WorldWideScience

Sample records for samarium 128

  1. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  2. Particle-Size-Induced Valence Changes in Samarium Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Mason, M. G.; Lee, S. -T.; Apai, G.; Davis, R. F.; Shirley, D. A.; Franciosi, A.; Weaver, J. H.

    1981-09-01

    Samarium clusters exhibit mixed-valence behavior which is sensitive to particle size. XPS and UPS data show samarium to be primarily divalent (4f{sup 6} ) at small particle size. The trivalent state (4f{sup 5} ) becomes progressively more abundant with increasing s1ze, becoming the dominant state for the bulk metal. These results are interpreted using a model in which band narrowing, due to reduced surface coordination, is more dominant than surface tension effects in establishing the valence of small samarium clusters.

  3. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  4. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel

    Energy Technology Data Exchange (ETDEWEB)

    Villarim Neto, Arthur; Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Rego, Amalia Cinthia Meneses [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Postgraduate Program in Health Sciences; Azevedo, Italo Medeiros; Medeiros, Aldo Cunha [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. of Surgery; Bernardo-Filho, Mario [State University of Rio de Janeiro, RJ (Brazil). Dept. of Biophysics and Biometry

    2009-01-15

    Purpose: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. Methods: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium) group received docetaxel (15 mg/kg) intraperitoneally in two cycles 11 days apart. The S (samarium/control) group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1 ml of samarium-153-EDTMP via orbital plexus (25 {mu} Ci. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI / g) was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland). Results: On the ninth day after the administration of the second chemotherapy cycle, the rats had a significant weight loss (314.50 +- 22.09 g) compared (p<0.5) to pre-treatment weight (353.66 {+-} 22.8). The % ATI/g in the samples of rats treated with samarium-153-EDTMP had a significant reduction in the right femur, left femur, kidney, liver and lungs of animals treated with docetaxel, compared to the control rats. Conclusion: The combination of docetaxel and samarium-153-EDTMP was associated with a lower response rate in the biodistribution of the radiopharmaceutical to targeted tissues. Further investigation into the impact of docetaxel on biodistribution of samarium-153-EDTMP would complement the findings of this study. (author)

  5. I love ATMEGA 128

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Hae Gwon; Bae, Seong Jun

    2005-06-15

    The contents of this book are introduction of ATMEGA 128, structure of ATMEGA128, AVR GCC function, direction of AvrEdit, AVR MCU write machine, introduction of AveEmbedded 128 kit, method of use of CPU cluck, outer interrupt, ADC practice, RS232C, 8 beat 16 beat counter, LED Test, PWM, LCE 16 * 2 / 273, Graphic LCD, stepping Motor, LDM, 4x4 scan key input, application of voice chip, USB, W3100A, practice to make a watch with DS1302, infrared rays and FLD.

  6. The Basis for Developing Samarium AMS for Fuel Cycle Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Buchholz, B A; Biegalski, S R; Whitney, S M; Tumey, S J; Weaver, C J

    2008-10-13

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of {sup 146}Sm, {sup 149}Sm, and {sup 151}Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  7. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    Optical characteristics of transparent samarium oxide thin films deposited by the radio-frequency sputtering technique. A A ATTA M M EL-NAHASS KHALED M ELSABAWY M M ABD EL-RAHEEM A M HASSANIEN A ALHUTHALI ALI BADAWI AMAR MERAZGA. Regular Volume 87 Issue 5 November 2016 Article ID 72 ...

  8. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3() ZnO(40-)V2O5(60) (where = 0.1–0.5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been calculated.

  9. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Optical properties of samarium doped zinc–tellurite glasses. B ERAIAH. Department of Physics, Karnatak University, Dharwad 580 003, India. Present address: Department of Physics, Bangalore University, Bangalore 560 056, India. MS received 20 March 2006; revised 13 June 2006. Abstract. Glasses with the composition, ...

  10. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: Syntheses, crystal structures, thermal analysis and luminescence study. MUHAMMAD IDIRIS SALEH, MIN YEE CHOO, TAI WEI CHAN and MOHD R RAZALI. ∗. School of Chemical Sciences, Universiti Sains Malaysia, Penang, ...

  11. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 127; Issue 12. Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: ... Muhammad Idiris Saleh1 Min Yee Choo1 Tai Wei Chan1 Mohd R Razali1. School of Chemical Sciences, Universiti Sains Malaysia, Penang, Malaysia ...

  12. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Mechanism of the electrochemical deposition of samarium-based coatings

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, Edgar J. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Ortega-Borges, Raul [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Godinez, Luis A. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Chapman, Thomas W. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Meas-Vong, Yunny [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico)]. E-mail: yunnymeas@cideteq.mx

    2006-11-12

    Samarium-based films have been shown to form from aqueous solutions on the surfaces of metallic substrates such as steel or aluminum, and their presence has been reported to decrease substantially the corresponding corrosion rate of the underlying metallic substrate. Based on previous reports on the deposition of oxides or hydroxides of the closely related element cerium, this work demonstrates that samarium films are formed following a similar mechanism, which involves as the fundamental step an increase in interfacial pH resulting from cathodic oxygen-reduction or hydrogen-evolution reactions. With cyclic voltammetry (CV), electrochemical quartz-crystal microbalance (EQCM) measurements, rotating-disk electrode (RDE) tests, and surface characterization techniques, namely, scanning electron microscopy (SEM) and X-ray surface microanalysis (EDX), the postulated mechanism was verified, and the surface morphology of the resulting films was correlated with the nature of the reduction reaction that triggers film formation.

  14. Samarium Monosulfide (SmS): Reviewing Properties and Applications

    OpenAIRE

    Sousanis, Andreas; Smet, Philippe; Poelman, Dirk

    2017-01-01

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducti...

  15. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  16. STS 128 - Christer Fuglesang

    CERN Multimedia

    CERN Video Productions

    2009-01-01

    STS-128 (ISS assembly flight 17A) is the next space shuttle mission to the International Space Station (ISS), planned for August 25, 2009. It is expected to use Space Shuttle Discovery. The primary payload will be the Multi-Purpose Logistics Module Leonardo. The mission is scheduled to include three spacewalks to remove and replace a materials processing experiment outside ESA's Columbus module and return an empty ammonia tank assembly As a graduate student, Fuglesang worked at CERN (the European Research Center on Particle Physics) in Geneva on the UA5 experiment, which studied proton-antiproton collisions. In 1988 he became a Fellow of CERN, where he worked on the CPLEAR experiment studying the subtle CP-violation of kaon particles. After a year he became a Senior Fellow and head of the particle identification subdetector........

  17. Synthesis of nano-pore samarium (III)-imprinted polymer for preconcentrative separation of samarium ions from other lanthanide ions via solid phase extraction

    Energy Technology Data Exchange (ETDEWEB)

    Shirvani-Arani, Simindokht [Center of Excellence in Electrochemistry, Department of Chemistry, University of Tehran, P.O.Box:14155-6455, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ahmadi, Seyed Javad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)], E-mail: sjahmadi@aeoi.org.ir; Bahrami-Samani, Ali [Nuclear Engineering and Physics Department, Amir Kabir University, P.O.Box: 15875-4413, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ghannadi-Maragheh, Mohammad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)

    2008-08-08

    A batch process was developed to separate samarium ions from some lanthanide ions by a novel solid phase which was prepared via the ion-imprinting technique. The samarium (III) ion-imprinted polymer (IIP) particles were synthesized by preparing the ternary complex of samarium ions with 5,7-dichloroquinoline-8-ol (DCQ) and 4-vinylpyridine (VP). Then, thermally copolymerization with styrene (functional monomer, STY) and divinylbenzene (cross-linking monomer, DVB) followed in the presence of 2-methoxy ethanol (porogen) and 2,2'-azobisisobutyronitrile (initiator, AIBN). The imprinted ion was removed by stirring the above particles with 50% (v/v) HCl to obtain the leached IIP particles. Moreover, control polymer (CP) particles were similarly prepared without the samarium ions. The unleached and leached IIP particles were characterized by X-ray diffraction (XRD), infra-red spectroscopy (IR), thermo gravimetric analysis (TGA) and scanning electron microscopy (SEM). Finally, preconcentration and selectivity studies for samarium and the other lanthanide ions were carried out. The preconcentration of the samarium (III) traces was studied during rebinding with the leached IIP particles as a function of pH, the weight of the polymer material, the preconcentration and the elution times, the eluent volume and the aqueous phase volume. These studies indicated that the samarium (III) amount as low as 1 {mu}g, present in 200 mL, could be preconcentrated into 25 mL of 1.0 M HCl.

  18. Ionization of Samarium by Chemical Releases in the Upper Atmosphere

    Science.gov (United States)

    Siefring, C. L.; Bernhardt, P. A.; Holmes, J. M.; Pedersen, T. R.; Caton, R.; Miller, D.; Groves, K. M.

    2014-12-01

    The release of Samarium vapor into the upper atmosphere was studied using during the Air Force Research Laboratory sponsored Metal Oxide Space Cloud (MOSC) rocket launches in May 2009. The Naval Research Laboratory supported these experiments with 3-D photochemical modeling of the artificial plasma cloud including (1) reactions with atomic oxygen, (2) photo excitation, (3) photoionization, (4) dissociative recombination, and (5) ion and neutral diffusion. NRL provided the experimental diagnostic instrument on the rocket which was a dual frequency radio beacon on the rocket to measure changes in total electron content. The AFRL provided ground based diagnostics of incoherent scatter radar and optical spectroscopy and imagery. The NRL Chemical Release Model (CRM) has over 600 excited states of atomic Samarium neutrals, atomic ions, along with Samarium Oxide Ions and electrons. Diffusive transport of neutrals in cylindrical geometry and ions along magnetic field lines is computed along with the reactive flow to predict the concentrations of Sm, Sm-Ion, Sm0, and SmO Ion. Comparison of the CRM with observations demonstrates that Sm release into the upper atmosphere initially produces enhanced electron densities and SmO-Ions. The diatomic ions recombine with electrons to yield neutral Sm and O. Only the photo ionization of Sm yields a stable atomic ion that does not substantially recombine. The MOSC releases in sunlight yielded long duration ion clouds that can be replicated with the CRM. The CRM predicts that Sm releases in darkness would not produce long duration plasma clouds because of the lack of photo excitation and photoionization.

  19. Reactive Materials for Evaporating Samarium (Pre-Print)

    Science.gov (United States)

    2016-04-15

    SUBJECT TERMS energetic materials, heat sources, pyrotechnic charges, easily ionized metals 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF...experiments.    Keywords:  energetic  materials, heat sources, pyrotechnic charges, easily ionized metals  1. Introduction Ejection of clouds of...results  were  negatively  affected  by  reduced  efficiency   of  release  and  ionization of samarium [8]. It is possible that not the entire charge of

  20. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  1. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  2. Luminescent solutions and powders of new samarium complexes with N,N',O,O'-chelating ligands

    Science.gov (United States)

    Kharcheva, Anastasia V.; Nikolskiy, Kirill S.; Borisova, Nataliya E.; Ivanov, Alexey V.; Reshetova, Marina D.; Yuzhakov, Viktor I.; Patsaeva, Svetlana V.

    2016-04-01

    Imaging techniques in biology and medicine are crucial tools to obtain information on structural and functional properties of living cells and organisms. To fulfill the requirements associated with application of these techniques it appears necessary to design markers with specific characteristics. Luminescent complexes of trivalent lanthanide ions with chelating ligands are of increasing importance in biomedical applications because of their millisecond luminescence lifetime, narrow emission band, high signal-to-noise ratio and minimal photodamage to biological samples. In order to extend the available emission wavelength range the luminescent samarium chelates are highly desirable. In this study the ligands with diamides of 2,2'-bipyridin-6,6'-dicarboxylic acid were used to improve photophysical characteristics of samarium complexes. We report the luminescence characteristics of samarium complexes with novel ligands. All complexes exhibited the characteristic emission of Sm (III) ion with the lines at 565, 597, 605, 645 and 654 nm, the intensity strongly depended on the ligand. Absorption and luminescence excitation spectra of Sm (III) complexes showed main peaks in the UV range demonstrating lanthanide coordination to the ligand. The absolute lumenescence quantum yield was measured for solutions in acetonitrile with excitation at 350 nm. The largest luminescence quantum yield was found for the samarium complex Bipy 6MePy Sm (3%) being much higher that for samarium complexes reported in the literature earlier. These results prove as well that samarium chelates are potential markers for multiparametric imaging techniques.

  3. Australian manufacture of Quadramet{sup TM} (Samarium-153 EDTMP)

    Energy Technology Data Exchange (ETDEWEB)

    Wood, N.R.; Whitwell, J. [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). Australian Radioisotopes

    1997-10-01

    Quadramet{sup T} (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200{mu}g/mL whereas the overseas formulation has a level of 20-46{mu}g/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet{sup TM} provides a further option in the management of these difficult cases

  4. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  5. Collision attack against Tav-128 hash function

    Science.gov (United States)

    Hariyanto, Fajar; Hayat Susanti, Bety

    2017-10-01

    Tav-128 is a hash function which is designed for Radio Frequency Identification (RFID) authentication protocol. Tav-128 is expected to be a cryptographically secure hash function which meets collision resistance properties. In this research, a collision attack is done to prove whether Tav-128 is a collision resistant hash function. The results show that collisions can be obtained in Tav-128 hash function which means in other word, Tav-128 is not a collision resistant hash function.

  6. Optical analysis of samarium doped sodium bismuth silicate glass.

    Science.gov (United States)

    Thomas, V; Sofin, R G S; Allen, M; Thomas, H; Biju, P R; Jose, G; Unnikrishnan, N V

    2017-01-15

    Samarium doped sodium bismuth silicate glass was synthesized using the melt quenching method. Detailed optical spectroscopic studies of the glassy material were carried out in the UV-Vis-NIR spectral range. Using the optical absorption spectra Judd-Ofelt (JO) parameters are derived. The calculated values of the JO parameters are utilized in evaluating the various radiative parameters such as electric dipole line strengths (Sed), radiative transition probabilities (Arad), radiative lifetimes (τrad), fluorescence branching ratios (β) and the integrated absorption cross- sections (σa) for stimulated emission from various excited states of Sm3+‡ ion. The principal fluorescence transitions are identified by recording the fluorescence spectrum. Our analysis revealed that the novel glassy system has the optimum values for the key parameters viz. spectroscopic quality factor, optical gain, stimulated emission cross section and quantum efficiency, which are required for a high performance optical amplifier. Calculated chromaticity co-ordinates (0.61, 0.38) also confirm its application potential in display devices. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Samarium Monosulfide (SmS): Reviewing Properties and Applications.

    Science.gov (United States)

    Sousanis, Andreas; Smet, Philippe F; Poelman, Dirk

    2017-08-16

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducting and metallic states could be exploited in several applications, such as high density optical storage and memory materials, thermovoltaic devices, infrared sensors and more. We discuss the electronic, optical and magnetic properties of SmS, its switching behavior, as well as the thin film deposition techniques which have been used, such as e-beam evaporation and sputtering. Moreover, applications and possible ideas for future work on this material are presented. Our scope is to present the properties of SmS, which were mainly measured in bulk crystals, while at the same time we describe the possible deposition methods that will push the study of SmS to nanoscale dimensions, opening an intriguing range of applications for low-dimensional, pressure-induced semiconductor-metal transition compounds.

  8. Excitation induced spectroscopic study and quenching effect in cerium samarium codoped lithium aluminoborate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Parvinder; Kaur, Simranpreet [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, Gurinder Pal [Department of Physics, Khalsa College, Amritsar 143002 (India); Arora, Deepawali; Kumar, Sunil [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, D.P., E-mail: dpsinghdr@yahoo.com [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India)

    2016-08-15

    Lithium aluminium borate host has been codoped with cerium and samarium to prepare glass by conventional melt quench technique. Their structural and spectroscopic investigation has been carried out using XRD, FTIR and density measurements. The UV‐Vis absorption spectra and fluorescence spectra (λ{sub exc}.=380 nm and 400 nm) have been studied for spectroscopic analysis. The amorphous nature of the prepared samples is shown by XRD. The density is increasing with addition of cerium at the expense of aluminium, keeping other components constant. FTIR study also shows the presence of compact and stable tetrahedral BO{sub 4} units thus supporting the density results. The UV‐ Vis absorption spectra show a shift of optical absorption edge towards longer wavelength along with an increase in intensity of peaks with rising samarium concentration. The fluorescence spectra show a blue shift and subsequent suppression of cerium peaks with addition of samarium.

  9. Effect of samarium doping on the dielectric behavior of barium zircomium titanate ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Badapanda, T., E-mail: badapanda.tanmaya@gmail.com [Department of Physics, C.V. Raman College of Engineering, Bhubaneswar, Odisha-752054 (India); Sarangi, S.; Behera, B. [School of Physics, Sambalpur University, Jyoti Vihar Sambalpur, Odisha-768019 (India); Anwar, S. [Colloids and Materials Chemistry, Institute of Minerals and Materials Technology, Bhubaneswar, Odisha-751013 (India); Sinha, T. P. [Department of Physics, Bose Institute, Kolkata-700009 (India)

    2014-04-24

    Samarium doped Barium Zirconium Titanate ceramic with general formula Ba{sub 1−x}Sm{sub 2x/3}Zr{sub 0.05}Ti{sub 0.95}O{sub 3} [x=0.0,0.01,0.02,0.03,0.04] has been prepared by high energy ball milling. The X-ray diffraction (XRD) patterns confirmed that these ceramics have a single phase with perovskite-type upto x≤0.03 and a small secondary phase exist at x=0.04. The temperature dependent dielectric study shows a ferroelectric phase transition and transition temperature decreases with an increase in the Samarium content.

  10. Lithium Bromide/Water as Additives in Dearomatizing Samarium-Ketyl (Hetero)Arene Cyclizations.

    Science.gov (United States)

    Rao, Chintada Nageswara; Bentz, Christoph; Reissig, Hans-Ulrich

    2015-11-02

    New conditions for dearomatizing samarium-ketyl (hetero)arene cyclizations are reported. In many examples of these samarium diiodide-mediated reactions, lithium bromide and water can be used as additives instead of the carcinogenic and mutagenic hexamethylphosphoramide (HMPA). The best results were obtained for the cyclizations of N-acylated indole derivatives delivering the expected indolines in good yields and excellent diastereoselectivities. A new type of cyclization delivering indolyl-substituted allene derivatives is also described. The scope and limitations of the lithium bromide/water system are discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. 21 CFR 133.128 - Cottage cheese.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cottage cheese. 133.128 Section 133.128 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.128 Cottage cheese. (a) Cottage cheese is the soft uncured cheese prepared by mixing cottage...

  12. 41 CFR 128-1.8001 - Background.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Background. 128-1.8001 Section 128-1.8001 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.80-Seismic Safety Program § 128-1.8001 Background. The...

  13. 7 CFR 1260.128 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1260.128 Section 1260.128 Agriculture... Promotion and Research Order Definitions § 1260.128 Act. Act means the Beef Promotion and Research Act of 1985, Title XVI, Subtitle A of the Food Security Act of 1985, Pub. L. 99-198 and any amendments thereto. ...

  14. 28 CFR 0.128 - Organization.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Organization. 0.128 Section 0.128 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE 1-Foreign Claims Settlement Commission § 0.128 Organization. The Foreign Claims Settlement Commission of the United States is...

  15. 41 CFR 128-1.152 - Citation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Citation. 128-1.152 Section 128-1.152 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.1-Regulation System § 128-1.152 Citation. The JPMR will be...

  16. 10 CFR 4.128 - New construction.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false New construction. 4.128 Section 4.128 Energy NUCLEAR... 1973, as Amended Discriminatory Practices § 4.128 New construction. (a) Design, construction, and... Federal Accessibility Standards. (1) Effective as of January 18, 1991, design, construction, or alteration...

  17. 7 CFR 1220.128 - Soybeans.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Soybeans. 1220.128 Section 1220.128 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.128 Soybeans. The term...

  18. 50 CFR 665.128 - Gear identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.128 Section 665.128 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... § 665.128 Gear identification. (a) The vessel number must be affixed to all fish and crab traps on board...

  19. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    The samarium-doped ceria (SDC) nanospheres were prepared by the one-step hydrothermal method and characterized by transmission electron microscope, scanning electron microscope, powder X-ray diffraction, X-ray photoelectron spectroscopy, energy-dispersive spectrometer and Raman spectra. According to the ...

  20. A spectroscopic comparison of samarium-doped LiYF4 and KY3F10

    NARCIS (Netherlands)

    Wells, J. P. R.; Sugiyama, A.; Han, T. P. J.; Gallagher, H. G.

    2000-01-01

    Laser selective excitation and fluorescence has been performed on LiYF4 and KY3F10 doped with samarium ions. In LiYF4, a single, tetragonal symmetry center associated with isovalent substitution of Sm3+ with lattice yttrium ions is present. By contrast, three Sm2+ centres and a single, tetragonal

  1. Cryptanalysis of Tav-128 hash function

    DEFF Research Database (Denmark)

    Many RFID protocols use cryptographic hash functions for their security. The resource constrained nature of RFID systems forces the use of light weight cryptographic algorithms. Tav-128 is one such 128-bit light weight hash function proposed by Peris-Lopez et al. for a low-cost RFID tag...... authentication protocol. Apart from some statistical tests for randomness by the designers themselves, Tav-128 has not undergone any other thorough security analysis. Based on these tests, the designers claimed that Tav-128 does not posses any trivial weaknesses. In this article, we carry out the first third...... party security analysis of Tav-128 and show that this hash function is neither collision resistant nor second preimage resistant. Firstly, we show a practical collision attack on Tav-128 having a complexity of 237 calls to the compression function and produce message pairs of arbitrary length which...

  2. Cryptanalysis of Tav-128 hash function

    DEFF Research Database (Denmark)

    Kumar, Ashish; Sanadhya, Somitra Kumar; Gauravaram, Praveen

    2010-01-01

    Many RFID protocols use cryptographic hash functions for their security. The resource constrained nature of RFID systems forces the use of light weight cryptographic algorithms. Tav-128 is one such 128-bit light weight hash function proposed by Peris-Lopez et al. for a low-cost RFID tag...... authentication protocol. Apart from some statistical tests for randomness by the designers themselves, Tav-128 has not undergone any other thorough security analysis. Based on these tests, the designers claimed that Tav-128 does not posses any trivial weaknesses. In this article, we carry out the first third...... party security analysis of Tav-128 and show that this hash function is neither collision resistant nor second preimage resistant. Firstly, we show a practical collision attack on Tav-128 having a complexity of 237 calls to the compression function and produce message pairs of arbitrary length which...

  3. 46 CFR 128.310 - Fuel.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fuel. 128.310 Section 128.310 Shipping COAST GUARD... Main and Auxiliary Machinery § 128.310 Fuel. (a) Except as provided by paragraph (b) of this section..., must be driven by a fuel having a flashpoint of not lower than 43 °C (110 °F) as determined by ASTM D...

  4. The Use of a Flexible Calix[4]arene Template to Stabilize a Cyclooctatetraindiyl Samarium-Potassium Complex

    Directory of Open Access Journals (Sweden)

    Geoffroy Guillemot

    2013-01-01

    Full Text Available A sandwich compound of cyclooctatetraendiyl (COT2− samarium-potassium was synthesized and analyzed using a flexible calix[4]arene dianion. This compound, [p-tBu-calix[4]-(OMe2(O2]arenediyl-samarium-(η8-cyclooctatetraendiyl-potassium (tetrahydrofurane3, is constructed as a linear sequence L-Sm--K-, where L, , and are specific ligands with L = O,O-dimethyl-calix[4]arene2−, = cyclo-octatetraendiyl, and = tetrahydrofurane templates.

  5. Dicty_cDB: AHB128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) AHB128 (Link to dictyBase) - - - Contig-U16408-1 AHB128P (Link to Original site) AHB128F 123 AHB128Z...AHB128Z 698 AHB128P 801 - - Show AHB128 Library AH (Link to library) Clone ID AHB128 (Link to dictyBase)...biol.tsukuba.ac.jp/CSM/AH/AHB1-B/AHB128Q.Seq.d/ Representative seq. ID AHB128P (Link to Original site)...site) Representative DNA sequence >AHB128 (AHB128Q) /CSM/AH/AHB1-B/AHB128Q.Seq.d/ AAAAATAATAAATTTACTATCA...membrane >> prediction for AHB128 is nuc 5' end seq. ID AHB128F 5' end seq. >AHB128F.Seq AAAAATAATAAATTT

  6. 31 CFR 128.22 - Periodic reports.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Periodic reports. 128.22 Section 128.22 Money and Finance: Treasury Regulations Relating to Money and Finance REPORTING OF INTERNATIONAL... as outstanding foreign exchange contracts, dealing positions, derivative foreign currency instruments...

