. Callejo; J. Genolla

    2004-01-01

    Las metástasis óseas son una complicación frecuente en pacientes neoplásicos, en este sentido, el tejido óseo ocupa el tercer lugar de todos los órganos y sistemas con metástasis después del pulmón e hígado. Aproximadamente un 75% de los enfermos con metástasis óseas sufrirán dolor, siendo estas la causa más frecuente de dolor en pacientes con cáncer. El dolor óseo aumenta con los movimientos y a la presión, limitando la autonomía del enfermo y su calidad de vida. El tratamiento incluye vario...