  7. 9 CFR 3.128 - Space requirements.

    Science.gov (United States)

    2010-01-01

    ..., poor condition, debility, stress, or abnormal behavior patterns. Animal Health and Husbandry Standards ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Space requirements. 3.128 Section 3.128 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  8. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  9. Samarium(II) iodide-mediated reductive annulations of ketones bearing a distal vinyl epoxide moiety

    Energy Technology Data Exchange (ETDEWEB)

    Molander, G.A.; Shakya, S.R. [Univ. of Colorado, Boulder, CO (United States)

    1996-08-23

    It was found that samarium (II) iodide promotes the intramolecular coupling of ketones with distal epoxy olefins while in the presence of hexamethylphosphoramide (HPMA). A number of epoxide compounds (1 a-k) fragment to form carbocycles with allylic alcohol side chains with high diastereoselectivity (2 a-k). Substituting tetramethylguanidine for HPMA reduces the diastereoselectivity. Adding Pd(0) as a catalyst reverses the diastereoselective sense. 40 refs., 1 tab.

  10. A temporal three-dimensional simulation of samarium release in the ionosphere

    Science.gov (United States)

    Zhao, Hai-Sheng; Feng, Jie; Xu, Zheng-Wen; Wu, Jian; Wu, Zhen-Sen; Xu, Bin; Xue, Kun; Xu, Tong; Hu, Yan-Li

    2016-10-01

    For understanding plasma processes of the ionosphere and magnetosphere, the alkali and alkaline-earth metals are usually released in space for artificially increasing the electron density. However, it is a limitation that these releases must be in sunlight where the photoionization can take place. In recent years, the lanthanide metals, such as samarium, have been released to produce electrons in reaction with atomic oxygen in the upper space. The reaction could proceed without sunlight so that the restriction on experimental periods is broken. Unfortunately, any sophisticated models even preliminary ones are unavailable yet in the literature. A temporal three-dimensional model is presented for the samarium release in detail with respect to various altitudes and mass. Especially, the plasma diffusion equation is remarkably extended from 2-D to 3-D by importing the influence of geomagnetic declination, which could be also useful for other chemical releases. The field-aligned terms are brought so as to the presented model can describe the diffusion along the geomagnetic field subtly. On the basis of the presented model, behaviors of radio waves propagating through the release area are simulated by using ray tracing. This model could be as the theoretical support for samarium releases, and it also helpful for the research on the generation and evolution of the ionosphere irregularities.

  11. 33 CFR 157.128 - Stripping system.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Stripping system. 157.128 Section... Crude Oil Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.128 Stripping system. (a) Each tank vessel having a COW system under § 157.10(e), § 157.10a(a)(2), or § 157.10c(b)(2...

  12. Liquid–liquid anion exchange extraction studies of samarium(III from salicylate media using high molecular weight amine

    Directory of Open Access Journals (Sweden)

    Aniruddha M. Mandhare

    2015-07-01

    Full Text Available Liquid–liquid extraction and separation of samarium(III were carried out by using 0.025 mol dm−3 2-octylaminopyridine(2-OAP in xylene at 298 K. The extraction behavior of samarium was studied as a function of pH, weak acid concentration, extractant concentration, diluent, and equilibration time. Samarium was quantitatively extracted at pH 7.5 to 10.0 from 0.01 mol dm−3 sodium salicylate solution with 0.025 mol dm−3 2-OAP. The possible composition of the extracted species in organic phase has been determined by using model of slope analysis method and extraction mechanism was found to proceed via an anion exchange mechanism. The stripping efficiency was found to be quantitative in HNO3, HCl and CH3COOH. The robustness of the procedure was demonstrated by the average recoveries obtained (>99.6% for samarium(III extraction in the presence of several cations and anions which are commonly associated with it. The proposed method facilitates the separation and determination of samarium(III from binary and synthetic mixtures. The various thermodynamic functions like free energy (ΔG, enthalpy (ΔH and entropy (ΔS of extraction mechanism were discussed.

  13. Dicty_cDB: CHF128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF128 (Link to dictyBase) - - - Contig-U16291-1 CHF128P (Link to Original site) CHF...128F 609 CHF128Z 672 CHF128P 1261 - - Show CHF128 Library CH (Link to library) Clone ID CHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF1-B/CHF128Q.Seq.d/ Representative seq. ID CHF...128P (Link to Original site) Representative DNA sequence >CHF128 (CHF128Q) /CSM/CH/CHF1-B/CHF... Score E Sequences producing significant alignments: (bits) Value CHF128 (CHF128Q) /CSM/CH/CHF1-B/CHF128Q.Se

  14. Samarium(II) iodide-mediated intramolecular conjugate additions of alpha,beta-unsaturated lactones.

    Science.gov (United States)

    Molander, Gary A; St Jean, David J

    2002-05-31

    Samarium(II) iodide, in the presence of catalytic amounts of nickel(II) iodide, has been used to promote intramolecular conjugate additions of alkyl halides onto alpha,beta-unsaturated lactones. This process has been shown to be applicable to a number of alpha,beta-unsaturated lactones, including tetrasubstituted olefins, and has been demonstrated to be quite general for the formation of saturated bicyclic and tricyclic lactones. The method presented herein provides a mild, efficient process to form structurally complex lactones from simple precursors.

  15. 22 CFR 128.13 - Appeals.

    Science.gov (United States)

    2010-04-01

    ... Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS ADMINISTRATIVE PROCEDURES § 128.13... Secretary of State for Arms Control and International Security, Department of State, Washington, DC 20520. An appeal from a final order denying export privileges or imposing civil penalties must be filed...

  16. 21 CFR 558.128 - Chlortetracycline.

    Science.gov (United States)

    2010-04-01

    ...-02-756 Cottonseed Meal 10.00 5-01-625 Trace Mineral/Vitamin Premix1 3.80 Calcium Carbonate 3.50 6-01... DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR USE IN ANIMAL FEEDS Specific New Animal Drugs for Use in Animal Feeds § 558.128 Chlortetracycline. (a) Specifications. Type A medicated articles...

  17. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  18. X-Band Microwave Reflection Properties of Samarium/Bismuth-Substituted Barium Lanthanum Titanate Ceramics

    Science.gov (United States)

    Bahel, Shalini; Pubby, Kunal; Narang, Sukhleen Bindra

    2017-03-01

    Samarium/bismuth-substituted barium lanthanum titanate ceramics with chemical composition Ba4 (La_{1 - y - z} Smy Biz )_{9.33} Ti_{18} O_{54} ( y = 0.5, 0.7; z = 0.05, 0.10, 0.15), intended as microwave reflecting materials, have been investigated in microwave X-band (8.2 GHz to 12.4 GHz) and the effect of substitution on their dielectric properties, i.e., dielectric constant and dielectric loss tangent, has been studied by vector network analyzer. Dielectric analysis showed that the dielectric constant increased with increasing samarium as well as bismuth content. Dielectric relaxation was observed for all samples in the scanned frequency range. Microwave reflection and transmission analysis of ceramic pellets of thickness 4 mm was carried out using two methods, i.e., open- and short-circuit approach, both indicating very high values of reflected power and very low values of transmitted power for all the doped materials in comparison with the base composition. The doped compositions are therefore potential microwave shielding materials for use in anechoic chambers, microwave laboratories, and radar equipment. Double-layer reflectors are also proposed, having better reflection properties (˜99% reflection) compared with single-layer reflectors.

  19. Microstructure and hysteresis curves of samarium-holmium-iron garnet synthesized by coprecipitation

    Directory of Open Access Journals (Sweden)

    Caffarena Valeska da Rocha

    2003-01-01

    Full Text Available An investigation was made into the synthesis and magnetic properties of Sm(3-xHo xFe5O12 (samarium-holmium-iron garnet ferrite, as yet absent from the literature. The material in question was synthesized by co-precipitation, starting from hydrated chlorides of rare-earth elements and ferrous sulfate, and the mixed hydroxide co-precipitate was calcined at 1000 °C. Using PVA as a binder, rectangular cross section-shaped compacts were produced by means of steel-die pressing, drying and sintering from 1200 to 1450 °C. The main conclusions of this study were that the coercive force decreases as the sintering temperature increases, and that the effect of substituting holmium for samarium in SmIG is entirely different from that provided by replacing yttrium by gadolinium in YIG, which is the most important result of this work. An in-depth investigation will be necessary to determine the correlation between microstructure/magnetic properties and ceramic processing variables.

  20. Bone-seeking radiopharmaceuticals as targeted agents of osteosarcoma: samarium-153-EDTMP and radium-223.

    Science.gov (United States)

    Anderson, Peter M; Subbiah, Vivek; Rohren, Eric

    2014-01-01

    Osteosarcoma is a cancer characterized by formation of bone by malignant cells. Routine bone scan imaging with Tc-99m-MDP is done at diagnosis to evaluate primary tumor uptake and check for bone metastases. At time of relapse the Tc-99m-MDP bone scan also provides a specific means to assess formation of bone by malignant osteosarcoma cells and the potential for bone-seeking radiopharmaceuticals to deliver radioactivity directly into osteoblastic osteosarcoma lesions. This chapter will review and compare a bone-seeking radiopharmaceutical that emits beta-particles, samarium-153-EDTMP, with an alpha-particle emitter, radium-223. The charged alpha particles from radium-223 have far more mass and energy than beta particles (electrons) from Sm-153-EDTMP. Because radium-223 has less marrow toxicity and more radiobiological effectiveness, especially if inside the bone forming cancer cell than samarium-153-EDTMP, radium-223 may have greater potential to become widely used against osteosarcoma as a targeted therapy. Radium-223 also has more potential to be used with chemotherapy against osteosarcoma and bone metastases. Because osteosarcoma makes bone and radium-223 acts like calcium, this radiopharmaceutical could possibly become a new targeted means to achieve safe and effective reduction of tumor burden as well as facilitate better surgery and/or radiotherapy for difficult to resect large, or metastatic tumors.

  1. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  2. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  3. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  4. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry in the Region of Samarium, Europium, and Gadolinium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R D; Kelley, K; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of samarium, europium and gadolinium (62 {le} Z {le} 64, 82 {le} N {le} 96).

  5. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  6. Effects of the atomic environment on the electron binding energies in samarium

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh., E-mail: inoyatov@jinr.ru [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Institute of Applied Physics, National University, Tashkent, Republic of Uzbekistan (Uzbekistan); Kovalík, A. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Filosofov, D.V. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Ryšavý, M.; Vénos, D. [Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Yushkevich, Yu.V.; Perevoshchikov, L.L. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Zhdanov, V.S. [Nuclear Physics Institute, Almaty, Republic of Kazakhstan (Kazakhstan)

    2016-02-15

    Highlights: • Eight different matrices (evaporated and implanted at 30 keV) used. • The greatest average difference in the binding energies amounted to 3.1 ± 0.1 eV. • The presence of trivalent and divalent Sm ions found in some implanted samples. • No significant differences in Sm natural atomic level widths were observed. - Abstract: Effects of the atomic environment on the L{sub 1}, L{sub 2}, L{sub 3}, M{sub 1}, M{sub 2}, M{sub 3}, and N{sub 1} electron binding energies in samarium generated in the electron capture decay of radioactive {sup 149}Eu were investigated by means of the internal conversion electron spectroscopy using the conversion electron spectrum of the 22.5 keV M1 + E2 nuclear transition in the daughter {sup 149}Sm. In this investigation, four pairs of {sup 149}Eu sources prepared by vacuum evaporation deposition and by ion implantation at 30 keV with the use of four different source backing materials, namely polycrystalline carbon, aluminium, gadolinium and platinum foils, were employed. The greatest average difference of (3.1 ± 0.1) eV in the L{sub 1}, L{sub 2}, L{sub 3}, and M{sub 1} subshell electron binding energies was observed between the {sup 149}Eu sources prepared by ion implantation into the aluminium and platinum substrates. On the other hand, minimal differences in the electron binding energies were generally found between samarium generated in the evaporated layer and in the bulk for the individual investigated source backings with the exception of the gadolinium foil. A doublet structure of all investigated conversion electron lines with the average values of 8.1 ± 0.2 eV and 1.5 ± 0.1 for the separation energy and the intensity ratio of the low-energy to high-energy components, respectively, was observed for the {sup 149}Eu sources prepared by ion implantation into the aluminium and carbon foils. This structure was presumably caused by the presence of both the trivalent and divalent Sm ions in the sources. No

  7. Multiphoton laser wave-mixing absorption spectroscopy for samarium using a graphite furnace atomizer

    Energy Technology Data Exchange (ETDEWEB)

    Maniaci, Michael J.; Tong, William G. E-mail: william.tong@sdsu.edu

    2004-07-30

    Nonlinear laser wave-mixing optical technique is presented as a sensitive atomic spectroscopic method for the analysis of rare earth elements using an unmodified commercially available graphite furnace (GF) atomizer. A simple nonplanar backward-scattering degenerate four-wave mixing optical arrangement offers sub-picogram detection sensitivity with sub-Doppler Lorentzian-broadened resolution. Nonlinear wave mixing is an unusually sensitive absorption-based optical method that offers both excellent detection sensitivity and sub-Doppler spectral resolution. A mass detection limit of 0.7 pg and a concentration detection limit of 70 pg/ml are determined for a rare earth element, samarium, using the 429.7-nm excitation line.

  8. Samarium Doped Cerium Oxide Clusters: a Study on the Modulation of Electronic Structure

    Science.gov (United States)

    Topolski, Josey E.; Kafader, Jared O.; Marrero-Colon, Vicmarie; Chick Jarrold, Caroline

    2017-06-01

    Cerium oxide is known for its use in solid oxide fuel cells due to its high ionic conductivity. The doping of trivalent samarium atoms into cerium oxide is known to enhance the ionic conductivity through the generation of additional oxygen vacancies. This study probes the electronic structure of Sm_{x}Ce_{y}O_{z} (x+y=3, z=2-4) anion and neutral clusters. Anion photoelectron spectra of these mixed metal clusters exhibit additional spectral features not present in the previously studied cerium oxide clusters. Density functional theory calculations have been used to aid interpretation of collected spectra. The results of this work can be used to inform the design of materials used for solid oxide fuel cells.

  9. Chelating Ligand-Mediated Hydrothermal Synthesis of Samarium Orthovanadate with Decavanadate as Vanadium Source

    Directory of Open Access Journals (Sweden)

    Quanguo Li

    2013-01-01

    Full Text Available A new ethylenediaminetetraacetic acid- (EDTA- mediated hydrothermal route to prepare chrysanthemum-shaped samarium orthovanadate (SmVO4 nanocrystals with decavanadate (K6V10O28·9H2O as vanadium source has been developed. The present hydrothermal approach is simple and reproducible and employs a relatively mild reaction temperature. The EDTA, pH value, and temperature of the reaction systems play important roles in determining the morphologies and growth process of the SmVO4 products. The products have been characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, Fourier transform infrared spectroscopy (FT-IR, photoluminescence spectra (PL, and UV-Vis spectroscopy.

  10. The Magnetocaloric Effect and Heat Capacity of Suspensions of High-Dispersity Samarium Ferrite

    Science.gov (United States)

    Korolev, V. V.; Aref'ev, I. M.; Ramazanova, A. G.

    2008-02-01

    The magnetocaloric effect and specific heat capacity of an aqueous suspension of samarium ferrite were determined calorimetrically over the temperature range 288-343 K in magnetic fields of 0-0.7 T. The data obtained were used to calculate changes in the magnetic component of the molar heat capacity and entropy of the magnetic phase and changes in the enthalpy of the process under an applied magnetic field. The magnetocaloric effect was found to increase nonlinearly as the magnetic field induction grew. The corresponding temperature dependences contained a maximum at 313 K related to the second-order magnetic phase transition at the Curie point. The field and temperature dependences of heat capacity contained a maximum in fields of 0.4 T and a minimum at the magnetic phase transition temperature.

  11. Roof renovation of buildings 128 and 129

    CERN Document Server

    2015-01-01

    The roof renovation of buildings 128 and 129 is scheduled to take place from 17 August to 15 October 2015.   During this period, access to the "raw material" workshop will be limited and controlled due to asbestos removal. Collecting your orders directly from the building will be difficult, or even impossible, and urgent requests will be difficult to carry out. We therefore ask you to create your requests via EDH, so that delivery may be carried out as soon as possible. Thank you for your understanding. GS Department

  12. Preparation of hollow core/shell microspheres of hematite and its adsorption ability for samarium.

    Science.gov (United States)

    Yu, Sheng-Hui; Yao, Qi-Zhi; Zhou, Gen-Tao; Fu, Sheng-Quan

    2014-07-09

    Hollow core/shell hematite microspheres with diameter of ca. 1-2 μm have been successfully achieved by calcining the precursor composite microspheres of pyrite and polyvinylpyrrolidone (PVP) in air. The synthesized products were characterized by a wide range of techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), energy-dispersive X-ray spectroscopy (EDX), transmission electron microscopy (TEM), high-resolution TEM (HRTEM), thermogravimetric analysis (TGA) and differential scanning calorimetry (DSC), and Brunauer-Emmett-Teller (BET) gas sorptometry. Temperature- and time-dependent experiments unveil that the precursor pyrite-PVP composite microspheres finally transform into hollow core/shell hematite microspheres in air through a multistep process including the oxidation and sulfation of pyrite, combustion of PVP occluded in the precursor, desulfation, aggregation, and fusion of nanosized hematite as well as mass transportation from the interior to the exterior of the microspheres. The formation of the hollow core/shell microspheres dominantly depends on the calcination temperature under current experimental conditions, and the aggregation of hematite nanocrystals and the core shrinking during the oxidation of pyrite are responsible for the formation of the hollow structures. Moreover, the adsorption ability of the hematite for Sm(III) was also tested. The results exhibit that the hematite microspheres have good adsorption activity for trivalent samarium, and that its adsorption capacity strongly depends on the pH of the solution, and the maximum adsorption capacity for Sm(III) is 14.48 mg/g at neutral pH. As samarium is a typical member of the lanthanide series, our results suggest that the hollow hematite microspheres have potential application in removal of rare earth elements (REEs) entering the water environment.

  13. The influence of the technological parameters on the ionic conductivity of samarium doped ceria thin films

    Directory of Open Access Journals (Sweden)

    Mantas Sriubas

    2015-03-01

    Full Text Available Sm0,20Ce0,80O2 powder was used for the formation of samarium doped cerium oxide (SDC thin films using e-beam. Surface area of powder was 34.9 m2/g and particle size – 0.3-0.5 μm. Thin films were deposited using physical vapor deposition system on SiO2 and Alloy 600 substrates. 2 Å/s – 16 Å/s growth rate and 20 °C – 600 °C substrate temperature were used during the deposition. Ionic conductivity investigation revealed that the maximum ionic conductivity (1.67 S/m has the thin film deposited on 300 °C temperature substrate using 4 Å/s growth rate. Minimum ionic conductivity (0.26 S/m has thin film which was deposited on 20 °C temperature substrate using 8 Å/s growth rate. Vacancy activation energies vary in 0.87 eV – 0.97 eV range. Furthermore the calculations of crystallite size revealed that crystallite size increases with increasing substrate temperature: from 7.50 nm to 46.23 nm on SiO2 substrate and from 9.30 nm to 44.62 nm on Alloy 600 substrate. Molar concentration of samarium in initial evaporated material is 19.38 mol% and varies from 11.37 mol% to 21 mol% in formed thin films depending on technological parameters.DOI: http://dx.doi.org/10.5755/j01.ms.21.1.5700

  14. Formation of Core-Shell Nanoparticles Composed of Magnetite and Samarium Oxide in Magnetospirillum magneticum Strain RSS-1.

    Science.gov (United States)

    Shimoshige, Hirokazu; Nakajima, Yoshikata; Kobayashi, Hideki; Yanagisawa, Keiichi; Nagaoka, Yutaka; Shimamura, Shigeru; Mizuki, Toru; Inoue, Akira; Maekawa, Toru

    2017-01-01

    Magnetotactic bacteria (MTB) synthesize magnetosomes composed of membrane-enveloped magnetite (Fe3O4) or greigite (Fe3S4) particles in the cells. Recently, several studies have shown some possibilities of controlling the biomineralization process and altering the magnetic properties of magnetosomes by adding some transition metals to the culture media under various environmental conditions. Here, we successfully grow Magnetospirillum magneticum strain RSS-1, which are isolated from a freshwater environment, and find that synthesis of magnetosomes are encouraged in RSS-1 in the presence of samarium and that each core magnetic crystal composed of magnetite is covered with a thin layer of samarium oxide (Sm2O3). The present results show some possibilities of magnetic recovery of transition metals and synthesis of some novel structures composed of magnetic particles and transition metals utilizing MTB.

  15. 22 CFR 128.2 - Administrative Law Judge.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administrative Law Judge. 128.2 Section 128.2... § 128.2 Administrative Law Judge. The Administrative Law Judge referred to in this part is an Administrative Law Judge appointed by the Department of State. The Administrative Law Judge is authorized to...

  16. 9 CFR 2.128 - Inspection for missing animals.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Inspection for missing animals. 2.128 Section 2.128 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE REGULATIONS Miscellaneous § 2.128 Inspection for missing animals. Each dealer...

  17. 34 CFR 300.125-300.128 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false 300.125-300.128 Section 300.125-300.128 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Additional Eligibility Requirements §§ 300.125-300.128 Children in Private...

  18. 22 CFR 128.17 - Availability of orders.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Availability of orders. 128.17 Section 128.17 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS ADMINISTRATIVE PROCEDURES § 128.17 Availability of orders. All charging letters, debarment orders, orders imposing civil penalties...

  19. 41 CFR 128-1.5002-6 - Personal property management.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Personal property management. 128-1.5002-6 Section 128-1.5002-6 Public Contracts and Property Management Federal Property... Responsibilities for Personal Property Management § 128-1.5002-6 Personal property management. A system for...

  20. 46 CFR 128.450 - Liquid-mud systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Liquid-mud systems. 128.450 Section 128.450 Shipping...: EQUIPMENT AND SYSTEMS Design Requirements for Specific Systems § 128.450 Liquid-mud systems. (a) Liquid-mud... this chapter. (b) Tanks for oil-based liquid mud must be fitted with tank vents equipped with flame...

  1. 33 CFR 110.128c - Island of Kauai, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Kauai, Hawaii. 110.128c Section 110.128c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128c Island of Kauai, Hawaii. (a) Nawiliwili Bay. The...

  2. 33 CFR 110.128b - Island of Hawaii, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Hawaii, Hawaii. 110.128b Section 110.128b Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128b Island of Hawaii, Hawaii. (a) Hilo Bay...

  3. 41 CFR 128-1.101 - Justice Property Management Regulations.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Justice Property Management Regulations. 128-1.101 Section 128-1.101 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.1-Regulation System § 128-1...

  4. 29 CFR 570.128 - Good faith defense.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Good faith defense. 570.128 Section 570.128 Labor... Provisions of the Fair Labor Standards Act of 1938, as Amended Enforcement § 570.128 Good faith defense. Link... commerce goods which he acquired in good faith in reliance on written assurance from the producer...

  5. Laboratory and telescope use of the NICMOS2 128 X 128 HgCdTe array

    Science.gov (United States)

    Rieke, Marcia J.; Montgomery, E. F.; Rieke, G. H.; Vural, Kadri; Blessinger, Michael; Kleinhans, William

    1989-10-01

    The second generation of Hubble Space Telescope (HST) instruments will include a near-infrared instrument. This choice has driven the development of near-infrared arrays to larger sizes and lower read noises. Rockwell International has delivered an array for use in the Near Infrared Camera and Multi-Object Spectrometer (NICMOS) instrument; this array has been dubbed NICMOS2. NICMOS2 is a 128x128 array of HgCdTe diodes In-bonded to a switched MOSFET readout. The readout was specifically designed for astronomical use with the HST requirement of low read noise a prime goal. These arrays use detector material which is similar to that used by Rockwell in previous arrays (e.g., HgCdTe produced on a sapphire substrate), but the NICMOS2 devices differ substantially from other 128x128 arrays produced by Rockwell in having a read noise of only 30 electrons when read out using appropriate correlated sampling. NICMOS2 has now been characterized in the laboratory, and it has been used on groundbased telescopes.

  6. Co-reduction of aluminium and lanthanide ions in molten fluorides: Application to cerium and samarium extraction from nuclear wastes

    Energy Technology Data Exchange (ETDEWEB)

    Gibilaro, M. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France); Massot, L. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)], E-mail: massot@chimie.ups-tlse.fr; Chamelot, P.; Taxil, P. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)

    2009-09-01

    This work concerns the method of co-reduction process with aluminium ions in LiF-CaF{sub 2} medium (79-21 mol.%) on tungsten electrode for cerium and samarium extraction. Electrochemical techniques such as cyclic and square wave voltammetries, and potentiostatic electrolyses were used to study the co-reduction of CeF{sub 3} and SmF{sub 3} with AlF{sub 3}. For each of these elements, specific peaks of Al-Ce and Al-Sm alloys formation were observed by voltammetry as well as peaks of pure cerium and aluminium, and pure samarium and aluminium respectively. The difference of potential measured between the solvent reduction and the alloy formation suggests expecting an extraction efficiency of 99.99% of each lanthanide by the process. Different intermetallic compounds were obtained for different potentiostatic electrolysis and were characterised by Scanning Electron Microscopy with EDS probe. The validity of the process was verified by carrying out cerium and samarium extractions in the form of Al-Ln alloy; the extraction efficiency was 99.5% for Ce(III) and 99.4% for Sm(III)

  7. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  8. Performance of 128×128 solar-blind AlGaN ultraviolet focal plane arrays

    Science.gov (United States)

    Yuan, Yongang; Zhang, Yan; Liu, Dafu; Chu, Kaihui; Wang, Ling; Li, Xiangyang

    2009-07-01

    Ozone layer intensively absorbs 240nm to 285 nm incidence, when the sunshine goes through stratospheric. There is almost no UVC (200nm-280nm) band radiation existing below stratospheric. Because the radiation target presents a strong contrast between atmosphere and background, solar-blind band radiation is very useful. Wide band gap materials, especially III-V nitride materials, have attracted extensive interest. The direct band gap of GaN and A1N is 3.4 and 6.2 eV, respectively. Since they are miscible with each other and form a complete series of AlGaN alloys, AlGaN has direct band gaps from 3.4 to 6.2 eV, corresponding to cutoff wavelengths from 365 to 200 nm. A back-illuminated hybrid FPA has been developed by Shanghai Institute of Technical Physics Chinese Academy of Science. This paper reports the performance of the 128x128 solar-blind AlGaN UV Focal Plane Arrays (FPAs). More and more a CTIA (capacitivetransimpedance) readout circuit architecture has been proven to be well suited for AlGaN detectors arrays. The bared readout circuit was first tested to find out optimal analog reference voltage. Second, this ROIC was tested in a standard 20-pin shielded dewar at 115 K to 330K. Then, a new test system was set up to obtain test UV FPA noise, swing voltage, data valid time, operating speed, dynamic range, UV response etc. The results show that 128x128 back-illuminated AlGaN PIN detector SNR is as high as 74db at the speed of above30 frame per second. Also, some noise test method is mentioned.

  9. Analysis of 128 Cases With Tuberculous Pleurisy

    Directory of Open Access Journals (Sweden)

    Levent Akyıldız

    2007-01-01

    Full Text Available In our country, most common form of extrapulmonary tuberculosis is tuberculous pleurisy. The mean age of patients is increasing to older age in developed countries in last 50 years but tuberculosis is still the illness of early ages in developing countries. We aimed to evaluate retrospectively clinical, radiological and laboratory findings and diagnostic methods of 128 patients with tuberculous pleurisy who were diagnosed as tuberculosis, between 1999 and 2005 in this study. Seventy six patients of all (%59 were males and fifty two cases were females(41% and mean age of all patients was 39±12 (15-74 year. Pleural adenosine deaminase level was evaluted in 19 patients and mean level of them was 62±23.7 IU/L. Most common symptoms were chest pain and cough. Tuberculosis pleurisy was unilateral in 97.6% of patients. Parenchymal infiltration on Chest X-ray was observed in 18 % of cases. Most common diagnostic method was (used pleural biopsy in 82% of patients. In conclusion, tuberculosis pleurisy is usually the diseases of young adults. In almost all of the patients, pleural effusion was unilateral and closed pleural biopsy presented high rates of diagnosis in a short time.

  10. Quadrupole collectivity in {sup 128}Cd

    Energy Technology Data Exchange (ETDEWEB)

    Boenig, Esther Sabine

    2014-07-07

    The regions around shell closures, especially around doubly magic nuclei, are of major interest in nuclear structure physics, as they provide a perfect test for nuclear structure theory. The neutron-rich Cd isotopes in the region of {sup 132}Sn are only two protons away from the shell closure at Z=50 and in close proximity to the N=82 magic number. Nevertheless they show an irregular behaviour regarding the excitation energy of the first excited 2{sup +} state. This is not reproduced by shell model calculations, which is astonishing due to the proximity of the shell closures. In order to shed light on the much discussed region around doubly magic {sup 132}Sn, a Coulomb excitation experiment of {sup 128}Cd has been performed at REX-ISOLDE, CERN. The reduced transition strength B(E2;0{sup +}{sub gs} → 2{sup +}{sub 1}), which is a measure of collectivity, and the spectroscopic quadrupole moment Q{sub s}(2{sup +}{sub 1}) as a measure of deformation could be determined for the first time. The results are shown as the continuation of already measured neutron-rich Cd isotopes and are compared to both beyond mean field and shell model calculations, which give different predictions for these observables.

  11. X-ray Induced Luminescence Spectroscopy of Samarium Doped Barium Sulfate Prepared by Sintering Method

    Science.gov (United States)

    Kumeda, T.; Maeda, K.; Shirano, Y.; Fujiwara, K.; Sakai, K.; Ikari, T.

    2015-06-01

    X-ray induced luminescence (XL) properties of phosphor materials made of samarium doped barium sulfate have been investigated. The samples were prepared by sintering method heated at 900-1250 °C for 3 hours in air from the mixture of BaSO4 and Sm2O3. The concentration of Sm were prepared from 0.01-6 at.%. In as-prepared sample, the Sm3+ was detected by photoluminescence (PL). The PL intensity is maximum about 2 at.% with Sm, and then starts decreasing. The PL intensity showed concentration quenching. The XL observed Sm2+ and Sm3+ ions. The XL was shown from the sample sintered up to 1200 °C. The XL intensity increased with Sm concentration up to 1 at.%. The intensity was almost constant larger than 1 at.% Sm. These concentration dependences is different since the X-ray energy absorbed to the host material at once, and the energy transferred to both Sm3+ and Sm2+ ions. Sm doped BaSO4 is found a host for XL phosphor materials.

  12. High-κ Samarium-Based Metal-Organic Framework for Gate Dielectric Applications.

    Science.gov (United States)

    Pathak, Abhishek; Chiou, Guan Ru; Gade, Narsinga Rao; Usman, Muhammad; Mendiratta, Shruti; Luo, Tzuoo-Tsair; Tseng, Tien Wen; Chen, Jenq-Wei; Chen, Fu-Rong; Chen, Kuei-Hsien; Chen, Li-Chyong; Lu, Kuang-Lieh

    2017-07-05

    The self-assembly of a samarium-based metal-organic framework [Sm2(bhc)(H2O)6]n (1) in good yield was achieved by reacting Sm(NO3)3·6H2O with benzenehexacarboxylic acid (bhc) in a mixture of H2O-EtOH under hydrothermal conditions. A structural analysis showed that compound 1 crystallized in a space group of Pnmn and adopted a 3D structure with (4,8) connected nets. Temperature dependent dielectric measurements showed that compound 1 behaves as a high dielectric material with a high dielectric constant (κ = 45.1) at 5 kHz and 310 K, which is comparable to the values for some of the most commonly available dielectric inorganic metal oxides such as Sm2O3, Ta2O5, HfO2, and ZrO2. In addition, electrical measurements of 1 revealed an electrical conductivity of about 2.15 × 10-7 S/cm at a frequency of 5 kHz with a low leakage current (Ileakage = 8.13 × 10-12 Amm-2). Dielectric investigations of the Sm-based MOF provide an effective path for the development of high dielectric materials in the future.

  13. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  14. Characterization of luminescent samarium doped HfO{sub 2} coatings synthesized by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Chacon-Roa, C [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Guzman-Mendoza, J [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Aguilar-Frutis, M [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Garcia-Hipolito, M [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Alvarez-Fragoso, O [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Falcony, C [Departamento de Fisica, CINVESTAV-IPN, A. P. 14-740, 07000 Mexico D.F. (Mexico)

    2008-01-07

    Trivalent samarium (Sm{sup 3+}) doped hafnium oxide (HfO{sub 2}) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO{sub 2} monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO{sub 2} : SmCl{sub 3} films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm{sup 3+} ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed.

  15. Samarium-153 EDTMP for metastatic bone pain palliation: the impact of europium impurities.

    Science.gov (United States)

    Kalef-Ezra, J A; Valakis, S T; Pallada, S

    2015-02-01

    To evaluate the impact on the radiation protection policies of the radiocontaminants in Samarium-153 ethylenediamine tetramethylene phosphonate ((153)Sm-EDTMP). The internal contamination of patients treated with (153)Sm-EDMTP for palliation of painful disseminated multiple bone metastases due to long-lived impurities was assessed by direct measurements. These measurements were coupled with dose-rate measurements close to their bodies and spectroscopic analysis of the residual activity in post-treatment radiopharmaceutical vials. Whole-body counting carried out in six patients showed a 30-81-kBq europium -152 plus europium-154 contamination. The 0.85 mean (152)Eu- to -(154)Eu activity ratio obtained by direct counting was similar to that assessed by analysis of post-treatment residual activities in twelve radiopharmaceutical vials following radiopharmaceutical injection. The long-lived radiocontaminants in the patient's bodies and the treatment wastes require modifications of the applicable radiation protection policies. Copyright © 2014 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  16. Luminescence of trivalent samarium ions in silver and tin co-doped aluminophosphate glass

    Science.gov (United States)

    Jiménez, José A.; Lysenko, Sergiy; Liu, Huimin; Sendova, Mariana

    2011-06-01

    This work presents the spectroscopic properties of trivalent samarium ions in a melt-quenched aluminophosphate glass containing silver and tin. Addition of 4 mol% of each Ag 2O and SnO into the glass system with 2 mol% Sm 2O 3 results in Sm 3+ ions luminescence under non-resonant UV excitation owing to energy transfer from single silver ions and/or twofold-coordinated Sn centers. Assessment of luminescence spectra and decay dynamics suggest the energy transfer mechanism to be essentially of the resonant radiative type. Moreover, a connection between the luminescent and structural properties of the rare-earth doped glass system was demonstrated. Raman spectroscopy characterization revealed that no significant variation in the glass matrix is induced by Sm 3+ doping at the concentration employed. A comparison was made with a structural study performed on the Eu 3+ doped system (containing 2 mol% Eu 2O 3 along with 4 mol% of each Ag 2O and SnO) where the radiative energy transfer mechanism was previously established. The data appears consistent regarding the lack of variation in glass structure upon the Eu 3+ and Sm 3+ doping in connection with the dominance of the radiative transfer in the matrix. Thermal treatment of the material leads to precipitation of Ag nanoparticles of a broad size range inside the dielectric as observed by transmission electron microspcopy. Assessment of 4G 5/2 excited state decay in Sm 3+ ions shows no influence from the silver particles.

  17. Samarium (III) adsorption on bentonite modified with N-(2-hydroxyethyl) ethylenediamine.

    Science.gov (United States)

    Li, Dandan; Chang, Xijun; Hu, Zheng; Wang, Qihui; Li, Ruijun; Chai, Xiaoli

    2011-02-15

    A new material has been synthesized using dry process to activate bentonite followed by N-(2-hydroxyethyl) ethylenediamine connecting chlorosilane coupling agent. The synthesized new material was characterized by elemental analysis, FT-IR and thermogravimetry which proved that bentonite was successfully modified. The most interesting trait of the new material was its selective adsorption for rare earth elements. A variety of conditions of the new material were investigated for adsorption. The optimal conditions were determined with respect to pH and shaking time. Samarium (Sm) was quantitatively adsorbed at pH 4 and shaking time of 2 min onto the new material. Under these conditions the maximum static adsorption capacity of Sm(III) was found to be 17.7 mg g(-1). The adsorbed Sm(III) ion were quantitatively eluted by 2.0 mL 0.1 mol L(-1) HCl and 5% CS (NH(2))(2) solution. According to IUPAC definition, the detection limit (3σ) of this method was 0.60 ng mL(-1). The relative standard deviation (RSD) under optimum conditions was less than 3% (n=8). The new material also was applied for the preconcentration of trace Sm(III) in environmental samples with satisfactory results. Copyright © 2010 Elsevier B.V. All rights reserved.

  18. 45 CFR 96.128 - Requirements regarding human immunodeficiency virus.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Requirements regarding human immunodeficiency virus. 96.128 Section 96.128 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL... human immunodeficiency virus. (a) In the case of a designated State as described in paragraph (b) of...

  19. 41 CFR 128-50.101 - Inventory records.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Inventory records. 128... Seized Personal Property § 128-50.101 Inventory records. Each bureau shall be responsible for establishing and maintaining inventory records of its seized personal property to ensure that: (a) The date the...

  20. 41 CFR 128-1.5003 - Primary authority and responsibility.

    Science.gov (United States)

    2010-07-01

    ..., leadership, and general supervision in the development and administration of an effective and efficient... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Primary authority and responsibility. 128-1.5003 Section 128-1.5003 Public Contracts and Property Management Federal Property...

  1. 34 CFR 303.128 - Traditionally underserved groups.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Traditionally underserved groups. 303.128 Section 303.128 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND...

  2. 29 CFR 452.128 - Under-strength representation.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Under-strength representation. 452.128 Section 452.128 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR... representation. A local union may elect fewer delegates than it is permitted under the union constitution as long...

  3. 42 CFR 436.128 - Coverage for certain qualified aliens.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Coverage for certain qualified aliens. 436.128... Mandatory Coverage of the Categorically Needy § 436.128 Coverage for certain qualified aliens. The agency... § 440.255(c) of this chapter to those aliens described in § 436.406(c) of this subpart. ...

  4. 22 CFR 128.3 - Institution of Administrative Proceedings.

    Science.gov (United States)

    2010-04-01

    ....3 Section 128.3 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS ADMINISTRATIVE PROCEDURES § 128.3 Institution of Administrative Proceedings. (a) Charging letters. The Managing..., Department of State, may initiate proceedings to impose debarment or civil penalties in accordance with § 127...

  5. 45 CFR 147.128 - Rules regarding rescissions.

    Science.gov (United States)

    2010-10-01

    ....128 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS HEALTH INSURANCE REFORM REQUIREMENTS FOR THE GROUP AND INDIVIDUAL HEALTH INSURANCE MARKETS § 147.128 Rules regarding rescissions. (a) Prohibition on rescissions—(1) A group health plan, or a health...

  6. 19 CFR 128.11 - Express consignment carrier application process.

    Science.gov (United States)

    2010-04-01

    ... with U.S. Immigration and Customs Enforcement (ICE). (iii) Provide, without cost to the Government... 19 Customs Duties 1 2010-04-01 2010-04-01 false Express consignment carrier application process. 128.11 Section 128.11 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND...

  7. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  8. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Science.gov (United States)

    Mandiwana, Vusani; Kalombo, Lonji; Venter, Kobus; Sathekge, Mike; Grobler, Anne; Zeevaart, Jan Rijn

    2015-09-01

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly( d, l-lactide- co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([153Sm]Sm2O3) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive 153Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The 153Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [153Sm]Sm2O3 loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [153Sm]Sm2O3-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  9. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  10. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 keV. This...

  11. Optical response and magnetic characteristic of samarium doped zinc phosphate glasses containing nickel nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Azmi, Siti Amlah M.; Sahar, M.R., E-mail: mrahim057@gmail.com

    2015-11-01

    A magnetic glass of composition 40ZnO–(58−x) P{sub 2}O{sub 5}–1Sm{sub 2}O{sub 3}–xNiO, with x=0.0, 1.0, 1.5 and 2.0 mol% is prepared by melt-quenching technique. The glass is characterized by X-ray diffraction, high-resolution transmission electron microscope (HRTEM), photoluminescence (PL) spectroscopy and vibrating sample magnetometer (VSM) analysis. The X-rays diffraction confirms the amorphous nature of the glass while the HRTEM analysis reveals the presence of nickel nanoparticles in the glass samples. High-resolution TEM reveals that the lattice spacing of nickel nanoparticles is 0.35 nm at (100) plane. Photoluminescence emission shows the existence of four peaks that correspond to the transition from the upper level of {sup 4}G{sub 5/2} to the lower level of {sup 6}H{sub 5/2}, {sup 6}H{sub 7/2}, {sup 6}H{sub 9/2,} and {sup 6}H{sub 11/2.} It is observed that all peaks experience significant quenching effect with the increasing concentration of nickel nanoparticles, suggesting a strong energy transfer from excited samarium ions to the nickel ions. The glass magnetization and susceptibility at 12 kOe at room temperature are found to be in the range of (3.87±0.17×10{sup −2}–7.19±0.39×10{sup −2}) emu/g and (3.24±0.16×10{sup −6}–5.99±0.29×10{sup −6}) emu/Oe g respectively. The obtained hysteresis curve indicates that the glass samples are paramagnetic materials. The studied glass can be further used towards the development of magneto-optical functional glass. - Highlights: • Sm{sup 3+} doped zinc phosphate glass embedded with Ni NPs has been prepared. • The Laue pattern and lattice spacing of Ni NPs are confirmed by HRTEM image. • The magnetic response of glasses has been studied through VSM analysis. • Enhancement factor and decay half-lifetime are investigated.

  12. Treatment of bone pain secondary to metastases using samarium-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Elba Cristina Sá de Camargo Etchebehere

    Full Text Available CONTEXT: More than 50% of patients with prostate, breast or lung cancer will develop painful bone metastases. The purpose of treating bone metastases is to relieve pain, reduce the use of steroids and to maintain motion. OBJECTIVE: To evaluate the use of samarium-153-EDTMP (153Sm-EDTMP for the treatment of bone pain secondary to metastases that is refractory to clinical management. TYPE OF STUDY: Retrospective. SETTING: Division of Nuclear Medicine, Universidade Estadual de Campinas (Unicamp. METHODS: Fifty-eight patients were studied (34 males with mean age 62 years; 31 patients had prostate cancer, 20 had breast cancer, three had lung cancer, one had lung hemangioendothelioma, one had parathyroid adenocarcinoma, one had osteosarcoma and one had an unknown primary tumor. All patients had multiple bone metastases demonstrated by bone scintigraphy using 99mTc-MDP,and were treated with 153Sm-EDTMP. Response to treatment was graded as good (pain reduction of 50-100%, intermediate (25-49% and poor (0-24%. RESULTS: All patients showed good uptake of 153Sm-EDTMP by bone metastases. Among the patients with prostate cancer, intermediate or good response to therapy occurred in 80.6% (25 patients and poor response in 19.4% (6. Among the patients with breast cancer, 85% (17 showed intermediate or good response to therapy while 15% (3 showed poor response. All three patients with lung cancer showed poor response to treatment. The lung hemangioendothelioma and unknown primary lesion patients showed intermediate response to treatment; the osteosarcoma and parathyroid adenocarcinoma patients showed good response to treatment. No significant myelotoxicity occurred. DISCUSSION: Pain control is important for improving the quality of life of patients with advanced cancers. The mechanism by which pain is relieved with the use of radionuclides is still not yet completely understood, however, the treatment is simple and provides a low risk of mielotoxicity

  13. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  14. A 128 x 128 InGaAs detector array for 1.0 - 1.7 microns

    Science.gov (United States)

    Olsen, G.; Joshi, A.; Lange, M.; Woodruff, K.; Mykietyn, E.; Gay, D.; Ackley, D.; Erickson, G.; Ban, V.; Staller, C.

    1990-01-01

    A two-dimensional 128 x 128 detector array for the 1.0 - 1.7 micron spectral region has been demonstrated with indium gallium arsenide. The 30 micron square pixels had 60 micron spacing in both directions and were designed to be compatible with a 2D Reticon multiplexer. Dark currents below 100 pA, capacitance near 0.1 pF, and quantum efficiencies above 80 percent were measured. Probe maps of dark current and quantum efficiency are presented along with pixel dropout data and wafer yield which was as high as 99.89 percent (7 dropouts) in an area of 6528 pixels and 99.37 percent (103 dropouts) over an entire 128 x 128 pixel region.

  15. Antistaphylococcal activity of bacteriophage derived chimeric protein P128

    Directory of Open Access Journals (Sweden)

    Vipra Aradhana A

    2012-03-01

    Full Text Available Abstract Background Bacterial drug resistance is one of the most significant challenges to human health today. In particular, effective antibacterial agents against methicillin-resistant Staphylococcus aureus (MRSA are urgently needed. A causal relationship between nasal commensal S. aureus and infection has been reported. Accordingly, elimination of nasal S. aureus reduces the risk of infection. Enzymes that degrade bacterial cell walls show promise as antibacterial agents. Bacteriophage-encoded bacterial cell wall-degrading enzymes exhibit intrinsic bactericidal activity. P128 is a chimeric protein that combines the lethal activity of the phage tail-associated muralytic enzyme of Phage K and the staphylococcal cell wall targeting-domain (SH3b of lysostaphin. Here we report results of in vitro studies evaluating the susceptibility of staphylococcal strains to this novel protein. Results Using the broth microdilution method adapted for lysostaphin, we found that P128 is effective against S. aureus clinical strains including MRSA, methicillin-sensitive S. aureus (MSSA, and a mupirocin-resistant S. aureus. Minimum bactericidal concentrations and minimum inhibitory concentrations of P128 (1-64 μg/mL were similar across the 32 S. aureus strains tested, demonstrating its bactericidal nature. In time-kill assays, P128 reduced colony-forming units by 99.99% within 1 h and inhibited growth up to 24 h. In an assay simulating topical application of P128 to skin or other biological surfaces, P128 hydrogel was efficacious when layered on cells seeded on solid media. P128 hydrogel was lethal to Staphylococci recovered from nares of healthy people and treated without any processing or culturing steps, indicating its in situ efficacy. This methodology used for in vitro assessment of P128 as an agent for eradicating nasal carriage is unique. Conclusions The novel chimeric protein P128 is a staphylococcal cell wall-degrading enzyme under development for

  16. Effect of Current Density on Thermodynamic Properties of Nanocrystalline Palladium Capped Samarium Hydride Thin Film Switchable Mirrors

    Directory of Open Access Journals (Sweden)

    Pushpendra Kumar

    2007-01-01

    Full Text Available A 55 nm samarium film capped with a 10 nm palladium overlayer switched from a metallic reflecting to a semiconducting, transparent in visible state during ex-situ hydrogen loading via electrochemical means in 1 M KOH electrolytic aqueous solution at room temperature. The switching between metal to semiconductor was accompanied by measurement of transmittance during hydrogen loading/unloading. The effect of current density on switching and thermodynamic properties was studied between dihydride state (FCC phase and trihydride state (hexagonal phase. From the plateau of partial pressure of hydrogen at x=2.6, enthalpy of formation was calculated at different current densities. The diffusion coefficients and switching kinetics are shown to depend on applied current density.

  17. Targeted bone marrow radioablation with 153Samarium-lexidronam promotes allogeneic hematopoietic chimerism and donor-specific immunologic hyporesponsiveness.

    Science.gov (United States)

    Inverardi, Luca; Linetsky, Elina; Pileggi, Antonello; Molano, R Damaris; Serafini, Aldo; Paganelli, Giovanni; Ricordi, Camillo

    2004-03-15

    Transplantation tolerance, defined as acceptance of a graft by an otherwise fully immunocompetent host, has been an elusive goal. Although robust tolerance has been achieved by the induction of stable hematopoietic chimerism after bone marrow transplantation, lethal or sublethal radiation conditioning used to induce long-term chimerism precludes its clinical use. We studied whether targeted delivery of radiation to bone marrow could allow for bone marrow cell (BMC) engraftment, chimerism, and donor-specific tolerance in the absence of the side effects associated with external irradiation. We administered a radioactive bone-seeking compound (Samarium-Lexidronam, Quadramet, Berlex Laboratories, Wayne, NJ) together with transient T-cell costimulatory blockade to recipient mice. Allogeneic BMCs were given 7 or 14 days after preconditioning. Costimulatory blockade was obtained by the use of an anti-CD154 antibody for 4 weeks. Chimerism was assessed by flow cytometry. Mice then received donor-specific and third-party skin grafts. Graft survival was analyzed with mechanisms of donor-specific hyporesponsiveness. High levels of stable chimerism across an allogeneic barrier were achieved in mice by a single administration of Samarium-Lexidronam, transient T-cell costimulatory blockade, and BMC transplantation. A large percentage of chimeric animals retained donor-derived skin grafts for more than 120 days without requiring additional immunosuppression, suggesting that harsh cytotoxic preconditioning is not necessary to achieve stable chimerism and donor specific hyporesponsiveness. Analysis of the T-cell repertoire in chimeras indicates T-cell deletional mechanisms. These data broaden the potential use of BMC transplantation for tolerance induction and argue for its potential in treating autoimmune diseases.

  18. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  19. Thermal imager based on the array light sensor device of 128×128 CdHgTe-photodiodes

    Directory of Open Access Journals (Sweden)

    Reva V. P.

    2010-08-01

    Full Text Available The results of investigation of developed thermal imager for middle (3—5 µm infrared region are presented and its applications features are discussed. The thermal imager consists of cooled to 80 K 128×128 diodes focal plane array on the base of cadmium–mercury–telluride compound and cryostat with temperature checking system. The photodiode array is bonded with readout device (silicon focal processor via indium microcontacts. The measured average value of noise equivalent temperature difference was NETD= 20±4 mK (background radiation temperature T = 300 K, field of view 2θ = 180°, the cooled diaphragm was not used.

  20. Phenotype abnormality: 128 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 128 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u634i decreased efficiency...t intensity regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u33i ... decreased efficiency ... growth ...

  1. 9 CFR 381.128 - Labels in foreign languages.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Labels in foreign languages. 381.128... in foreign languages. Any label to be affixed to a container of any dressed poultry or other poultry product for foreign commerce may be printed in a foreign language. However, the official inspection legend...

  2. 22 CFR 128.10 - Disposition of proceedings.

    Science.gov (United States)

    2010-04-01

    ....10 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS ADMINISTRATIVE PROCEDURES § 128.10 Disposition of proceedings. Where the evidence is not sufficient to support the charges... provided in § 127.7 of this subchapter, impose a civil penalty as provided in § 127.10 of this subchapter...

  3. 14 CFR 21.128 - Tests: aircraft engines.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Tests: aircraft engines. 21.128 Section 21... engines. (a) Each person manufacturing aircraft engines under a type certificate only shall subject each engine (except rocket engines for which the manufacturer must establish a sampling technique) to an...

  4. 31 CFR 128.11 - Purpose of reports.

    Science.gov (United States)

    2010-07-01

    ... INTERNATIONAL CAPITAL AND FOREIGN-CURRENCY TRANSACTIONS AND POSITIONS Reports on International Capital Transactions and Positions § 128.11 Purpose of reports. Reports on international capital transactions and positions provide timely and reliable information on international portfolio capital movements by U.S...

  5. 37 CFR 2.128 - Briefs at final hearing.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Procedure in Inter Partes Proceedings § 2.128... index of cited cases. Without prior leave of the Trademark Trial and Appeal Board, a main brief on the... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Briefs at final hearing. 2...

  6. 41 CFR 128-1.8005 - Seismic safety standards.

    Science.gov (United States)

    2010-07-01

    ... Congress (SBCC) Standard Building Code (SBC). (b) The seismic design and construction of a covered building... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Seismic safety standards... Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.80-Seismic Safety Program § 128-1.8005...

  7. Phenotype-gene: 128 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 128 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1126i decreased efficiency...Cell 19(4):1347-61. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17449806i decreased efficiency

  8. Crystal growth of semiorganic complex- samarium chloride coordinated thiourea-L-tartaric acid and its studies on structure and optical characteristics

    Science.gov (United States)

    Slathia, Goldy; Singh, Harjinder; Ramya, E.; Rao, D. Narayana; Bamzai, K. K.

    2017-05-01

    The semi-organic complex of samarium chloride coordinated thiourea-L-tartaric acid (SCTLT) has been grown as a single crystal by slow evaporation technique at room temperature. For structural studies, the grown crystal was subjected to single crystal X-ray diffraction and Fourier transform infra-red (FTIR) spectroscopy. Low cut off wavelength and transparent characteristics were explored by UV-VIS optical characterization. Third-order nonlinear optical properties of grown crystal were investigated by Z-scan technique.

  9. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J.C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  10. Trace amounts of rare earth elements in high purity samarium oxide by sector field inductively coupled plasma mass spectrometry after separation by HPLC

    Energy Technology Data Exchange (ETDEWEB)

    Pedreira, W.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil) and Fundacao Jorge Duprat Figueiredo de Seguranca e Medicina do Trabalho (FUNDACENTRO), 05409-002 Sao Paulo, SP (Brazil)]. E-mail: walter.pedreira@fundacentro.gov.br; Queiroz, C.A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Abrao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Rocha, S.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Vasconcellos, M.E. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Boaventura, G.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil); Pimentel, M.M. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil)

    2006-07-20

    Today there is an increasing need for high purity rare earth compounds in various fields, the optical, the electronics, the ceramic, the nuclear and geochemistry. Samarium oxide has special uses in glass, phosphors, lasers and thermoelectric devices. Calcium chloride crystals treated with samarium have been employed in lasers, which produce light beams intense enough to burn metal. In general, the inductively coupled plasma mass spectrometry (ICP-MS) presents some advantages for trace element analysis, due to high sensitivity and resolution, when compared with other analytical techniques such as ICP optical emission spectrometry (ICP-OES). In this work, sector field inductively coupled plasma mass spectrometry was used. Sixteen elements (Sc, Y and 14 lanthanides) were determined selectively with the ICP-MS system using a concentration gradient method. The detection limits with the ICP-MS system were about 0.2 (La) pg mL{sup -1} to 8 (Gd) pg mL{sup -1}. The %R.S.D. of the methods varying between 0.9 and 1.5% for a set of five (n = 5) replicates was found for the IPEN's material and for the certificate reference sample. Determination of trace REEs in two high pure samarium oxides samples (IPEN and JMC) was performed. IPEN's material is highly pure (>99.99%) and was successfully analyzed without spectral interference (MO{sup +} and MOH{sup +})

  11. High resolution imaging of the Venus night side using a Rockwell 128x128 HgCdTe array

    Science.gov (United States)

    Hodapp, K.-W.; Sinton, W.; Ragent, B.; Allen, D.

    1989-01-01

    The University of Hawaii operates an infrared camera with a 128x128 HgCdTe detector array on loan from JPL's High Resolution Imaging Spectrometer (HIRIS) project. The characteristics of this camera system are discussed. The infrared camera was used to obtain images of the night side of Venus prior to and after inferior conjunction in 1988. The images confirm Allen and Crawford's (1984) discovery of bright features on the dark hemisphere of Venus visible in the H and K bands. Our images of these features are the best obtained to date. Researchers derive a pseudo rotation period of 6.5 days for these features and 1.74 microns brightness temperatures between 425 K and 480 K. The features are produced by nonuniform absorption in the middle cloud layer (47 to 57 Km altitude) of thermal radiation from the lower Venus atmosphere (20 to 30 Km altitude). A more detailed analysis of the data is in progress.

  12. Micron MT29F128G08AJAAA 128GB Asynchronous Flash Memory Total Ionizing Dose Characterization Test Report

    Science.gov (United States)

    Campola, Michael; Wyrwas, Edward

    2017-01-01

    The purpose of this test was to characterize the Micron MT29F128G08AJAAAs parameter degradation for total dose response and to evaluate and compare lot date codes for sensitivity. In the test, the device was exposed to both low dose and high dose rate (HDR) irradiations using gamma radiation. Device parameters such as leakage currents, quantity of upset bits and overall chip and die health were investigated to determine which lot is more robust.

  13. Isovector states in /sup 128-134/Ba

    Energy Technology Data Exchange (ETDEWEB)

    Harter, H.; Lipas, P.O.; Nojarov, R.; Taigel, T.; Faessler, A.

    1988-04-28

    Phenomenological IBA-2 and microscopic QRPA are applied to predict isovector, or mixed-symmetry, states in /sup 128-134/Ba. The lowest 1/sup +/ state is found at 2.6-3.2 MeV with B(M1)arrow up approx. = 0.1-0.4 ..mu../sub N//sup 2/. IBA predictions are also given for the lowest mixed 2/sup +/ state at 2.2-2.7 MeV. A very strong (up to 5 ..mu../sub N//sup 2/) 1/sup +/ doublet is predicted (QRPA) at 4.7 MeV in /sup 130-134/Ba.

  14. Effectiveness of radiation synovectomy with samarium-{sup 153} particulate hydroxyapatite in rheumatoid arthritis patients with knee synovitis: a controlled randomized double-blind trial

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Marla Francisca dos; Furtado, Rita Nely Vilar; Konai, Monique Sayuri; Natour, Jamil, E-mail: jnatour@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Reumatologia; Castiglioni, Mario Luiz Vieira; Marchetti, Renata Rosa [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Medicina Nuclear

    2009-07-01

    Objectives: the aim of the present study was to investigate the effectiveness of Samarium{sup 153}-particulate hydroxyapatite radiation synovectomy in rheumatoid arthritis patients with chronic knee synovitis. Methods: fifty-eight rheumatoid arthritis patients (60 knees) with chronic knee synovitis participated in a controlled double-blinded trial. Patients were randomized to receive either an intra-articular injection with 40 mg triamcinolone hexacetonide alone (TH group) or 40 mg triamcinolone hexacetonide combined with 15 mCi Samarium{sup 153}-particulate hydroxyapatite (Sm/TH group). Blinded examination at baseline (T0) and at 1 (T1), 4 (T4), 12 (T12), 32 (T32), and 48 (T48) weeks post-intervention were performed on all patients and included a visual analog scale for joint pain and swelling as well as data on morning stiffness, flexion, extension, knee circumference, Likert scale of improvement, percentage of improvement, SF-36 generic quality of life questionnaire, Stanford Health Assessment Questionnaire (HAQ), Lequesne index, use of non-steroidal anti-inflammatory drugs or oral corticosteroids, events and adverse effects, calls to the physician, and hospital visits. Results: the sample was homogeneous at baseline, and there were no withdrawals. Improvement was observed in both groups in relation to T0, but no statistically significant differences between groups were observed regarding all variables at the time points studied. The Sm/TH group exhibited more adverse effects at T1 (p<0.05), but these were mild and transitory. No severe adverse effects were reported during follow-up. Conclusion: intra-articular injection of Samarium{sup 153}-particulate hydroxyapatite (15 mCi) with 40 mg of triamcinolone hexacetonide is not superior to triamcinolone hexacetonide alone for the treatment of knee synovitis in patients with rheumatoid arthritis at 1 y of follow-up. (author)

  15. A 128 Multiplexing Factor Time-Domain SQUID Multiplexer

    Science.gov (United States)

    Prêle, D.; Voisin, F.; Piat, M.; Decourcelle, T.; Perbost, C.; Chapron, C.; Rambaud, D.; Maestre, S.; Marty, W.; Montier, L.

    2016-07-01

    A cryogenic 128:1 Time-Domain Multiplexer (TDM) has been developed for the readout of kilo-pixel Transition Edge Sensor (TES) arrays dedicated to the Q&U Bolometric Interferometer for Cosmology (QUBIC) instrument which aims to measure the B-mode polarization of the Cosmic Microwave Background. Superconducting QUantum Interference Devices (SQUIDs) are usually used to read out TESs. Moreover, SQUIDs are used to build TDM by biasing sequentially the SQUIDs connected together—one for each TES. In addition to this common technique which allows a typical 32 multiplexing factor, a cryogenic integrated circuit provides a 4:1 second multiplexing stage. This cryogenic integrated circuit is one of the original part of our TDM achieving an unprecedented 128 multiplexing factor. We present these two dimension TDM stages: topology of the SQUID multiplexer, operation of the cryogenic integrated circuit, and integration of the full system to read out a TES array dedicated to the QUBIC instrument. Flux-locked loop operation in multiplexed mode is also discussed.

  16. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  17. Neutron Activated Samarium-153 Microparticles for Transarterial Radioembolization of Liver Tumour with Post-Procedure Imaging Capabilities

    Science.gov (United States)

    Hashikin, Nurul Ab. Aziz; Yeong, Chai-Hong; Abdullah, Basri Johan Jeet; Ng, Kwan-Hoong; Chung, Lip-Yong; Dahalan, Rehir; Perkins, Alan Christopher

    2015-01-01

    Introduction Samarium-153 (153Sm) styrene divinylbenzene microparticles were developed as a surrogate for Yttrium-90 (90Y) microspheres in liver radioembolization therapy. Unlike the pure beta emitter 90Y, 153Sm possess both therapeutic beta and diagnostic gamma radiations, making it possible for post-procedure imaging following therapy. Methods The microparticles were prepared using commercially available cation exchange resin, Amberlite IR-120 H+ (620–830 μm), which were reduced to 20–40 μm via ball mill grinding and sieve separation. The microparticles were labelled with 152Sm via ion exchange process with 152SmCl3, prior to neutron activation to produce radioactive 153Sm through 152Sm(n,γ)153Sm reaction. Therapeutic activity of 3 GBq was referred based on the recommended activity used in 90Y-microspheres therapy. The samples were irradiated in 1.494 x 1012 n.cm-2.s-1 neutron flux for 6 h to achieve the nominal activity of 3.1 GBq.g-1. Physicochemical characterisation of the microparticles, gamma spectrometry, and in vitro radiolabelling studies were carried out to study the performance and stability of the microparticles. Results Fourier Transform Infrared (FTIR) spectroscopy of the Amberlite IR-120 resins showed unaffected functional groups, following size reduction of the beads. However, as shown by the electron microscope, the microparticles were irregular in shape. The radioactivity achieved after 6 h neutron activation was 3.104 ± 0.029 GBq. The specific activity per microparticle was 53.855 ± 0.503 Bq. Gamma spectrometry and elemental analysis showed no radioactive impurities in the samples. Radiolabelling efficiencies of 153Sm-Amberlite in distilled water and blood plasma over 48 h were excellent and higher than 95%. Conclusion The laboratory work revealed that the 153Sm-Amberlite microparticles demonstrated superior characteristics for potential use in hepatic radioembolization. PMID:26382059

  18. 22 CFR 128.9 - Proceedings before and report of Administrative Law Judge.

    Science.gov (United States)

    2010-04-01

    ... Rules of Civil Procedure. The record may be made available in any other administrative or other... Law Judge. 128.9 Section 128.9 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS ADMINISTRATIVE PROCEDURES § 128.9 Proceedings before and report of Administrative Law Judge. (a...

  19. 41 CFR 128-1.5002-7 - Property management officer (PMO).

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Property management officer (PMO). 128-1.5002-7 Section 128-1.5002-7 Public Contracts and Property Management Federal Property... Responsibilities for Personal Property Management § 128-1.5002-7 Property management officer (PMO). An individual...

  20. 17 CFR 1.28 - Appraisal of instruments purchased with customer funds.

    Science.gov (United States)

    2010-04-01

    ... purchased with customer funds. 1.28 Section 1.28 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION GENERAL REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Customers' Money, Securities, and Property § 1.28 Appraisal of instruments purchased with customer funds. Futures commission merchants who...

  1. 7 CFR 1942.128 - Borrower accounting methods, management reports and audits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 13 2010-01-01 2009-01-01 true Borrower accounting methods, management reports and audits. 1942.128 Section 1942.128 Agriculture Regulations of the Department of Agriculture (Continued... Rescue and Other Small Community Facilities Projects § 1942.128 Borrower accounting methods, management...

  2. 24 CFR 943.128 - How does a consortium carry out planning and reporting functions?

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false How does a consortium carry out planning and reporting functions? 943.128 Section 943.128 Housing and Urban Development Regulations... Consortia § 943.128 How does a consortium carry out planning and reporting functions? (a) During the term of...

  3. 45 CFR 148.128 - State flexibility in individual market reforms-alternative mechanisms.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false State flexibility in individual market reforms-alternative mechanisms. 148.128 Section 148.128 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES... Requirements Relating to Access and Renewability of Coverage § 148.128 State flexibility in individual market...

  4. 41 CFR 128-1.5007 - Reproduction of departmental and bureau seals.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reproduction of departmental and bureau seals. 128-1.5007 Section 128-1.5007 Public Contracts and Property Management Federal... and Responsibilities for Personal Property Management § 128-1.5007 Reproduction of departmental and...

  5. 42 CFR 423.128 - Dissemination of Part D plan information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Dissemination of Part D plan information. 423.128 Section 423.128 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Protections § 423.128 Dissemination of Part D plan information. (a) Detailed description. A Part D sponsor...

  6. 33 CFR 110.128d - Island of Oahu, Hawaii. (Datum: OHD)

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Oahu, Hawaii. (Datum: OHD) 110.128d Section 110.128d Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128d Island of Oahu, Hawaii. (Datum...

  7. Laparoscopy in 100 consecutive patients with 128 impalpable testes

    DEFF Research Database (Denmark)

    Cortes, D; Thorup, J M; Lenz, K

    1995-01-01

    OBJECTIVE: To investigate the value of laparoscopy in boys with impalpable testes, to carry out a histological examination of testicular biopsies or orchidectomy specimens, and to present a clinical description of boys with impalpable testes. PATIENTS AND METHODS: One hundred consecutive patients...... underwent laparoscopy for 128 impalpable testes. They ranged in age from 2.7 to 19.3 years (median 10.8). Histological examination was performed on 39 testicular biopsies, nine primarily orchidectomized testes and 13 tissue samples from the end of blind-ending vessels and vasa deferentia. Any additional...... diagnoses to that of impalpable testes were recorded. RESULTS: There were no complications associated with laparoscopy and the procedure clarified the situation in all patients. In 50% of patients either blind-ending cord structures above the internal inguinal ring or intra-abdominal testes were identified...

  8. Laparoskopi af 100 konsekutive patienter med 128 ikkepalpable testes

    DEFF Research Database (Denmark)

    Cortes, D; Thorup, J M; Lenz, K

    1996-01-01

    A cohort of 100 patients underwent laparoscopy for 128 impalpable testes. They ranged in age from 2.7 to 19.3 years (median 10.8 years). There were no complications associated with laparoscopy. In 50% of the cases either blindending cord structures above the internal inguinal ring or intra......-abdominal testes were identified; in the remainder, cord structures could be seen passing through the ring, indicating an intracanalicular testis. The impalpable testis was absent in 77% of patients with a contralateral scrotal testis. A seminoma was found in one 18.6-year-old patient with bilateral cryptorchidism....... No intratubular germ cell neoplasia (carcinoma in situ) was proved. Germ cell hypoplasia or aplasia was demonstrated in 95% of cases with testicular parenchyma. We recommend laparoscopy as a safe procedure which leads to a diagnosis in patients with impalpable testes; the advent of laparoscopic procedure makes...

  9. Possible Odd Parity State in {sup 128}Xe

    Energy Technology Data Exchange (ETDEWEB)

    Broman, L. [Department of Physics, Chalmers Univ. of Technology, Goeteborg (Sweden); Malmskog, S.G. [AB Atomenergi, Nykoeping (Sweden)

    1966-07-15

    Gamma lines in the decay of I have been measured by means of a Ge(Li) detector. The following gamma ray energies have been obtained: 442.5 {+-} 0.05, 526.5 {+-} 0.5, 742.4 {+-}1.0, 969.0 {+-} 1.0, and 1136.5 {+-}2.0 keV. The 1136.5 keV transition defines a level in {sup 128}Xe at 1579 {+-} 2 keV. From the log ft = 7.8 {+-} 0.3 of the ({beta}{sup -} feeding, this level is believed to have an odd parity. Upper limits of gamma ray intensities for transitions around eV are used to set a limit for the population of the expected 0{sup +} level originating from the two-phonon quadrupole vibration.

  10. 128 slice computed tomography dose profile measurement using thermoluminescent dosimeter

    Science.gov (United States)

    Salehhon, N.; Hashim, S.; Karim, M. K. A.; Ang, W. C.; Musa, Y.; Bahruddin, N. A.

    2017-05-01

    The increasing use of computed tomography (CT) in clinical practice marks the needs to understand the dose descriptor and dose profile. The purposes of the current study were to determine the CT dose index free-in-air (CTDIair) in 128 slice CT scanner and to evaluate the single scan dose profile (SSDP). Thermoluminescent dosimeters (TLD-100) were used to measure the dose profile of the scanner. There were three sets of CT protocols where the tube potential (kV) setting was manipulated for each protocol while the rest of parameters were kept constant. These protocols were based from routine CT abdominal examinations for male adult abdomen. It was found that the increase of kV settings made the values of CTDIair increased as well. When the kV setting was changed from 80 kV to 120 kV and from 120 kV to 140 kV, the CTDIair values were increased as much as 147.9% and 53.9% respectively. The highest kV setting (140 kV) led to the highest CTDIair value (13.585 mGy). The p-value of less than 0.05 indicated that the results were statistically different. The SSDP showed that when the kV settings were varied, the peak sharpness and height of Gaussian function profiles were affected. The full width at half maximum (FWHM) of dose profiles for all protocols were coincided with the nominal beam width set for the measurements. The findings of the study revealed much information on the characterization and performance of 128 slice CT scanner.

  11. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  12. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  13. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints.

    Science.gov (United States)

    Najeeb Al Hallak, Mohammed; McCurdy, Matt; Zouain, Nicolas; Hayes, Justin

    2009-08-28

    (153)Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate) and Samarium-153 [1]. (153)Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of (153)Sm-EDTMP leads to contamination with (154)Eu (Europium-154) [2]. A previous study only alluded to the retention of (154)Eu in the bones after receiving treatment with (153)Sm-EDTMP [2]. Activation of the alarm at security checkpoints after (153)Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received (153)Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA) activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing the American-Canadian border. We assume that the (154)Eu which remained in the patients' bones activated the sensors. METHODS: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received (153)Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. RESULTS: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of (154)Eu emissions. CONCLUSION: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of (154)Eu retained in patients who received (153)Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of (153)Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with (153)Sm-EDTMP at Roger Maris Cancer

  14. Formation of a new adduct based on fullerene tris-malonate samarium salt C60-[C60(=C(COO)2)3]Sm2

    Science.gov (United States)

    Petrov, A. A.; Keskinov, V. A.; Semenov, K. N.; Charykov, N. A.; Letenko, D. G.; Nikitin, V. A.

    2017-03-01

    Gram quantities of a new adduct based on light fullerene tris-malonate samarium salt C60 [C60(=C(COO)2)3]Sm2 are obtained via the reaction of ion exchange. The obtained adduct is studied by means of electron and infrared spectroscopy, X-ray and elemental analysis, electron microscopy, and thermogravimetry. The polythermal solubility of [C60(=C(COO)2)3]Sm2 in water is determined in ampoules via saturation within 20-70°C. The composition of crystalline hydrate [C60(=C(COO)2)3]Sm2 · 36H2O, which exists in equilibrium with the saturated solution, is estimated.

  15. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  16. Marrow irradiation with high-dose 153Samarium-EDTMP followed by chemotherapy and hematopoietic stem cell infusion for acute myelogenous leukemia.

    Science.gov (United States)

    Rodriguez, Vilmarie; Anderson, Peter M; Litzow, Mark R; Erlandson, Linda; Trotz, Barbara A; Arndt, Carola A S; Khan, Shakila P; Wiseman, Gregory A

    2006-08-01

    In four patients, aged 15 - 20 years, with high-risk acute myeloid leukemia (AML), high-dose samarium 153-labelled ethylenediaminetetramethylenephosphonate (153Sm-EDTMP) was used for targeted marrow irradiation before preparative chemotherapy conditioning regimens and allogeneic (three patients) or autologous (one patient) hematopoietic stem cell transplantation. The dose of 153Sm-EDTMP was 703 MBq/kg (n = 1) or 1110 MBq/kg (n = 3). No side-effects occurred during the 30-min infusion of 153Sm-EDTMP. Samarium - melphalan regimens were given to three patients; one had 153Sm-EDTMP - busulfan + cyclophosphamide. Total body radioactivity was below the 133 MBq safe limit before infusion of stem cells (day 14 after 153Sm-EDTMP). No hemorrhagic cystitis, nephrotoxicity or serious infections occurred. Leukocyte engraftment (white blood cell count >0.5 x 10(9)/l) occurred between 12 and 23 days after stem cell infusion (mean of 17 days). Complete cytogenetic and morphologic remission of AML was evident on follow-up marrow aspirate and biopsy specimens from all patients. In two of the four study patients, the disease remains in complete remission and the patients have an excellent quality of life (Eastern Cooperative Oncology Group performance status 0; no medications) and no organ toxicity more than 2 years and more than 4 years, respectively, after their blood and bone marrow transplantations. Thus, in adolescents and adults, 153Sm-EDTMP may provide a relatively simple and effective means for using irradiation to eliminate AML within the marrow.

  17. Optical signal processing up to 1.28 Tbits/s

    DEFF Research Database (Denmark)

    Mulvad, Hans Christian Hansen; Oxenløwe, Leif Katsuo; Galili, Michael

    2009-01-01

    Techniques for 640 Gbit/s optical signal processing are described, including demultiplexing, clock recovery, transmission, wavelength conversion, add-drop multiplexing, and timing-jitter tolerance. Demultiplexing at 1.28 Tbit/s is presented, with preliminary results for 1.28 Tbit/s transmission....

  18. Complete genome of Nitrosospira briensis C-128, an ammonia-oxidizing bacterium from agricultural soil

    NARCIS (Netherlands)

    Rice, Marlen C.; Norton, Jeanette M.; Valois, Frederica; Bollmann, Annette; Bottomley, Peter J.; Klotz, Martin G.; Laanbroek, Hendrikus J.; Suwa, Yuichi; Stein, Lisa Y.; Sayavedra-Soto, Luis; Woyke, Tanja; Shapiro, Nicole; Goodwin, Lynne A.; Huntemann, Marcel; Clum, Alicia; Pillay, Manoj; Kyrpides, Nikos; Varghese, Neha; Mikhailova, Natalia; Markowitz, Victor; Palaniappan, Krishna; Ivanova, Natalia; Stamatis, Dimitrios; Reddy, T. B. K.; Ngan, Chew Yee; Daum, Chris

    2016-01-01

    Nitrosospira briensis C-128 is an ammonia-oxidizing bacterium isolated from an acid agricultural soil. N. briensis C-128 was sequenced with PacBio RS technologies at the DOE-Joint Genome Institute through their Community Science Program (2010). The high-quality finished genome contains one

  19. Transcription pattern of UL131A-128 mRNA in clinical strains of ...

    Indian Academy of Sciences (India)

    Mean while, clones containing UL131A-128 transcripts in an HCMV cDNA library of a clinical strain were selected and sequenced. It was demonstrated that UL131A-128 mRNA was expressed with immediately early, early and late kinetics. Sequences obtained by RT-PCR showed that the UL131A gene consisted of two ...

  20. 33 CFR 128.100 - Does this part apply to me?

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Does this part apply to me? 128.100 Section 128.100 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... me? This part applies to all passenger terminals in the United States or its territories when being...

  1. 14 CFR 135.128 - Use of safety belts and child restraint systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Use of safety belts and child restraint systems. 135.128 Section 135.128 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF.... 213 (49 CFR 571.213)), vest- and harness-type child restraint systems, and lap held child restraints...

  2. MicroRNA-128 governs neuronal excitability and motor behavior in mice

    DEFF Research Database (Denmark)

    Tan, Chan Lek; Plotkin, Joshua L.; Venø, Morten Trillingsgaard

    2013-01-01

    The control of motor behavior in animals and humans requires constant adaptation of neuronal networks to signals of various types and strengths. We found that microRNA-128 (miR-128), which is expressed in adult neurons, regulates motor behavior by modulating neuronal signaling networks...

  3. 41 CFR 128-1.5006-2 - Property management officer (PMO).

    Science.gov (United States)

    2010-07-01

    ... leadership, guidance, and operating procedures for personal property management functions. (b) Ensuring... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Property management officer (PMO). 128-1.5006-2 Section 128-1.5006-2 Public Contracts and Property Management Federal Property...

  4. 49 CFR 393.128 - What are the rules for securing automobiles, light trucks and vans?

    Science.gov (United States)

    2010-10-01

    ... trucks and vans? 393.128 Section 393.128 Transportation Other Regulations Relating to Transportation... automobiles, light trucks and vans? (a) Applicability. The rules in this section apply to the transportation of automobiles, light trucks, and vans which individually weigh 4,536 kg. (10,000 lb) or less...

  5. 22 CFR 128.5 - Answer and demand for oral hearing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Answer and demand for oral hearing. 128.5 Section 128.5 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS... materials are in language other than English, translations into English shall be submitted at the same time...

  6. Biclique Cryptanalysis on the Full Crypton-256 and mCrypton-128

    Directory of Open Access Journals (Sweden)

    Junghwan Song

    2014-01-01

    Full Text Available Biclique cryptanalysis is an attack which reduces the computational complexity by finding a biclique which is a kind of bipartite graph. We show a single-key full-round attack of the Crypton-256 and mCrypton-128 by using biclique cryptanalysis. In this paper, 4-round bicliques are constructed for Crypton-256 and mCrypton-128. And these bicliques are used to recover master key for the full rounds of Crypton-256 and mCrypton-128 with the computational complexities of 2253.78 and 2126.5, respectively. This is the first known single-key full-round attack on the Crypton-256. And our result on the mCrypton-128 has superiority over known result of biclique cryptanalysis on the mCrypton-128 which constructs 3-round bicliques in terms of computational time complexity.

  7. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  8. Biological Control of Apple Anthracnose by Paenibacillus polymyxa APEC128, an Antagonistic Rhizobacterium

    Directory of Open Access Journals (Sweden)

    Young Soo Kim

    2016-06-01

    Full Text Available The present study investigated the suppression of the disease development of anthracnose caused by Colletotrichum gloeosporioides and C. acutatum in harvested apples using an antagonistic rhizobacterium Paenibacillus polymyxa APEC128 (APEC128. Out of 30 bacterial isolates from apple rhizosphere screened for antagonistic activity, the most effective strain was APEC128 as inferred from the size of the inhibition zone. This strain showed a greater growth in brain-heart infusion (BHI broth compared to other growth media. There was a reduction in anthracnose symptoms caused by the two fungal pathogens in harvested apples after their treatment with APEC128 in comparison with non-treated control. This effect is explained by the increased production of protease and amylase by APEC128, which might have inhibited mycelial growth. In apples treated with different APEC128 suspensions, the disease caused by C. gloeosporioides and C. acutatum was greatly suppressed (by 83.6% and 79%, respectively in treatments with the concentration of 1 × 10⁸ colony forming units (cfu/ml compared to other lower dosages, suggesting that the suppression of anthracnose development on harvested apples is dose-dependent. These results indicated that APEC128 is one of the promising agents in the biocontrol of apple anthracnose, which might help to increase the shelf-life of apple fruit during the post-harvest period.

  9. 15-micro-m 128 x 128 GaAs/Al(x)Ga(1-x) As Quantum Well Infrared Photodetector Focal Plane Array Camera

    Science.gov (United States)

    Gunapala, Sarath D.; Park, Jin S.; Sarusi, Gabby; Lin, True-Lon; Liu, John K.; Maker, Paul D.; Muller, Richard E.; Shott, Craig A.; Hoelter, Ted

    1997-01-01

    In this paper, we discuss the development of very sensitive, very long wavelength infrared GaAs/Al(x)Ga(1-x)As quantum well infrared photodetectors (QWIP's) based on bound-to-quasi-bound intersubband transition, fabrication of random reflectors for efficient light coupling, and the demonstration of a 15 micro-m cutoff 128 x 128 focal plane array imaging camera. Excellent imagery, with a noise equivalent differential temperature (N E(delta T)) of 30 mK has been achieved.

  10. Error-free transmission of serial 1.28 Tbaud RZ-DPSK signal

    DEFF Research Database (Denmark)

    Hu, Hao; Galili, Michael; Oxenløwe, Leif Katsuo

    2010-01-01

    This paper demonstrates the first transmission of a 1.28 Tbaud data signal. The transmission link is a 50-km dispersion managed fibre consisting of super large area fibre and inverse dispersion fibre. Error-free performance (BER......This paper demonstrates the first transmission of a 1.28 Tbaud data signal. The transmission link is a 50-km dispersion managed fibre consisting of super large area fibre and inverse dispersion fibre. Error-free performance (BER...

  11. MiR-128b is down-regulated in gastric cancer and negatively ...

    Indian Academy of Sciences (India)

    Moreover, miR-128b was predicted to bind the 3'UTR of PDK1 gene using bioinformatic target-screening tools. Accordingly, ectopic expression of miR-128b inhibited the PDK1 expression at both transcriptional and post-transcriptional levels, and furthermore, the expression of gene tailed by the 3′UTR of PDK1 gene was ...

  12. Assessing Mission Impact of Cyberattacks: Report of the NATO IST-128 Workshop

    Science.gov (United States)

    2015-12-01

    ARL-TR-7566 ● DEC 2015 US Army Research Laboratory Assessing Mission Impact of Cyberattacks: Report of the NATO IST-128 Workshop ... Workshop by Alexander Kott, Computational and Information Sciences Directorate, ARL Nikolai Stoyanov, Defense Institute, Bulgaria Nazife Baykal...From - To) 4. TITLE AND SUBTITLE Assessing Mission Impact of Cyberattacks: Report of the NATO IST-128 Workshop 5a. CONTRACT NUMBER 5b

  13. MicroRNA-128 promotes apoptosis in lung cancer by directly targeting NIMA-related kinase 2.

    Science.gov (United States)

    Zhao, Dejian; Han, Wenzheng; Liu, Xia; Cui, Dawei; Chen, Yu

    2017-07-01

    MicroRNA-128 (miR-128) serves as a regulator by inducing cancer cell apoptosis, differentiation, the epithelial-to-mesenchymal transition process, and tumor growth by mediating different targets. NIMA-related kinase 2 (NEK2) is aberrantly expressed in lung cancer. The miR-128/NEK2 pathway has been reported to predict prognosis in colorectal cancer; however, the determination of a relationship between miR-128 and NEK2 in lung cancer has remained elusive. We explored the association between miR-128 and NEK2 in lung cancer. MiR-128 and NEK2 expression were examined in 15 lung cancer tissues by real time-PCR. Lung cancer SK-MES-1 cells were transfected with miR-128 mimic, an inhibitor or a negative control. MiR-128 and NEK2 expression levels were detected using quantitative real time-PCR and Western blot. SK-MES-1 cell apoptosis was performed by flow cytometry. Compared to adjacent non-tumor tissues, miR-128 was downregulated and NEK2 was upregulated in 15 lung cancer tissues. Lung cancer SK-MES-1 cells transfected with miR-128 mimic induced a higher apoptotic rate than those transfected with the negative control. Dual luciferase assay further confirmed that NEK2 was a direct target of miR-128 in lung cancer, and transfection with miR-128 mimic could decrease the NEK2 protein level while the miR-128 inhibitor increased NEK2 expression. Finally, the apoptotic effect of lung cancer cells induced by miR-128 mimic could be reversed by NEK2 overexpression. NEK2 was regulated by miR-128 in lung cancer and miR-128 induced lung cancer cell apoptosis by mediating NEK2 expression. © 2017 The Authors. Thoracic Cancer published by China Lung Oncology Group and John Wiley & Sons Australia, Ltd.

  14. INK128 exhibits synergy with azoles against Exophiala spp. and Fusarium spp.

    Directory of Open Access Journals (Sweden)

    Lujuan Gao

    2016-10-01

    Full Text Available Infections of Exophiala spp. and Fusarium spp. are often chronic and recalcitrant. Systemic disseminations, which mostly occur in immunocompromised patients, are often refractory to available antifungal therapies. The conserved target of rapamycin (TOR orchestrates cell growth and proliferation in response to nutrients and growth factors, which are important for pathogenicity and virulence. INK128 is a second-generation ATP-competitive TOR inhibitor, which binds the TOR catalytic domain and selectively inhibits TOR. In the present study, we investigated the in vitro activities of INK128 alone and the interactions of INK128 with conventional antifungal drugs including itraconazole, voriconazole, posaconazole, and amphotericin B against 18 strains of Exophiala spp. and 10 strains of Fusarium spp. via broth microdilution checkerboard technique system adapted from clinical and Laboratory Standards Institute broth microdilution method M38-A2. INK128 alone was inactive against all isolates tested. However, favorable synergistic effects between INK128 and voriconazole were observed in 61% Exophiala strains and 60% Fusarium strains, despite Fusarium strains exhibited high MIC values (4-8 μg/ml against voriconazole. In addition, synergistic effects of INK128/itraconazole were shown in 33% Exophiala strains and 30% Fusarium strains, while synergy of INK128/posaconazole were observed in 28% Exophiala strains and 30% Fusarium strains. The effective working ranges of INK128 were 0.125-2 μg/ml and 1-4μg/ml against Exophiala isolates and Fusarium isolates, respectively. No synergistic effect was observed when INK128 was combined with amphotericin B. No antagonism was observed in all combinations. In conclusion, INK128 could enhance the in vitro antifungal activity of voriconazole, itraconazole and posaconazole against Exophiala spp. and Fusarium spp., suggesting that azoles, especially voriconazole, combined with TOR kinase inhibitor might provide a

  15. Pyrolysis result of polyethylene waste as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-02-01

    In this research, the result of pyrolysis on polyethylene was used as fuel for a solid oxide fuel cell (SOFC). The pyrolysis result is a liquid which consists of hydrocarbon chains. According to GC-MS analysis, the hydrocarbons mainly consist of C7 to C20 hydrocarbon chain. Then, the liquid was applied to a single cell of NSDC-L | NSDC | NSDC-L. NSDC is a composite SDC (samarium doped-ceria) with sodium carbonate. Meanwhile, NSDC-L is a composite of NSDC with LiNiCuO (LNC). NSDC and LNC were analyzed by X-ray diffraction to understand their crystal structure. The result shows that presence of carbonate did not change the crystal structure of SDC. SEM EDX analysis for fuel cell before and after being loaded with polyethylene oil to get information of element diffusion to the electrolyte. Meanwhile, the conductivity properties were investigated through impedance measurement. The presence of carbonate even increases the electrical conductivity. The single cell test with the pyrolysis result of polyethylene at 300 - 600 °C, found that the highest power density is at 600 °C with the maximum power density of 0.14 mW/cm2 and open circuit voltage of 0.4 Volt. Elemental analysis at three point spots of single cell NDSC-L |NSDC|NSDC-L found that a migration of ions was occurred during fuel operation at 300 - 600 °C.

  16. Effects of some rare earth and carbonate-based co-dopants on structural and electrical properties of samarium doped ceria (SDC) electrolytes for solid oxide fuel cells

    Science.gov (United States)

    Anwar, Mustafa; Khan, Zuhair S.; Mustafa, Kamal; Rana, Akmal

    2015-09-01

    In the present study, samarium doped ceria (SDC) and SDC-based composite with the addition of K2CO3 were prepared by co-precipitation route and effects of pH of the solution and calcination temperature on microstructure of SDC and SDC-K2CO3, respectively, were investigated. Furthermore, experimentation was performed to investigate into the ionic conductivity of pure SDC by co-doping with yttrium i.e., YSDC, XRD and SEM studies show that the crystallite size and particle size of SDC increases with the increase in pH. The SEM images of all the samples of SDC synthesized at different pH values showed the irregular shaped and dispersed particles. SDC-K2CO3 was calcined at 600∘C, 700∘C and 800∘C for 4 h and XRD results showed that crystallite size increases while lattice strain, decreases with the increase in calcination temperature and no peaks were detected for K2CO3 as it is present in an amorphous form. The ionic conductivity of the electrolytes increases with the increase in temperature and SDC-K2CO3 shows the highest value of ionic conductivity as compared to SDC and YSDC. Chemical compatibility tests were performed between the co-doped electrolyte and lithiated NiO cathode at high temperature. It revealed that the couple could be used up to the temperature of 700∘C.

  17. Calculation of the Dose of Samarium-153-Ethylene Diamine Tetramethylene Phosphonate (153Sm-EDTMP as a Radiopharmaceutical for Pain Relief of bone Metastasis

    Directory of Open Access Journals (Sweden)

    Fatemeh Razghandi

    2016-04-01

    Full Text Available Introduction One of the important applications of nuclear physics in medicine is the use of radioactive elements as radiopharmaceuticals. Metastatic bone disease is the most common form of malignant bone tumors. Samarium-153-ethylene diamine tetramethylene phosphonate (153Sm-EDTMP as a radiopharmaceutical is used for pain palliation. This radiopharmaceutical usually emits beta particles, which have a high uptake in bone tissues. The purpose of this study was to calculate the radiation dose distribution of 153Sm-EDTMP in bone and other tissues, using MCNPX Monte Carlo code in the particle transport model. Materials and Methods Dose delivery to the bone was simulated by seeking radiopharmaceuticals on the bone surface. The phantom model had a simple cylindrical geometry and included bone, bone marrow, and soft tissue. Results The simulation results showed that a significant amount of radiation dose was delivered to the bone by the use of this radiopharmaceutical. Conclusion Thebone acted as a fine protective shield against rays for the bone marrow. Therefore, the trivial absorbed dose by the bone marrow caused less damage to bone-making cells. Also, the high absorbed dose of the bone could destroy cancer cells and relieve the pain in the bone.

  18. Synthesis, quality control and biological evaluation of tris[(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate complex as a therapeutic agent

    Energy Technology Data Exchange (ETDEWEB)

    Naseri, Z.; Kharat, A. Nemati [Tehran Univ. (Iran, Islamic Republic of). Inorganic Chemistry Dept.; Hakimi, A. [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Dept. of Nuclear Engineering, Science and Research Branch; Jalilian, A.R.; Shirvani-Arani, S.; Bahrami-Samani, A.; Ghannadi-Maragheh, M. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (IR). Radiopharmaceutical Research and Development Lab (RRDL)

    2012-07-01

    Therapeutic radiopharmaceuticals are designed to deliver high doses of radiation to selected target organs or tissues with an aim of minimizing unwanted radiation to surrounding healthy tissue. In this work, [tris(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate ({sup 153}Sm-TPTTC) was developed for possible therapeutic properties. The cold compound, i.e. {sup nat}Sm-TPTTC was prepared and characterized by IR, UV, mass and {sup 1}H-NMR spectroscopy. {sup 153}Sm-TPTTC was prepared in two steps using [{sup 153}Sm]SmCl{sub 3}, obtained by neutron activation of an enriched {sup 152}Sm sample. Stability tests, partition coefficient determination, toxicity tests and biodistribution studies of the complex in wild-type and fibrosarcoma-bearing mice were determined. The radiolabeled complex was prepared in high radiochemical purity (> 99% precipitation method) and specific activity of 278 GBq/mmol and demonstrated significant stability at 4, 25 and 37 C (in presence of human serum). Initial complex biodistribution data showed significant liver accumulation in wild-type mice and significant tumor accumulation in fibrosarcoma-bearing mice with tumor:blood and tumor:muscle ratios of 3.55 (2 h) and 38.26 (96 h) respectively. {sup 153}Sm-TPTTC properties suggest an efficient tumor targeting agent with high tumor-avidity. Further investigation on the therapeutic properties must be conducted. (orig.)

  19. Inhibition of microRNA 128 promotes excitability of cultured cortical neuronal networks.

    Science.gov (United States)

    McSweeney, K Melodi; Gussow, Ayal B; Bradrick, Shelton S; Dugger, Sarah A; Gelfman, Sahar; Wang, Quanli; Petrovski, Slavé; Frankel, Wayne N; Boland, Michael J; Goldstein, David B

    2016-10-01

    Cultured neuronal networks monitored with microelectrode arrays (MEAs) have been used widely to evaluate pharmaceutical compounds for potential neurotoxic effects. A newer application of MEAs has been in the development of in vitro models of neurological disease. Here, we directly evaluated the utility of MEAs to recapitulate in vivo phenotypes of mature microRNA-128 (miR-128) deficiency, which causes fatal seizures in mice. We show that inhibition of miR-128 results in significantly increased neuronal activity in cultured neuronal networks derived from primary mouse cortical neurons. These results support the utility of MEAs in developing in vitro models of neuroexcitability disorders, such as epilepsy, and further suggest that MEAs provide an effective tool for the rapid identification of microRNAs that promote seizures when dysregulated. © 2016 McSweeney et al.; Published by Cold Spring Harbor Laboratory Press.

  20. PERBANDINGAN APLIKASI MENGGUNAKAN METODE CAMELLIA 128 BIT KEY DAN 256 BIT KEY

    Directory of Open Access Journals (Sweden)

    Lanny Sutanto

    2014-01-01

    Full Text Available The rapid development of the Internet today to easily exchange data. This leads to high levels of risk in the data piracy. One of the ways to secure data is using cryptography camellia. Camellia is known as a method that has the encryption and decryption time is fast. Camellia method has three kinds of scale key is 128 bit, 192 bit, and 256 bit.This application is created using the C++ programming language and using visual studio 2010 GUI. This research compare the smallest and largest key size used on the file extension .Txt, .Doc, .Docx, .Jpg, .Mp4, .Mkv and .Flv. This application is made to comparing time and level of security in the use of 128-bit key and 256 bits. The comparison is done by comparing the results of the security value of avalanche effect 128 bit key and 256 bit key.

  1. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  2. A 128-channel picoammeter system and its application on charged particle beam current distribution measurements.

    Science.gov (United States)

    Yu, Deyang; Liu, Junliang; Xue, Yingli; Zhang, Mingwu; Cai, Xiaohong; Hu, Jianjun; Dong, Jinmei; Li, Xin

    2015-11-01

    A 128-channel picoammeter system is constructed based on instrumentation amplifiers. Taking advantage of a high electric potential and narrow bandwidth in DC energetic charged beam measurements, a current resolution better than 5 fA can be achieved. Two sets of 128-channel strip electrodes are implemented on printed circuit boards and are employed for ion and electron beam current distribution measurements. Tests with 60 keV O(3+) ions and 2 keV electrons show that it can provide exact boundaries when a positive charged particle beam current distribution is measured.

  3. SU-C-201-06: Utility of Quantitative 3D SPECT/CT Imaging in Patient Specific Internal Dosimetry of 153-Samarium with GATE Monte Carlo Package

    Energy Technology Data Exchange (ETDEWEB)

    Fallahpoor, M; Abbasi, M [Tehran University of Medical Sciences, Vali-Asr Hospital, Tehran, Tehran (Iran, Islamic Republic of); Sen, A [University of Houston, Houston, TX (United States); Parach, A [Shahid Sadoughi University of Medical Sciences, Yazd, Yazd (Iran, Islamic Republic of); Kalantari, F [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: Patient-specific 3-dimensional (3D) internal dosimetry in targeted radionuclide therapy is essential for efficient treatment. Two major steps to achieve reliable results are: 1) generating quantitative 3D images of radionuclide distribution and attenuation coefficients and 2) using a reliable method for dose calculation based on activity and attenuation map. In this research, internal dosimetry for 153-Samarium (153-Sm) was done by SPECT-CT images coupled GATE Monte Carlo package for internal dosimetry. Methods: A 50 years old woman with bone metastases from breast cancer was prescribed 153-Sm treatment (Gamma: 103keV and beta: 0.81MeV). A SPECT/CT scan was performed with the Siemens Simbia-T scanner. SPECT and CT images were registered using default registration software. SPECT quantification was achieved by compensating for all image degrading factors including body attenuation, Compton scattering and collimator-detector response (CDR). Triple energy window method was used to estimate and eliminate the scattered photons. Iterative ordered-subsets expectation maximization (OSEM) with correction for attenuation and distance-dependent CDR was used for image reconstruction. Bilinear energy mapping is used to convert Hounsfield units in CT image to attenuation map. Organ borders were defined by the itk-SNAP toolkit segmentation on CT image. GATE was then used for internal dose calculation. The Specific Absorbed Fractions (SAFs) and S-values were reported as MIRD schema. Results: The results showed that the largest SAFs and S-values are in osseous organs as expected. S-value for lung is the highest after spine that can be important in 153-Sm therapy. Conclusion: We presented the utility of SPECT-CT images and Monte Carlo for patient-specific dosimetry as a reliable and accurate method. It has several advantages over template-based methods or simplified dose estimation methods. With advent of high speed computers, Monte Carlo can be used for treatment planning

  4. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO2) thin films using electron beam evaporation

    Science.gov (United States)

    Kundu, Subrata; Sutradhar, Narottam; Thangamuthu, R.; Subramanian, B.; Panda, Asit Baran; Jayachandran, M.

    2012-08-01

    Samarium (Sm)-doped cerium oxide (CeO2) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ( 300 or 500 °C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO2 nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO2 nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH4. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO2 thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.

  5. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films using electron beam evaporation

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Subrata, E-mail: skundu@cecri.res.in [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Sutradhar, Narottam [G. B. Marg, Central Salt and Marine Chemical Research Institute - CSIR (India); Thangamuthu, R.; Subramanian, B. [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Panda, Asit Baran [G. B. Marg, Central Salt and Marine Chemical Research Institute (CSIR) (India); Jayachandran, M., E-mail: mjayam54@yahoo.com [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India)

    2012-08-15

    Samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ({approx}300 or 500 Degree-Sign C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO{sub 2} nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO{sub 2} nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH{sub 4}. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO{sub 2} thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.Graphical Abstract.

  6. cymang619@yeah.net | 投稿 | 1813-1821 | 11 | 128 | jcsc | Volumes ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jcsc; 128; 11; 1813-1821; 投稿; cymang619@yeah.net. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Good Governance: Contribution of Vigilance · Vigilance ...

  7. Photonic chip based 1.28 Tbaud transmitter optimization and receiver OTDM demultiplexing

    DEFF Research Database (Denmark)

    Vo, T.D.; Hu, Hao; Galili, Michael

    2010-01-01

    We propose chip-based Tbaud processing for all-optical performance monitoring, switching and demultiplexing. We demonstrate the first transmitter optimization and receiver-end demultiplexing of 1.28 Tbit/s OOK signals. Both exploited Kerr nonlinearity in dispersion-engineered As$_2$S$_3$ planar...

  8. HFM-128 NATO Research Task Group on Representation of Human Behavior in Constructive Simulation

    NARCIS (Netherlands)

    Lotens, W.A.; Allender, L.; Castor, M.; Lundin, M.; Wallin, N.; Belyavin, A.; Käppler, W.-D.; Cain, B.; Thomas-Meyers, G.

    2007-01-01

    The North Atlantic Treaty Organization (NATO) Human Factors group has approved the formation of a study group, HFM-128, on human behavior representation (HBR) in constructive simulation. The differentiating focus of this working group is the translation of HBR concepts into a combined “how-to” and

  9. HFM-128 NATO research task group on representation of human behavior in constructive simulation

    NARCIS (Netherlands)

    Lotens, W.; Allender, L.; Castor, M.; Lundin, M.; Wallin, N.; Cain, B.; Käppler, W.-D.; Belyavin, A.; Thomas-Meyers, G.

    2005-01-01

    The North Atlantic Treaty Organization (NATO) Human Factors group has approved the formation of a study group, HFM-128, on human behavior representation (HBR) in constructive simulation. The differentiating focus of this working group is the translation of HBR concepts into a combined "how-to" and

  10. Vulnerability of advanced encryption standard algorithm to differential power analysis attacks implemented on ATmega-128 microcontroller

    CSIR Research Space (South Africa)

    Mpalane, Kealeboga

    2016-09-01

    Full Text Available such as differences in the power consumption measured from the physical implementation of the cryptosystem while it is performing cryptographic operations to determine the secret key of the device. This paper investigates the vulnerability of 128-bits advanced...

  11. A 128-channel receive-only cardiac coil for highly accelerated cardiac MRI at 3 Tesla.

    Science.gov (United States)

    Schmitt, Melanie; Potthast, Andreas; Sosnovik, David E; Polimeni, Jonathan R; Wiggins, Graham C; Triantafyllou, Christina; Wald, Lawrence L

    2008-06-01

    A 128-channel receive-only array coil is described and tested for cardiac imaging at 3T. The coil is closely contoured to the body with a "clam-shell" geometry with 68 posterior and 60 anterior elements, each 75 mm in diameter, and arranged in a continuous overlapped array of hexagonal symmetry to minimize nearest neighbor coupling. Signal-to-noise ratio (SNR) and noise amplification for parallel imaging (G-factor) were evaluated in phantom and volunteer experiments. These results were compared to those of commercially available 24-channel and 32-channel coils in routine use for cardiac imaging. The in vivo measurements with the 128-channel coil resulted in SNR gains compared to the 24-channel coil (up to 2.2-fold in the apex). The 128- and 32-channel coils showed similar SNR in the heart, likely dominated by the similar element diameters of these coils. The maximum G-factor values were up to seven times better for a seven-fold acceleration factor (R=7) compared to the 24-channel coil and up to two-fold improved compared to the 32-channel coil. The ability of the 128-channel coil to facilitate highly accelerated cardiac imaging was demonstrated in four volunteers using acceleration factors up to seven-fold (R=7) in a single spatial dimension. Copyright (c) 2008 Wiley-Liss, Inc.

  12. MiR-128b is down-regulated in gastric cancer and negatively ...

    Indian Academy of Sciences (India)

    2016-02-04

    Feb 4, 2016 ... Gastric cancer (GC) is the fourth most prevalent type of cancer worldwide, which is usually caused by the interaction between environmental and genetic factors, or epigenetic aspects. Referring to the non-coding RNAs, miR-128b has been reported to be associated with many tumour cases, and exerts ...

  13. 7 CFR 457.128 - Guaranteed production plan of fresh market tomato crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Guaranteed production plan of fresh market tomato crop... § 457.128 Guaranteed production plan of fresh market tomato crop insurance provisions. The Guaranteed Production Plan of Fresh Market Tomato Crop Insurance FCIC Policies Department of Agriculture Federal Crop...

  14. Bronchial Asthma in Sokoto: A Study of 128 Adult Asthmatic Patients ...

    African Journals Online (AJOL)

    128 adult asthmatics, made up of 62 males and 66 females were seen at Usmanu Danfodiyo University Teaching Hospital, Sokoto between the 1st of January 1993 and 31 st of December 1998. The mean age of presentation for the males was 34.8 years while for the females it was 28.2 years. Those between the age of 20 ...

  15. 46 CFR 128.220 - Class II non-vital systems-materials and pressure design.

    Science.gov (United States)

    2010-10-01

    ... schedule in wall thickness. (c) Each Class II non-vital piping-system must be certified by the builder as... 46 Shipping 4 2010-10-01 2010-10-01 false Class II non-vital systems-materials and pressure design... SUPPLY VESSELS MARINE ENGINEERING: EQUIPMENT AND SYSTEMS Materials and Pressure Design § 128.220 Class II...

  16. Asi ametlik: Euroopa Komisjon esitab Ermamaa eest 128 000-eurose arve / Jaanus Vogelberg

    Index Scriptorium Estoniae

    Vogelberg, Jaanus

    2017-01-01

    Rahandusministeerium ootab Euroopa Komisjonilt arvet, misjärel makstakse tagasi 128 515,14 eurot Ermamaa jaoks saadud toetusraha. EAS andis 2006. a. Ermamaale 2,97 miljonit krooni toetust turismitalunduse arendamiseks, mida pole aga sihipäraselt kasutatud

  17. Genome sequence of the Medicago-nodulating Ensifer meliloti commercial inoculant strain RRI128

    Science.gov (United States)

    Reeve, Wayne; Ballard, Ross; Drew, Elizabeth; Tian, Rui; Bräu, Lambert; Goodwin, Lynne; Huntemann, Marcel; Han, James; Tatiparthi, Reddy; Chen, Amy; Mavrommatis, Konstantinos; Markowitz, Victor; Palaniappan, Krishna; Ivanova, Natalia; Pati, Amrita; Woyke, Tanja; Kyrpides, Nikos

    2014-01-01

    Ensifer meliloti strain RRI128 is an aerobic, motile, Gram-negative, non-spore-forming rod. RRI128 was isolated from a nodule recovered from the roots of barrel medic (Medicago truncatula) grown in the greenhouse and inoculated with soil collected from Victoria, Australia. The strain is used in commercial inoculants in Australia. RRI128 nodulates and forms an effective symbiosis with a diverse range of lucerne cultivars (Medicago sativa) and several species of annual medic (M. truncatula, Medicago littoralis and Medicago tornata), but forms an ineffective symbiosis with Medicago polymorpha. Here we describe the features of E. meliloti strain RRI128, together with genome sequence information and annotation. The 6,900,273 bp draft genome is arranged into 156 scaffolds of 157 contigs, contains 6,683 protein-coding genes and 87 RNA-only encoding genes, and is one of 100 rhizobial genomes sequenced as part of the DOE Joint Genome Institute 2010 Genomic Encyclopedia for Bacteria and Archaea-Root Nodule Bacteria (GEBA-RNB) project. PMID:25197447

  18. Atypical antipsychotic-like effects of the dopamine D-3 receptor agonist, (+)-PD 128,907

    NARCIS (Netherlands)

    Witkin, J; Gasior, M; Acri, J; Beekman, M; Thurkauf, A; de Boer, Peter; Wikstrom, H; Dijkstra, D

    1998-01-01

    Anti-schizophrenia agents with improved efficacy and side-effect profiles are required. A dopamine D-3 receptor agonist, R-(+)-trans-3,4a,10b-tetrahydro-4-propyl-2H,5H-[1]benzopyrano[4,3-b]-1,4-oxazin-9-ol HCl ((+)-PD 128,907), displayed an atypical antipsychotic profile comparable to that of

  19. 41 CFR 128-48.001-50 - Administrative or summary process.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL OF ABANDONED AND FORFEITED PERSONAL PROPERTY § 128-48.001-50 Administrative or summary process... interpreted to mean by administrative process. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Administrative or...

  20. 29 CFR 780.128 - General statement on “secondary” agriculture.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false General statement on âsecondaryâ agriculture. 780.128... APPLICABLE TO AGRICULTURE, PROCESSING OF AGRICULTURAL COMMODITIES, AND RELATED SUBJECTS UNDER THE FAIR LABOR STANDARDS ACT General Scope of Agriculture Practices Exempt Under âsecondaryâ Meaning of Agriculture...

  1. Supporting Symmetric 128-bit AES in Networked Embedded Systems: An Elliptic Curve Key Establishment Protocol-on-Chip

    Directory of Open Access Journals (Sweden)

    Roshan Duraisamy

    2007-02-01

    Full Text Available The secure establishment of cryptographic keys for symmetric encryption via key agreement protocols enables nodes in a network of embedded systems and remote agents to communicate securely in an insecure environment. In this paper, we propose a pure hardware implementation of a key agreement protocol, which uses the elliptic curve Diffie-Hellmann and digital signature algorithms and enables two parties, a remote agent and a networked embedded system, to establish a 128-bit symmetric key for encryption of all transmitted data via the advanced encryption scheme (AES. The resulting implementation is a protocol-on-chip that supports full 128-bit equivalent security (PoC-128. The PoC-128 has been implemented in an FPGA, but it can also be used as an IP within different embedded applications. As 128-bit security is conjectured valid for the foreseeable future, the PoC-128 goes well beyond the state of art in securing networked embedded devices.

  2. Crystal structure of monoclinic samarium and cubic europium sesquioxides and bound coherent neutron scattering lengths of the isotopes {sup 154}Sm and {sup 153}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Kohlmann, Holger [Leipzig Univ. (Germany). Inst. of Inorganic Chemistry; Hein, Christina; Kautenburger, Ralf [Saarland Univ., Saarbruecken (Germany). Inorganic Solid State Chemistry; Hansen, Thomas C.; Ritter, Clemens [Institut Laue-Langevin, Grenoble (France); Doyle, Stephen [Karlsruhe Institute of Technology, Eggenstein-Leopoldshafen (Germany). Inst. for Synchrotron Radiation (ISS)

    2016-11-01

    The crystal structures of monoclinic samarium and cubic europium sesquioxide, Sm{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}, were reinvestigated by powder diffraction methods (laboratory X-ray, synchrotron, neutron). Rietveld analysis yields more precise structural parameters than previously known, especially for oxygen atoms. Interatomic distances d(Sm-O) in Sm{sub 2}O{sub 3} range from 226.3(4) to 275.9(2) pm [average 241.6(3) pm] for the monoclinic B type Sm{sub 2}O{sub 3} [space group C2/m, a = 1418.04(3) pm, b = 362.660(7) pm, c = 885.48(2) pm, β = 100.028(1) ], d(Eu-O) in Eu{sub 2}O{sub 3} from 229.9(2) to 238.8(2) pm for the cubic bixbyite (C) type [space group Ia anti 3, a = 1086.87(1) pm]. Neutron diffraction at 50 K and 2 K did not show any sign for magnetic ordering in Sm{sub 2}O{sub 3}. Isotopically enriched {sup 154}Sm{sub 2}O{sub 3} and {sup 153}Eu{sub 2}O{sub 3} were used for the neutron diffraction work because of the enormous absorption cross section of the natural isotopic mixtures for thermal neutrons. The isotopic purity was determined by inductively coupled plasma - mass spectrometry to be 98.9% for {sup 154}Sm and 99.8% for {sup 153}Eu. Advanced analysis of the neutron diffraction data suggest that the bound coherent scattering lengths of {sup 154}Sm and {sup 153}Eu need to be revised. We tentatively propose b{sub c}({sup 154}Sm) = 8.97(6) fm and b{sub c}({sup 153}Eu) = 8.85(3) fm for a neutron wavelength of 186.6 pm to be better values for these isotopes, showing up to 8% deviation from accepted literature values. It is shown that inaccurate scattering lengths may result in severe problems in crystal structure refinements causing erroneous structural details such as occupation parameters, which might be critically linked to physical properties like superconductivity in multinary oxides.

  3. 21 CFR 801.128 - Exceptions or alternatives to labeling requirements for medical devices held by the Strategic...

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Exceptions or alternatives to labeling requirements for medical devices held by the Strategic National Stockpile. 801.128 Section 801.128 Food and... requirements for medical devices held by the Strategic National Stockpile. (a) The appropriate FDA Center...

  4. 17 CFR 240.3a12-8 - Exemption for designated foreign government securities for purposes of futures trading.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption for designated foreign government securities for purposes of futures trading. 240.3a12-8 Section 240.3a12-8 Commodity and... trading. (a) When used in this Rule, the following terms shall have the meaning indicated: (1) The term...

  5. Sistem Kontrol Hexapod robot MSR-H01 Menggunakan Mikrokontroler ATMega 128

    Directory of Open Access Journals (Sweden)

    Yunifa Miftachul Arif

    2013-10-01

    Full Text Available Penelitian ini membahas tentang bagaimana model sistem kontrol hexapod robot menggunakan mikrokontroler ATMega 128. Hexapod robot yang digunakan sebagai objek dalam penelitian ini adalah kit MSR-H01. Kit hexapod robot ini dilengkapi dengan sistem pBrain yang mengontrol setiap pergerakan mekaniknya. Komunikasi data antara mikrokontroler AVR ATMega 128 dengan pBrain menggunakan komunikasi serial RS 232. Hexapod robot pada penelitian ini dilengkapi dengan sensor ultrasonik untuk mengetahui kondisi lingkungan dan obstacle di sekitar robot. Selain itu ultrasonik juga menjadi input ATMega   128   untuk  menentukan  perintah   gerak  yang   dikirimkan   ke  pBrain.   Untuk menentukan gerakan mekanik, mode yang digunakan simkontrol pada pBrain adalah mode offroad. Hasil ujicoba yang telah dilakukan menunjukkan bahwa mode offroad dapat digunakan  robot  untuk  berjalan  di  track  datar,  berkarpet  maupun  track  bergelombang dengan kecepatan maksimal 7 s/m pada track datar.

  6. Development of a 128 channel silicon drift detector for spectroscopic purposes

    Energy Technology Data Exchange (ETDEWEB)

    Valk, H.; Huizenga, J.; van Eijk, C.W.E.; Hollander, R.W. [Delft Univ. of Technol. (Netherlands). Dept. of Appl. Phys.; Nanver, L.K.; Sarro, P.M.; van den Boogaard, A. [Delft Institute of Microelectronics and Submicron Technology (DIMES), Delft University of Technology, Feldmannweg 17, P.O. Box 5053, 2600GB Delft (Netherlands)

    1997-06-21

    A linear silicon drift detector with an active area of 1.28 x 2.56 cm{sup 2} has been designed. On each short side of the detector a row of 64 anodes is placed. The detector is intended for X-ray fluorescence purposes. Position resolution is obtained only from the anode number and not from drift time. Energy resolution is important and lateral charge diffusion to neighboring anodes cannot be tolerated. In this work minimization of the lateral charge diffusion by a sawtooth shape of the cathode biasing strips is studied. The main advantage of this method is that additional processing steps are not required. We measured {sup 55}Fe spectra using a small detector in which the influence of lateral diffusion was still present. For the 128 anode detector of the right size we report charge collection over the maximum drift distance of 1.28 cm. Unfortunately this specific detector did not allow the extraction of diffusion data. (orig.).

  7. High-sensitive thermal video camera with self-scanned 128 InSb linear array

    Science.gov (United States)

    Fujisada, Hiroyuki

    1991-12-01

    A compact thermal video camera with very high sensitivity has been developed by using a self-scanned 128 InSb linear array photodiode. Two-dimensional images are formed by a self- scanning function of the linear array focal plane assembly in the horizontal direction and by a vibration mirror in the vertical direction. Images with 128 X 128 pixel number are obtained every 1/30 seconds. A small size InSb detector array with a total length of 7.68 mm is utilized in order to build the compact system. In addition, special consideration is given to a configuration of optics, vibration mirror, and focal plane assembly. Real-time signal processing by a microprocessor is carried out to compensate inhomogeneous sensitivities and irradiances for each detector. The standard NTSC TV format is employed for output video signals. The thermal video camera developed had a very high radiometric sensitivity. Minimum resolvable temperature difference (MRTD) is estimated at about 0.02 K for 300 K target. The stable operation is possible without blackbody reference, because of very small stray radiation.

  8. Approaching the r-process "waiting point" nuclei below $^{132}$Sn: quadrupole collectivity in $^{128}$Cd

    CERN Multimedia

    Reiter, P; Blazhev, A A; Nardelli, S; Voulot, D; Habs, D; Schwerdtfeger, W; Iwanicki, J S

    We propose to investigate the nucleus $^{128}$Cd neighbouring the r-process "waiting point" $^{130}$Cd. A possible explanation for the peak in the solar r-abundances at A $\\approx$ 130 is a quenching of the N = 82 shell closure for spherical nuclei below $^{132}$Sn. This explanation seems to be in agreement with recent $\\beta$-decay measurements performed at ISOLDE. In contrast to this picture, a beyond-mean-field approach would explain the anomaly in the excitation energy observed for $^{128}$Cd rather with a quite large quadrupole collectivity. Therefore, we propose to measure the reduced transition strengths B(E2) between ground state and first excited 2$^{+}$-state in $^{128}$Cd applying $\\gamma$-spectroscopy with MINIBALL after "safe" Coulomb excitation of a post-accelerated beam obtained from REX-ISOLDE. Such a measurement came into reach only because of the source developments made in 2006 for experiment IS411, in particular the use of a heated quartz transfer line. The result from the proposed measure...

  9. Fermented herbal formula KIOM-MA-128 protects against acute colitis induced by dextran sodium sulfate in mice.

    Science.gov (United States)

    Kim, Dong-Gun; Lee, Mi-Ra; Yoo, Jae-Myung; Park, Kwang-Il; Ma, Jin-Yeul

    2017-07-05

    Colitis is a well-known subtype of inflammatory bowel disease and is caused by diverse factors. Previous research has shown that KIOM-MA elicits anti-inflammatory and anti-allergic effects on various diseases. KIOM-MA-128, our novel herbal formula, was generated from KIOM-MA using probiotics to improve the therapeutic efficacy. We investigated whether KIOM-MA-128 has protective activity in a mouse model of acute colitis induced by dextran sodium sulfate (DSS). Colitis was induced by DSS administered to ICR mice in drinking water. KIOM-MA-128 (125 or 250 mg/kg) was orally administered once per day. The body weights of the mice were measured daily, and colonic endoscopies were performed at 5 and 8 days. Colon length as well as histological and cytokine changes were observed at the end of drug administration. KIOM-MA-128 has pharmacological activity in an acute colitis model. KIOM-MA-128 reduced the loss of body weight and disease activity index (DAI) and inhibited the abnormally short colon lengths and the colonic damage in this mouse model of acute colitis. Moreover, KIOM-MA-128 suppressed pro-inflammatory cytokine expression and maintained the integrity of the tight junctions during DSS-induced colitis. The results indicated that KIOM-MA-128 protects against DSS-induced colitis in mice and suggested that this formula might be a candidate treatment for inflammatory bowel disease (IBD).

  10. Characterization of subventricular zone-derived progenitor cells from mild and late symptomatic YAC128 mouse model of Huntington's disease.

    Science.gov (United States)

    Silva, Ana C; Ferreira, Ildete L; Hayden, Michael R; Ferreiro, Elisabete; Rego, A Cristina

    2018-01-01

    Huntington's disease (HD) is caused by an expansion of CAG repeats in the HTT gene, leading to expression of mutant huntingtin (mHTT) and selective striatal neuronal loss, frequently associated with mitochondrial dysfunction and decreased support of brain-derived neurotrophic factor (BDNF). New neurons derived from the subventricular zone (SVZ) are apparently not able to rescue HD pathological features. Thus, we analyzed proliferation, migration and differentiation of adult SVZ-derived neural stem/progenitor cells (NSPC) from mild (6month-old (mo)) and late (10mo) symptomatic HD YAC128 mice expressing full-length (FL)-mHTT versus age-matched wild-type (WT) mice. SVZ cells derived from 6mo YAC128 mice exhibited higher migratory capacity and a higher number of MAP2+ and synaptophysin+cells, compared to WT cells; MAP2 labeling was enhanced after exposure to BDNF. However, BDNF-evoked neuronal differentiation was not observed in 10mo YAC128 SVZ-derived cells. Interestingly, 6mo YAC128 SVZ-derived cells showed increased intracellular Ca 2+ levels in response to KCl, which was potentiated by BDNF, evidencing the presence of differentiated neurons. In contrast, KCl depolarization-induced intracellular Ca 2+ increase in 10mo YAC128 SVZ-derived cells was shown to be increased only in BDNF-treated YAC128 SVZ-derived cells, suggestive of decreased differentiation capacity. In addition, BDNF-untreated NSPC from 10mo YAC128 mice exhibited lower mitochondrial membrane potential and increased mitochondrial Ca 2+ accumulation, in relation with NSPC from 6mo YAC128 mice. Data evidence age-dependent reduced migration and decreased acquisition of a neuronal phenotype, accompanied by decreased mitochondrial membrane potential in SVZ-derived cells from YAC128 mice through HD symptomatic phases. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Highly CO2-Tolerant Cathode for Intermediate-Temperature Solid Oxide Fuel Cells: Samarium-Doped Ceria-Protected SrCo0.85Ta0.15O3-δ Hybrid.

    Science.gov (United States)

    Li, Mengran; Zhou, Wei; Zhu, Zhonghua

    2017-01-25

    Susceptibility to CO2 is one of the major challenges for the long-term stability of the alkaline-earth-containing cathodes for intermediate-temperature solid oxide fuel cells. To alleviate the adverse effects from CO2, we incorporated samarium-stabilized ceria (SDC) into a SrCo0.85Ta0.15O3-δ (SCT15) cathode by either mechanical mixing or a wet impregnation method and evaluated their cathode performance stability in the presence of a gas mixture of 10% CO2, 21% O2, and 69% N2. We observed that the CO2 tolerance of the hybrid cathode outperforms the pure SCT15 cathode by over 5 times at 550 °C. This significant enhancement is likely attributable to the low CO2 adsorption and reactivity of the SDC protective layer, which are demonstrated through thermogravimetric analysis, energy-dispersive spectroscopy, and electrical conductivity study.

  12. 1.28-Tb/s Demultiplexing of an OTDM DPSK Data Signal Using a Silicon Waveguide

    DEFF Research Database (Denmark)

    Ji, Hua; Galili, Michael; Hu, Hao

    2010-01-01

    This letter demonstrates optical demultiplexing of a 1.28-Tb/s serial differential phase-shift-keying data signal using a nano-engineered silicon waveguide. We first present error-free performance at 640 Gb/s and then at 1.28 Tb/s with characterization of all 128 channels. Bit-error rates below $10......^-9$ are achieved for some channels and below forward-error-correction limit for all channels, corresponding to a 1.19-Tb/s error-free data signal....

  13. Case report: Isolated unilateral pulmonary vein atresia diagnosed on 128-slice multidetector CT

    Directory of Open Access Journals (Sweden)

    Rashmi Dixit

    2011-01-01

    Full Text Available Unilateral pulmonary venous atresia is an uncommon entity that is generally believed to be congenital. Most patients present in infancy or childhood with recurrent chest infections or hemoptysis. Pulmonary angiography is usually used for definitive diagnosis. However, the current multislice CT scanners may obviate the need for pulmonary angiography. We report two cases diagnosed using 128-slice CT angiography. On the CT angiography images both these cases demonstrated absent pulmonary veins on the affected side, with a small pulmonary artery and prominent bronchial or other systemic arterial supply.

  14. Chiral geometry in symmetry-restored states: Chiral doublet bands in 128Cs

    Science.gov (United States)

    Chen, F. Q.; Chen, Q. B.; Luo, Y. A.; Meng, J.; Zhang, S. Q.

    2017-11-01

    The pairing-plus-quadrupole Hamiltonian is diagonalized in a symmetry-restored basis, i.e., the triaxial quasiparticle states with angular momentum and particle number projections, and applied for chiral doublet bands in 128Cs. The observed energy spectra and electromagnetic transition probabilities are reproduced well without introducing any parameters. The orientation of the angular momentum in the intrinsic frame is investigated by the distributions of its components on the three principle axes (K plot) and those of its tilted angles (azimuthal plot). The evolution of the chirality with spin is illustrated, and the chiral geometry is demonstrated in the angular momentum projected model for the first time.

  15. Inadvertently programmed bits in Samsung 128 Mbit flash devices: a flaky investigation

    Science.gov (United States)

    Swift, G.

    2002-01-01

    JPL's X2000 avionics design pioneers new territory by specifying a non-volatile memory (NVM) board based on flash memories. The Samsung 128Mb device chosen was found to demonstrate bit errors (mostly program disturbs) and block-erase failures that increase with cycling. Low temperature, certain pseudo- random patterns, and, probably, higher bias increase the observable bit errors. An experiment was conducted to determine the wearout dependence of the bit errors to 100k cycles at cold temperature using flight-lot devices (some pre-irradiated). The results show an exponential growth rate, a wide part-to-part variation, and some annealing behavior.

  16. Multicollision attack on CBC-MAC, EMAC, and XCBC-MAC of AES-128 algorithm

    Science.gov (United States)

    Brolin Sihite, Alfonso; Hayat Susanti, Bety

    2017-10-01

    A Message Authentication Codes (MAC) can be constructed based on a block cipher algorithm. CBC-MAC, EMAC, and XCBC-MAC constructions are some of MAC schemes that used in the hash function. In this paper, we do multicollision attack on CBC-MAC, EMAC, and XCBC-MAC construction which uses AES-128 block cipher algorithm as basic construction. The method of multicollision attack utilizes the concept of existential forgery on CBC-MAC. The results show that the multicollision can be obtained easily in CBC-MAC, EMAC, and XCBC-MAC construction.

  17. Fermilab 500 GeV main accelerator rf cavity 128 MHz mode damper

    Energy Technology Data Exchange (ETDEWEB)

    Kerns, Q.A.; Miller, H.W.

    1977-01-01

    The Fermilab 500-GeV main accelerating system has been operating for a year now with the aid of 128-MHz mode dampers. Such dampers proved to be necessary to achieve stable operation and a reasonably smooth slow spill at intensities of approximately 2 x 10/sup 13/ protons per pulse, and furthermore are low-cost and reliable. The approach used to identify troublesome modes, the observed beam blow-up without dampers, and the steps taken to design and install suitable dampers on eighteen main ring cavities are discussed. Spectrum analyzer pictures help illustrate the performance.

  18. Wavelength conversion of a 128 Gbit/s DP-QPSK signal in a silicon polarization diversity circuit

    DEFF Research Database (Denmark)

    Vukovic, Dragana; Schroeder, Jochen; Ding, Yunhong

    2014-01-01

    Wavelength conversion of a 128 Gbit/s DP-QPSK signal is demonstrated using FWM in a polarization diversity circuit with silicon nanowires as nonlinear elements. Error-free performances are achieved with a negligible power penalty....

  19. Hypertrophic cardiomyopathy: prognostic factors and survival analysis in 128 Egyptian patients.

    Science.gov (United States)

    El-Saiedi, Sonia A; Seliem, Zeinab S; Esmail, Reem I

    2014-08-01

    Hypertrophic cardiomyopathy is an important cause of disability and death in patients of all ages. Egyptian children may differ from Western and Asian patients in the pattern of hypertrophy distribution, clinical manifestations, and risk factors. The aim of our study was to report the clinical characteristics and outcomes of Egyptian children with hypertrophic cardiomyopathy studied over a 7-year duration and to determine whether the reported adult risk factors for sudden cardiac death are predictive of the outcome in these affected children. This retrospective study included 128 hypertrophic cardiomyopathy children. The data included personal history, family history, physical examination, baseline laboratory measurements, electrocardiogram, and Holter and echocardiographic results. Logistic regression analysis was used for the detection of risk factors of death. Fifty-one out of 128 patients died during the period of the study. Of the 51 deaths, 36 (70.5%) occurred in patients presenting before 1 year of age. Only eight patients had surgical intervention. Extreme left ventricular hypertrophy, that is, interventricular septal wall thickness or posterior wall thickness Z-score >6, sinus tachycardia, and supraventricular tachycardia were found to be independent risk factors for prediction of death in patients with hypertrophic cardiomyopathy. At our Egyptian tertiary care centre, hypertrophic cardiomyopathy has a relatively worse prognosis when compared with reports from Western and Asian series. Infants have a worse outcome than children presenting after the age of 1 year. A poorer prognosis in childhood hypertrophic cardiomyopathy is predicted by an extreme left ventricular hypertrophy, the presence of sinus tachycardia, and supraventricular tachycardia.

  20. Historia de los MSS BH 133 y 128 de Alfonso de Palencia

    Directory of Open Access Journals (Sweden)

    Durán Barceló, Javier

    2012-07-01

    Full Text Available El investigador que inspeccione los volúmenes UCM BH MSS 133 y 128 de Alfonso de Palencia encontrará un buen número de marcas y cotas librarias acumuladas a lo largo de su historia. Como veremos en este trabajo, estas signaturas tienen su correspondencia en los inventarios y catálogos de la biblioteca del Colegio de San Ildefonso desde 1720, 1745, 1800 y 1878. Además, la historia de estos manuscritos se puede rastrear hasta la fundación del Colegio mediante un examen analítico de los primitivos inventarios de la librería ildefonsina incluso más allá del año 1517.The researcher who inspects volumes UCM BH MSS 133 and 128 of Alfonso de Palencia will encounter a great variety of old call numbers and librarian marks accumulated throughout their history. As we will find out in this paper, these call numbers have also a parallel existence in the inventories and catalogues of the Library of the Colegio de San Ildefonso produced since 1720, 1745, 1800 y 1878. But the history of these manuscripts can be also traced back to the foundation of the College, as it is demonstrated by an analytical examination of the earlier Library inventories as far as 1517 and beyond.

  1. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  2. Web Server Berbasis ATmega 128 Untuk Monitoring dan Kontrol Peralatan Rumah

    Directory of Open Access Journals (Sweden)

    Sigit Pramono

    2015-05-01

    Full Text Available Penggunaan mikropengendali untuk mengendalikan perangkat yang ada di rumah tentu menjadi salah satu penerapan prinsip kerja yang praktis dan fleksibel.Mikropengendali dapat digunakan untuk memudahkan dalam mengendalikan lampu ruangan, pemantauan suhu, dan pengendalian sistem penggerak tirai.Dengan memanfaatkan modul jaringanNM7010A TCP/IP Starter Kit maka aplikasi rumah tersebut dapat dikendalikan melalui jaringan intranet. Pada mikropengendali ATmega128, data akan diproses dan dieksekusi untuk mengendalikan sistem kerja keseluruhan rangkaian. Dari hasil pengujian membuktikan bahwa mikropengendali dapat berperan sebagai Embedded Server untuk mengendalikan lampu, pengaktifan kanal Analog to Digital Converter (ADC yang digunakan untuk memantau suhu.Hasil pengujian terhadap LM35 menunjukan bahwa rata-rata error konversi sebesar 0,64%. Untuk mengeksekusi sistem melalui jaringan TCP/IP diperlukan waktu tunda antara 0,5 sampai 1,2 detik.

  3. Observation of a γ-decaying millisecond isomeric state in 128Cd80

    Directory of Open Access Journals (Sweden)

    A. Jungclaus

    2017-09-01

    Full Text Available A new high-spin isomer in the neutron-rich nucleus 128Cd was populated in the projectile fission of a 238U beam at the Radioactive Isotope Beam Factory at RIKEN. A half-life of T1/2=6.3(8 ms was measured for the new state which was tentatively assigned a spin/parity of (15−. The experimental results are compared to shell model calculations performed using state-of-the-art realistic effective interactions and to the neighbouring nucleus 129Cd. In the present experiment no evidence was found for the decay of a 18+ E6 spin-trap isomer, based on the complete alignment of the two-neutron and two-proton holes in the 0h11/2 and the 0g9/2 orbit, respectively, which is predicted to exist by the shell model.

  4. Evaluation of Malthus 128H microbiological growth analyser for detecting significant bacteriuria.

    Science.gov (United States)

    Smith, T K; Eggington, R; Pease, A A; Harris, D M; Spencer, R C

    1985-08-01

    In a pilot study a prototype Malthus 128H microbiological growth analyser was used to study the growth of six commonly encountered urinary pathogens in a range of five different laboratory media. No single medium had been able to show acceptable conductance changes for all bacteria within five hours. Subsequently, the Malthus system, with fastidious anaerobe broth as the culture medium, was used to screen 500 consecutive clinical specimens of urine for significant bacteriuria. After two and a half hours the Malthus system detected 32 out of the 40 true positives and eight of the 44 contaminated urines. Increasing the detection time to five hours permitted the recognition of 39 true positives and 37 contaminated urines.

  5. Implementation of 128 bits Camellia Algorithm for Cryptography in Digital Image

    Science.gov (United States)

    Satrio Waluyo Poetro, Bagus

    2017-04-01

    Nowadays information technology requires stronger cryptographic algorithms. Camellia algorithm is also known for its suitability in terms of the implementation of both software and hardware as well as a high level of safety. The digital image is an image f (x, y) which having the spatial coordinates, and brightness levels are discrete. Unlike text messages, the image data has special features such as high redundancy and a high correlation between pixels. This research conducted a cryptographic process of the digital image using the Camellia algorithm. Comparisons were made on three digital image format .bmp, .jpg, .png with 128 bits key block Camellia algorithm. Results shows that Camellia cryptographic algorithms in digital image can successfully produce encrypted images. In addition, the same algorithm can also reproduce the image when decryption process.

  6. The production and certification of a plutonium equal-atom reference material: NBL CRM 128

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, D.W. (Department of Energy, Washington, DC (USA). Office of Safeguards and Security); Gradle, C.G.; Soriano, M.D. (USDOE New Brunswick Lab., Argonne, IL (USA))

    1990-07-01

    This report describes the design, production, and certification of the New Brunswick Laboratory plutonium equal-atom certified reference material (CRM), NBL CRM 128. The primary use of this CRM is for the determination of bias corrections encountered in the operation of a mass spectrometer. This reference material is available to the US Department of Energy contractor-operated and government-operated laboratories, as well as to the international nuclear safeguards community. The absolute, or unbiased, certified value for the CRM's Pu-242/Pu-239 ratio is 1.00063 {plus minus} 0.00026 (95% confidence interval) as of October 1, 1984. This value was obtained through the quantitative blending of high-purity, chemically and isotopically characterized separated isotopes, as well as through intercomparisons of CRM samples with calibration mixtures using thermal ionization mass spectrometry. 32 tabs.

  7. Genetically engineered mesenchymal stem cells reduce behavioral deficits in the YAC 128 mouse model of Huntington's disease.

    Science.gov (United States)

    Dey, Nicholas D; Bombard, Matthew C; Roland, Bartholomew P; Davidson, Stacy; Lu, Ming; Rossignol, Julien; Sandstrom, Michael I; Skeel, Reid L; Lescaudron, Laurent; Dunbar, Gary L

    2010-12-25

    The purpose of this study was to evaluate the therapeutic effects of the transplantation of bone-marrow mesenchymal stem cells (MSCs), genetically engineered to over-express brain-derived neurotrophic factor (BDNF) or nerve growth factor (NGF) on motor deficits and neurodegeneration in YAC 128 transgenic mice. MSCs, harvested from mouse femurs, were genetically engineered to over-express BDNF and/or NGF and these cells, or the vehicle solution, were injected into the striata of four-month old YAC 128 transgenic and wild-type mice. Assessments of motor ability on the rotarod and the severity of clasping were made one day prior to transplantation and once monthly, thereafter, to determine the effects of the transplanted cells on motor function. The mice were sacrificed at 13-months of age for immunohistological examination. All YAC 128 mice receiving transplants had reduced clasping, relative to vehicle-treated YAC 128 mice, while YAC 128 mice that were transplanted with MSCs which were genetically engineered to over-express BDNF, had the longest latencies on the rotarod and the least amount of neuronal loss within the striatum of the YAC 128 mice. These results indicate that intrastriatal transplantation of MSCs that over-express BDNF may create an environment within the striatum that slows neurodegenerative processes and provides behavioral sparing in the YAC 128 mouse model of HD. Further research on the long-term safety and efficacy of this approach is needed before its potential clinical utility can be comprehensively assessed. Copyright (c) 2010 Elsevier B.V. All rights reserved.

  8. Coronary CT angiography for acute chest pain triage: Techniques for radiation exposure reduction; 128 vs. 64 multidetector CT

    Energy Technology Data Exchange (ETDEWEB)

    Goitein, Orly; Eshet, Yael; Konen, Eli (Diagnostic Imaging, Sheba Medical Center, Tel Hashomer, and the Sackler Faculty of Medicine, Tel Aviv Univ., Tel Aviv (Israel)), email: orly.goitein@sheba.health.gov.il; Matetzky, Shlomi (Heart Inst., Sheba Medical Center, Tel Hashomer, and the Sackler Faculty of Medicine, Tel Aviv Univ., Tel Aviv (Israel)); Goitein, David (Surgery C, Sheba Medical Center, Tel Hashomer, and the Sackler Faculty of Medicine, Tel Aviv Univ., Tel Aviv (Israel)); Hamdan, Ashraf; Di Segni, Elio (Diagnostic Imaging, Sheba Medical Center, Tel Hashomer, and the Sackler Faculty of Medicine, Tel Aviv Univ., Tel Aviv (Israel); Heart Inst., Sheba Medical Center, Tel Hashomer, and the Sackler Faculty of Medicine, Tel Aviv Univ., Tel Aviv (Israel))

    2011-10-15

    Background. Coronary CT angiography (CCTA) is used daily in acute chest pain triage, although exposing patients to significant radiation dosage. CCTA using prospective ECG gating (PG CCTA) enables significant radiation reduction Purpose. To determine whether the routine use of 128 vs. 64 multidetector CT (MDCT) can increase the proportion of patients scanned using PG CCTA technique, lowering radiation exposure, without decreasing image quality. Material and Methods. The study comprised 232 patients, 116 consecutive patients scanned using 128 MDCT (mean age 49 years, 79 men, BMI 28) and 116 consecutive patients (mean age 50 years, 75 men, BMI 28) which were scanned using 64 MDCT. PG CCTA was performed whenever technically permissible by each type of scanner: 64 MDCT = stable heart rate (HR) <60/min and weight <110 kg; 128 MDCT = stable HR < 70/min and weight <140 kg. All coronary segments were evaluated for image quality using a visual scale of 1-5. An estimated radiation dose was recorded. Results. PC CCTA was performed in 84% and 49% of the 128 and 64 MDCT groups, respectively (P < 0.0001). Average image quality score were 4.6 +- 0.3 and 4.7 +- 0.1 for the 128 and 64 MDCT, respectively (P = 0.08). The mean radiation dose exposure was 6.2 +- 4.8 mSv and 10.4 +- 7.5 mSv for the 128 and 64 MDCT, respectively (P = 0.008). Conclusion. The 128 MDCT scanner enables utilization of PG CCTA technique in a greater proportion of patients, thereby decreasing the related radiation significantly, without hampering image quality

  9. Physical, Mechanical, and Thermal Analysis of Polylactic Acid/Fumed Silica/Clay (1.28E Nanocomposites

    Directory of Open Access Journals (Sweden)

    Josephine Chang Hui Lai

    2015-01-01

    Full Text Available Polylactic acid/fumed silica/clay (PLA/FS/clay (1.28E nanocomposites have been successfully prepared by solution-intercalation film-casting technique. The resultant nanocomposites were characterized by Fourier Transform Infrared Spectroscopy (FT-IR, Scanning Electron Microscopy (SEM, tensile test, thermogravimetric analysis (TGA, and moisture absorption test. The FT-IR spectrum indicated that PLA/FS/clay with 2 wt% had much broader peak compared to 5 wt%, 10 wt%, and 15 wt% nanocomposites. Incorporation of clay (1.28E with 2 wt% showed the best compatibility with PLA/FS matrix. PLA/FS/clay (1.28E nanocomposite with 2 wt% of clay loading had higher tensile strength and modulus compared to other nanocomposites. The thermal stability and activation energy of 2 wt% of PLA/FS/clay (1.28E nanocomposite are the highest among all the nanocomposites. The moisture absorbed into PLA/FS/clay (1.28E nanocomposite was significantly reduced with clay loading of 2 wt%.

  10. microRNA miR-128 represses LINE-1 retrotransposition by downregulating the nuclear import factor TNPO1.

    Science.gov (United States)

    Idica, Adam; Sevrioukov, Evgueni A; Zisoulis, Dimitri G; Hamdorf, Matthias; Daugaard, Iben; Kadandale, Pavan; Pedersen, Irene Munk

    2017-10-03

    Repetitive elements, including LINE-1 (L1), comprise approximately half of the human genome. These elements can potentially destabilize the genome by initiating their own replication and reintegration into new sites (retrotransposition). In somatic cells, transcription of L1 elements are repressed by distinct molecular mechanisms including DNA methylation and histone modifications to repress transcription. Under conditions of hypomethylation (e.g. in tumor cells) a window of opportunity for L1 de-repression arises and additional restriction mechanisms become crucial. We recently demonstrated that the microRNA miR-128 represses L1 activity by directly binding to L1 ORF2 RNA. In this study, we tested whether miR- 128 can also control L1 activity by repressing cellular proteins important for L1 retrotransposition. We found that miR-128 targets the 3'UTR of the nuclear import factor transportin 1 (TNPO1) mRNA. Manipulation of miR-128 and TNPO1 levels demonstrated that induction or depletion of TNPO1 affects L1 retrotransposition and nuclear import of an L1-RNP complex (using L1-encoded ORF1p as a proxy for L1-RNP complexes). Moreover, TNPO1 overexpression partially reversed the repressive effect of miR-128 on L1 retrotransposition. Our study represents the first description of a protein factor involved in nuclear import of the L1 element and demonstrates that miR-128 controls L1 activity in somatic cells through two independent mechanisms: direct binding to L1 RNA, and regulating a cellular factor necessary for L1 nuclear import and retrotransposition. Copyright © 2017, The American Society for Biochemistry and Molecular Biology.

  11. Remaining Sites Verification Package for the 128-B-3 Burn Pit Site, Waste Site Reclassification Form 2006-058

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2006-11-17

    The 128-B-3 waste site is a former burn and disposal site for the 100-B/C Area, located adjacent to the Columbia River. The 128-B-3 waste site has been remediated to meet the remedial action objectives specified in the Remaining Sites ROD. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results of sampling at upland areas of the site also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  12. Observation of a γ -decaying millisecond isomeric state in 128 Cd 80

    Energy Technology Data Exchange (ETDEWEB)

    Jungclaus, A.; Grawe, H.; Nishimura, S.; Doornenbal, P.; Lorusso, G.; Simpson, G. S.; Söderström, P. -A.; Sumikama, T.; Taprogge, J.; Xu, Z. Y.; Baba, H.; Browne, F.; Fukuda, N.; Gernhäuser, R.; Gey, G.; Inabe, N.; Isobe, T.; Jung, H. S.; Kameda, D.; Kim, G. D.; Kim, Y. -K.; Kojouharov, I.; Kubo, T.; Kurz, N.; Kwon, Y. K.; Li, Z.; Sakurai, H.; Schaffner, H.; Shimizu, Y.; Steiger, K.; Suzuki, H.; Takeda, H.; Vajta, Zs.; Watanabe, H.; Wu, J.; Yagi, A.; Yoshinaga, K.; Benzoni, G.; Bönig, S.; Chae, K. Y.; Coraggio, L.; Daugas, J. -M.; Drouet, F.; Gadea, A.; Gargano, A.; Ilieva, S.; Itaco, N.; Kondev, F. G.; Kröll, T.; Lane, G. J.; Montaner-Pizá, A.; Moschner, K.; Mücher, D.; Naqvi, F.; Niikura, M.; Nishibata, H.; Odahara, A.; Orlandi, R.; Patel, Z.; Podolyák, Zs.; Wendt, A.

    2017-09-01

    A new high-spin isomer in the neutron-rich nucleus 128Cd was populated in the projectile fission of a 238U beam at the Radioactive Isotope Beam Factory at RIKEN. A half-life of T1/2 = 6.3(8) ms was measured for the new state which was tentatively assigned a spin/parity of (15-). The experimental results are compared to shell model calculations performed using state-of-the-art realistic effective interactions and to the neighbouring nucleus 129Cd. In the present experiment no evidence was found for the decay of a 18+ E6 spin-trap isomer, based on the complete alignment of the two-neutron and two-proton holes in the 0h11/2 and the 0g9/2 orbit, respectively, which is predicted to exist by the shell model.

  13. 128 Gb/s TWDM PON system using dispersion-supported transmission method

    Science.gov (United States)

    Bindhaiq, Salem; Zulkifli, Nadiatulhuda; Supa'at, Abusahmah M.; Idrus, Sevia M.; Salleh, M. S.

    2017-11-01

    Time and wavelength division multiplexed passive optical network (TWDM-PON) trend is considered as the most extraordinary trend of the next generation solution to accommodate exponential traffic growth for converged new services. In this paper, we briefly review recent progress on TWDM-PON system through the use of low cost directly modulated lasers (DMLs) transmission for various line rate transmissions to date. Furthermore, through simulation, we propose and evaluate a cost effective way to upgrade TWDM-PON up to a symmetric capacity of 128 Gb/s using fiber Bragg gratings (FBGs) in optical line terminal (OLT) as a paramount dispersion manager in high speed light-wave systems in both upstream and downstream directions. A low cost and potential chirpless directed modulated grating laser (DMGL) is employed for downstream link and DML with a single delay-interferometer (DI) is employed for upstream link. After illustrating the demonstrated system architecture and configuration, we present the results and analysis to prove the system feasibility. The results show that a successful transmission is achieved over 40 km single mode fiber with a power budget of 33.7 dB, which could support 1:256 splitting ratio.

  14. Core Needle Percutaneous Transpedicular Vertebral Body Biopsy: A Study of 128 Cases.

    Science.gov (United States)

    Kamei, Yoichi; Nishida, Jun; Mimata, Yoshikuni; Shiraishi, Hideo; Ehara, Shigeru; Satoh, Takashi; Shimamura, Tadashi

    2015-08-01

    We report an accurate technique for percutaneous transpedicular core needle biopsy of vertebral body lesions, and evaluate its effectiveness for histologic diagnosis retrospectively. The purpose of this study is to evaluate the effectiveness and accuracy of this method retrospectively. Better knowledge of vertebral pedicle morphometry has led to the development of transpedicular fixation techniques in spinal surgery. After experience with these techniques, we have been performing percutaneous transpedicular vertebral body core needle biopsies (transpedicular biopsy) for histologic diagnosis since 1993. A total of 128 patients who had undergone transpedicular biopsy for T1-L5 vertebral body lesions were evaluated. The biopsies were carried out under local anesthesia, except in children, for whom general anesthesia was used. Biopsy specimens were obtained by passing 8 or 11 G needle biopsy instruments percutaneously through the pedicle into the site of the lesion under C-arm fluoroscopy guidance. Histologic analyses were performed, and the accuracy and effectiveness of this technique were evaluated. The pathologic evaluations were definitive in 120 patients (93.8%) and not diagnostic in 8. The accuracy of the results differed among the diagnostic categories. Diagnostic accuracy was 78.6% for primary neoplasms and 97.0% for metastatic neoplasms. There was a significant difference in the diagnostic criteria and spinal segment. True positive rate was higher in the thoracic spine (92.2%) than that of lumbar spine (76.6%). Transpedicular biopsy is a useful procedure for evaluation of thoracic and lumbar vertebral body lesions.

  15. The Spatial Structure of the 128 ka Antarctic Sea Ice Minimum

    Science.gov (United States)

    Holloway, Max D.; Sime, Louise C.; Allen, Claire S.; Hillenbrand, Claus-Dieter; Bunch, Pete; Wolff, Eric; Valdes, Paul J.

    2017-11-01

    We compare multi-ice core data with δ18O model output for the early last interglacial Antarctic sea ice minimum. The spatial pattern of δ18O across Antarctica is sensitive to the spatial pattern of sea ice retreat. Local sea ice retreat increases the proportion of winter precipitation, depleting δ18O at ice core sites. However, retreat also enriches δ18O because of the reduced source-to-site distance for atmospheric vapor. The joint overall effect is for δ18O to increase as sea ice is reduced. Our data-model comparison indicates a winter sea ice retreat of 67, 59, and 43% relative to preindustrial in the Atlantic, Indian, and Pacific sectors of the Southern Ocean. A compilation of Southern Ocean sea ice proxy data provides weak support for this reconstruction. However, most published marine core sites are located too far north of the 128,000 years B.P. sea ice edge, preventing independent corroboration for this sea ice reconstruction.

  16. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  17. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS); Die Dynamik des laserinduzierten Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS)

    Energy Technology Data Exchange (ETDEWEB)

    Kaempfer, Tino

    2009-12-15

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [German] Die vorliegende Arbeit ist der experimentellen Untersuchung des Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS) gewidmet. Es werden temperatur- und zeitaufgeloeste Experimente zur Charakterisierung des Phasenuebergangs gemischt-valenter SmS Proben (M-SmS) vorgestellt. Die Messung der Dynamik des laserinduzierten Phasenuebergangs erfolgt ueber zeitaufgeloeste Ultrakurzzeit-Mikroskopie und durch Roentgenbeugung mit subpikosekunden Zeitaufloesung. Die elektronischen und strukturellen Prozesse, welche einer Anregung von M-SmS mit infraroten Femtosekunden-Laserpulsen folgen, werden auf der Basis der in dieser Arbeit gewonnenen Ergebnisse und Modellvorstellungen physikalisch interpretiert. (orig.)

  18. A CMOS 128-APS linear array integrated with a LVOF for highsensitivity and high-resolution micro-spectrophotometry

    NARCIS (Netherlands)

    Liu, C.; Emadi, A.; Wu, H.; De Graaf, G.; Wolffenbuttel, R.F.

    A linear array of 128 Active Pixel Sensors has been developed in standard CMOS technology and a Linear Variable Optical Filter (LVOF) is added using CMOS-compatible post-process, resulting in a single chip highly-integrated highresolution microspectrometer. The optical requirements imposed by the

  19. Clustering in ICT: From Route 128 to Silicon Valley, from DEC to Google, from Hardware to Content

    NARCIS (Netherlands)

    W. Hulsink (Wim); D. Manuel; H. Bouwman (Harry)

    2007-01-01

    textabstractOne of the pioneers in academic entrepreneurship and high-tech clustering is MIT and the Route 128/Boston region. Silicon Valley centered around Stanford University was originally a fast follower and only later emerged as a scientific and industrial hotspot. Several technology and

  20. 1.28 Tbaud Nyquist-OTDM Transmission over a 7-Core Fiber Using an On-Chip SDM Coupler

    DEFF Research Database (Denmark)

    Hu, Hao; Medhin, Ashenafi Kiros; Ye, Feihong

    2014-01-01

    We have demonstrated the first 1.28-Tbaud Nyquist-OTDM-SDM transmission over a 67.4 - km seven-core fiber with an aggregated data rate of 7.2 Tbit/s using a silicon SDM coupler. 10 - GHz control pulses were transmitted through the center core...

  1. 77 FR 29581 - Approval and Promulgation of Implementation Plans; Florida; Section 128 and 110(a)(2)(E)(ii) and...

    Science.gov (United States)

    2012-05-18

    .... What is parallel processing? II. Background III. What elements are required under Sections 110(a)(1) and (2)? IV. What is EPA's analysis of how Florida addressed CAA Section 128? V. What is EPA's analysis of how Florida addressed CAA Section 110(a)(2)(E)(ii)? VI. What is EPA's analysis of how Florida...

  2. 49 CFR 176.128 - Magazine stowage types “A”, “C” and Special Stowage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Magazine stowage types âAâ, âCâ and Special... CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Stowage § 176.128 Magazine...” and “Special”. (b) Magazine stowage type “A”. Magazine stowage type A is required for those substances...

  3. Longitudinal analyses of operant performance on the serial implicit learning task (SILT) in the YAC128 Huntington's disease mouse line.

    Science.gov (United States)

    Brooks, Simon P; Jones, Lesley; Dunnett, Stephen B

    2012-06-01

    Huntington's disease is a genetic disorder characterised by progressive striatal and cortical neurodegeneration, resulting in a broad range of motor, cognitive and behavioural abnormalities. The disease is caused by a single mutation in the gene responsible for the protein huntingtin, increasing the number of polyQ repeats and conferring a toxic gain of function to the mutant protein, which ultimately induces cell death. Several mouse models of HD are available. The YAC128 mouse model carries 128 CAG repeats and is known to develop several HD-like symptoms. This model has been well characterised on the FVB/N background strain, a strain that develops severe retinal degeneration. We have therefore sought to characterise YAC128 deficit in mice backcrossed onto the C57BL/6j background strain which is free of visual deficits and therefore more amenable to behavioural testing. In a parallel study (this special issue) we have provided a longitudinal characterisation of the emergence of a motor phenotype in the YAC128/C57BL mice. In the present paper, we have undertaken a more detailed characterisation of cognitive impairment in this mouse line at 6, 12, and 18 months of age using the operant serial implicit learning task (SILT), a task that was first designed to assess impairments in mice similar to the implicit serial learning impairments in HD patients task, and which has subsequently been shown to be highly sensitive to cortico-striatal disruption in mice. On the SILT task, the mouse must attain rewards by correctly nose-poking to 2 stimulus lights (S1 and S2) presented randomly and sequentially in 5 holes (deemed A-E) on a light array. Performance is measured by accuracy and speed of response to the S1 and S2 stimuli. Embedded within the random sequences, was a predictable sequence whereby an S1 in hole B is always followed by the S2 in hole D, which constitutes an implicit learning probe. The YAC128 carriers were less accurate in their responses to both S1 and S2

  4. The novel mTORC1/2 dual inhibitor INK-128 suppresses survival and proliferation of primary and transformed human pancreatic cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Lou, Hai-zhou [Department of Medical Oncology, Sir Run Run Shaw Hospital, College of Medicine, Zhejiang University, Hangzhou 310016 (China); Weng, Xiao-chuan [Department of Anesthesiology, Hangzhou Xia-sha Hospital, Hangzhou 310018 (China); Pan, Hong-ming; Pan, Qin [Department of Medical Oncology, Sir Run Run Shaw Hospital, College of Medicine, Zhejiang University, Hangzhou 310016 (China); Sun, Peng [Department of Medical Oncology, Sun Yat-Sen University Cancer Center, Guangzhou 510060 (China); Liu, Li-li [Department of Medical Oncology, Sir Run Run Shaw Hospital, College of Medicine, Zhejiang University, Hangzhou 310016 (China); Chen, Bin, E-mail: chenbinhangzhou126@126.com [Department of Hepatopancreatobiliary Surgery, First People’s Hospital of Hangzhou, Hangzhou 310006 (China)

    2014-07-25

    Highlights: • INK-128 inhibits the survival and growth of human pancreatic cancer cells. • INK-128 induced pancreatic cancer cell apoptosis and necrosis simultaneously. • INK-128 blocks mTORC1/2 activation simultaneously in pancreatic cancer cells. • INK-128 down-regulates cyclin D1 and causes pancreatic cancer cell cycle arrest. • INK-128 significantly increases sensitivity of pancreatic cancer cells to gemcitabine. - Abstract: Pancreatic cancer has one of worst prognosis among all human malignancies around the world, the development of novel and more efficient anti-cancer agents against this disease is urgent. In the current study, we tested the potential effect of INK-128, a novel mammalian target of rapamycin (mTOR) complex 1 and 2 (mTORC1/2) dual inhibitor, against pancreatic cancer cells in vitro. Our results demonstrated that INK-128 concentration- and time-dependently inhibited the survival and growth of pancreatic cancer cells (both primary cells and transformed cells). INK-128 induced pancreatic cancer cell apoptosis and necrosis simultaneously. Further, INK-128 dramatically inhibited phosphorylation of 4E-binding protein 1 (4E-BP1), ribosomal S6 kinase 1 (S6K1) and Akt at Ser 473 in pancreatic cancer cells. Meanwhile, it downregulated cyclin D1 expression and caused cell cycle arrest. Finally, we found that a low concentration of INK-128 significantly increased the sensitivity of pancreatic cancer cells to gemcitabine. Together, our in vitro results suggest that INK-128 might be further investigated as a novel anti-cancer agent or chemo-adjuvant for pancreatic cancer treatment.

  5. Clinical significance of the UGT1A1*28 allele detection in HIV-infected patients

    Directory of Open Access Journals (Sweden)

    Veronika Kanestri

    2014-11-01

    Full Text Available Introduction: The UGT1A1*28 (rs8175347 polymorphism is associated with hyperbilirubinemia. The presence of 6 TA-repeats in the UGT1A1 gene promoter region corresponds to normal UGT1TA1 activity. A detection of 7 TA-repeats in hetero- or homozygous individuals [(TA6/(TA7 and (TA7/(TA7] is associated with lower UGT1TA1 activity, which may eventually result in the development of Gilbert syndrome and/or modified individual response to drugs metabolized by this enzyme. ATV contributes to the decreased levels of UGT1A1, which may lead to elevations of indirect bilirubin, jaundice and even to therapy discontinuation. We evaluated the prevalence of the UGT1A1*28 among HIV-infected patients and the dependence of the frequency and severity of AE during ATV treatment on individual genetic characteristics. Materials and Methods: 47 HIV-infected patients was screen for UGT1A1 genotype and the presence of UGT1A1*28. All patients received ATV in the HAART regimen for 48 weeks. Changes in the total, direct and indirect bilirubin, ALT, AST, GGT and jaundice were evaluated. Statistical analysis was performed using Microsoft Office Excel for Windows XP Professional 2007 and Biostat. Results: All patients were followed up in the AIDS Center (males 72.3%, median age 33 years, median CD4+ count-282 cells/µl (19.5%. HBV/HCV was in 36.2% patients. Ten patients had risk factors that could affect bilirubin turnover (chronic cholecystitis, biliary dyskinesia, etc.. Genotype (TA6/(TA6 was found in 42.6% patients, (TA6/(TA7-42.6% and (TA7/(TA7-14.9%. Overall prevalence of UGT1A1*28 was 57.4%, and homozygous allele frequency was 14.9%. G3/4 of indirect bilirubin were detected in 36.2% patients [(TA6/(TA6 in 10–20%, (TA6/(TA7-25-40%, (TA7/(TA7-72-86%], and significant jaundice in 10.6% [80% with (TA7/(TA7]. The OR for hyperbilirubinemia>40 µmol/L in patients with heterozygous UGT1A1*28 was increased 3 times over patients without this allele (OR 3.07, 95% CI 1.54–4.6 and

  6. First Measurement of the g Factor in the Chiral Band: The Case of the Cs 128 Isomeric State

    Science.gov (United States)

    Grodner, E.; Srebrny, J.; Droste, Ch.; Próchniak, L.; Rohoziński, S. G.; Kowalczyk, M.; Ionescu-Bujor, M.; Ur, C. A.; Starosta, K.; Ahn, T.; Kisieliński, M.; Marchlewski, T.; Aydin, S.; Recchia, F.; Georgiev, G.; Lozeva, R.; Fiori, E.; Zielińska, M.; Chen, Q. B.; Zhang, S. Q.; Yu, L. F.; Zhao, P. W.; Meng, J.

    2018-01-01

    The g factor of the 56 ns half-life isomeric state in Cs 128 has been measured using the time-differential perturbed angular distribution method. This state is the bandhead of the positive-parity chiral rotational band, which emerges when an unpaired proton, an unpaired neutron hole, and an even-even core are coupled such that their angular momentum vectors are aplanar (chiral configuration). g -factor measurements can give important information on the relative orientation of the three angular momentum vectors. The measured g factor g =+0.59 (1 ) shows that there is an important contribution of the core rotation in the total angular momentum of the isomeric state. Moreover, a quantitative theoretical analysis supports the conclusion that the three angular momentum vectors lie almost in one plane, which suggests that the chiral configuration in Cs 128 demonstrated in previous works by characteristic patterns of electromagnetic transitions appears only above some value of the total nuclear spin.

  7. 78 FR 19024 - Submission for Review: It's Time to Sign Up for Direct Deposit or Direct Express, RI 38-128

    Science.gov (United States)

    2013-03-28

    ... From the Federal Register Online via the Government Publishing Office OFFICE OF PERSONNEL MANAGEMENT Submission for Review: It's Time to Sign Up for Direct Deposit or Direct Express, RI 38-128 AGENCY... INFORMATION: RI 38-128 is primarily used by OPM to give recent retirees the opportunity to waive Direct...

  8. Optical waveform sampling and error-free demultiplexing of 1.28 Tbit/s serial data in a silicon nanowire

    DEFF Research Database (Denmark)

    Ji, Hua; Hu, Hao; Galili, Michael

    2010-01-01

    We experimentally demonstrate 640 Gbit/s and 1.28 Tbit/s serial data optical waveform sampling and 640-to-10 Gbit/s and 1.28 Tbit/s-to-10 Gbit/s error-free demultiplexing using four-wave mixing in a 300nm$$450nm$$5mm silicon nanowire....

  9. Clustering in ICT: From Route 128 to Silicon Valley, from DEC to Google, from Hardware to Content

    OpenAIRE

    Hulsink, W.; Manuel, D.; Bouwman, H.

    2007-01-01

    textabstractOne of the pioneers in academic entrepreneurship and high-tech clustering is MIT and the Route 128/Boston region. Silicon Valley centered around Stanford University was originally a fast follower and only later emerged as a scientific and industrial hotspot. Several technology and innovation waves, have shaped Silicon Valley over all the years. The initial regional success of Silicon Valley started with electro-technical instruments and defense applications in the 1940s and 1950s ...

  10. Amplification of DWDM channels at 1.28 Tb/s in a bidirectional fiber optical parametric amplifier.

    Science.gov (United States)

    Lei, Gordon K P; Marhic, Michel E

    2014-04-07

    We experimentally demonstrate amplification of 1.28 Tb/s DWDM channels using a bidirectional fiber optical parametric amplifier. The amplifier can provide more than 13 dB on-off gain on all 32 DWDM channels. Error-free operation has been achieved for all data streams, with an average power penalty of 2.5 dB compared with conventional unidirectional configuration.

  11. Mice lacking caspase-2 are protected from behavioral changes, but not pathology, in the YAC128 model of Huntington disease

    Directory of Open Access Journals (Sweden)

    Bissada Nagat

    2011-08-01

    Full Text Available Abstract Background Huntington Disease (HD is a neurodegenerative disorder in which caspase activation and cleavage of substrates, including the huntingtin protein, has been invoked as a pathological mechanism. Specific changes in caspase-2 (casp2 activity have been suggested to contribute to the pathogenesis of HD, however unique casp2 cleavage substrates have remained elusive. We thus utilized mice completely lacking casp2 (casp2-/- to examine the role played by casp2 in the progression of HD. This 'substrate agnostic' approach allows us to query the effect of casp2 on HD progression without pre-defining proteolytic substrates of interest. Results YAC128 HD model mice lacking casp2 show protection from well-validated motor and cognitive features of HD, including performance on rotarod, swimming T-maze, pre-pulse inhibition, spontaneous alternation and locomotor tasks. However, the specific pathological features of the YAC128 mice including striatal volume loss and testicular degeneration are unaltered in mice lacking casp2. The application of high-resolution magnetic resonance imaging (MRI techniques validates specific neuropathology in the YAC128 mice that is not altered by ablation of casp2. Conclusions The rescue of behavioral phenotypes in the absence of pathological improvement suggests that different pathways may be operative in the dysfunction of neural circuitry in HD leading to behavioral changes compared to the processes leading to cell death and volume loss. Inhibition of caspase-2 activity may be associated with symptomatic improvement in HD.

  12. Brain microRNAs and insights into biological functions and therapeutic potential of brain enriched miRNA-128.

    Science.gov (United States)

    Adlakha, Yogita K; Saini, Neeru

    2014-02-21

    MicroRNAs, the non-coding single-stranded RNA of 19-25 nucleotides are emerging as robust players of gene regulation. Plethora of evidences support that the ability of microRNAs to regulate several genes of a pathway or even multiple cross talking pathways have significant impact on a complex regulatory network and ultimately the physiological processes and diseases. Brain being a complex organ with several cell types, expresses more distinct miRNAs than any other tissues. This review aims to discuss about the microRNAs in brain development, function and their dysfunction in brain tumors. We also provide a comprehensive summary of targets of brain specific and brain enriched miRNAs that contribute to the diversity and plasticity of the brain. In particular, we uncover recent findings on miRNA-128, a brain-enriched microRNA that is induced during neuronal differentiation and whose aberrant expression has been reported in several cancers. This review describes the wide spectrum of targets of miRNA-128 that have been identified till date with potential roles in apoptosis, angiogenesis, proliferation, cholesterol metabolism, self renewal, invasion and cancer progression and how this knowledge might be exploited for the development of future miRNA-128 based therapies for the treatment of cancer as well as metabolic diseases.

  13. MicroRNA-128b suppresses tumor growth and promotes apoptosis by targeting A2bR in gastric cancer

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ping; Guo, Xueyan; Zong, Wei [Department of Gastroenterology, The Third Affiliated Hospital, College of Medicine, Xi' an Jiaotong University, Xi' an 710068 (China); Song, Bin [Department of General Surgery, The Third Affiliated Hospital, College of Medicine, Xi' an Jiaotong University, Xi' an 710068 (China); Liu, Guisheng [Department of Gastroenterology, The Third Affiliated Hospital, College of Medicine, Xi' an Jiaotong University, Xi' an 710068 (China); He, Shuixiang, E-mail: fisrstsxianghe@163.com [Department of Gastroenterology, The First Affiliated Hospital, College of Medicine, Xi' an Jiaotong University, Xi' an 710061 (China)

    2015-11-27

    MicroRNAs (miRNAs) play crucial roles in the development and progression of human cancers, including gastric cancer (GC). The discovery of miRNAs may provide a new and powerful tool for studying the mechanism, diagnosis, and treatment of GC. In this study, we aimed to investigate the role and mechanism of miR-128b in the development and progression of GC. Quantitative real-time PCR (qRT-PCR) was used to measure the expression level of miR-128b in GC tissues and cell lines. We found that miR-128b was significantly down-regulated in GC tissues and cell lines. In addition, over-expression of miR-128b inhibited GC cell proliferation, migration and invasion of GC cells in vitro. Gain-of-function in vitro experiments further showed that the miR-128b mimic significantly promoted GC cell apoptosis. Subsequent dual-luciferase reporter assay identified one of the proto-oncogene A2bR as direct target of miR-128b. Therefore, our results indicate that miR-128b is a proto-oncogene miRNA that can suppresses GC proliferation and migration through down-regulation of the oncogene gene A2bR. Taken together, our results indicate that miR-128b could serve as a potential diagnostic biomarker and therapeutic option for human GC in the near future. - Highlights: • The expression of MiR-128b is significantly down-regulated in GC tissues and cell lines. • Ectopic expression of miR-128b directly affects cell proliferation, migration and invasion in vitro. • Overexpression of miR-128b increases apoptosis in GC cells. • A2bR is a candidate target gene of miR-128b. • MiR-128b represses cell proliferation, migration and invasion and promotes apoptosis by targeting A2bR in GC.

  14. Diagnostic accuracy of 128-slice dual-source CT coronary angiography: a randomized comparison of different acquisition protocols

    Energy Technology Data Exchange (ETDEWEB)

    Neefjes, Lisan A.; Kate, Gert-Jan R. ten [Erasmus Medical Center, Department of Cardiology, Room Hs 207, P.O. Box 2040, Rotterdam (Netherlands); Erasmus Medical Center, Department of Radiology, Rotterdam (Netherlands); Interuniversity Cardiology Institute of the Netherlands, Utrecht (Netherlands); Rossi, Alexia; Nieman, Koen; Papadopoulou, Stella L.; Dharampal, Anoeshka S.; Dedic, Admir; Feyter, Pim J. de; Mollet, Nico R. [Erasmus Medical Center, Department of Cardiology, Room Hs 207, P.O. Box 2040, Rotterdam (Netherlands); Erasmus Medical Center, Department of Radiology, Rotterdam (Netherlands); Genders, Tessa S.S.; Hunink, M.G.M. [Erasmus Medical Center, Department of Radiology, Rotterdam (Netherlands); Erasmus Medical Center, Department of Epidemiology, Rotterdam (Netherlands); Schultz, Carl J. [Erasmus Medical Center, Department of Cardiology, Room Hs 207, P.O. Box 2040, Rotterdam (Netherlands); Weustink, Annick C.; Dijkshoorn, Marcel L.; Straten, Marcel van; Cademartiri, Filippo; Krestin, Gabriel P. [Erasmus Medical Center, Department of Radiology, Rotterdam (Netherlands)

    2013-03-15

    To compare the diagnostic performance and radiation exposure of 128-slice dual-source CT coronary angiography (CTCA) protocols to detect coronary stenosis with more than 50 % lumen obstruction. We prospectively included 459 symptomatic patients referred for CTCA. Patients were randomized between high-pitch spiral vs. narrow-window sequential CTCA protocols (heart rate below 65 bpm, group A), or between wide-window sequential vs. retrospective spiral protocols (heart rate above 65 bpm, group B). Diagnostic performance of CTCA was compared with quantitative coronary angiography in 267 patients. In group A (231 patients, 146 men, mean heart rate 58 {+-} 7 bpm), high-pitch spiral CTCA yielded a lower per-segment sensitivity compared to sequential CTCA (89 % vs. 97 %, P = 0.01). Specificity, PPV and NPV were comparable (95 %, 62 %, 99 % vs. 96 %, 73 %, 100 %, P > 0.05) but radiation dose was lower (1.16 {+-} 0.60 vs. 3.82 {+-} 1.65 mSv, P < 0.001). In group B (228 patients, 132 men, mean heart rate 75 {+-} 11 bpm), per-segment sensitivity, specificity, PPV and NPV were comparable (94 %, 95 %, 67 %, 99 % vs. 92 %, 95 %, 66 %, 99 %, P > 0.05). Radiation dose of sequential CTCA was lower compared to retrospective CTCA (6.12 {+-} 2.58 vs. 8.13 {+-} 4.52 mSv, P < 0.001). Diagnostic performance was comparable in both groups. Sequential CTCA should be used in patients with regular heart rates using 128-slice dual-source CT, providing optimal diagnostic accuracy with as low as reasonably achievable (ALARA) radiation dose. circle 128-slice dual-source CT coronary angiography offers several different acquisition protocols. (orig.)

  15. Frequency of the UGT1A1*28 Polymorphism in a Romanian Cohort of Gilbert Syndrome Individuals.

    Science.gov (United States)

    Radoi, Viorica E; Ursu, Radu I; Poenaru, Elena; Arsene, Cosmin; Bohiltea, Camil L; Bohiltea, Roxana

    2017-03-01

    Gilbert syndrome (GS) is characterized by unconjugated hyperbilirubinemia without liver disease or overt hemolysis and it is found in 3-10% of the general population. Inherited hyperbilirubinaemia is attributable to a reduced UGT1A1 activity. The UGT1A1 promoter (TA) repeats variants are documented of being involved in abnormally elevated bilirubin levels. The aim of the present study is to analyze the impact of UGT1A1 promoter variants on bilirubin levels in Romanian patients clinically supected with GS. The study group included 897 subjects: 292 GS patients and 605 healthy controls. Genomic DNA was extracted from the peripheral blood leukocytes. All individuals were screened for the presence of the (TA) insertion in the TATA box region of UGT1A1 gene by PCR amplification. This case-control study was conducted at the Department of Medical Genetics, Synevo, Romania. UGT1A1*28 (7TA) revealed the highest frequency (61.87%) of all individuals, while the UGT1A1*1 (6TA) allele was found in 36.79%. We identified two other variants of the UGT1A1 gene, depending on the number of TA repeats in the promoter: 5TA (0.61%) and 8TA (0.72%). The (TA)7/7 homozygous genotype was identified in 32.33% of all individuals, while the (TA)6/7 heterozygous genotype was the most prevalent (57.64%). The wild type (TA)6/6 was identified in 7.36% of the whole cohort. Because other polymorphisms have been associated with GS, the absence of the UGT1A1*28 allele does not rule out this condition. The results suggest that in the Romanian population there is a strong correlation between the UGT1A1*28 polymorphism and hyperbilirubinemia in patients with GS.

  16. Regulation of turkey myogenic satellite cell migration by MicroRNAs miR-128 and miR-24.

    Science.gov (United States)

    Velleman, S G; Harding, R L

    2017-06-01

    Myogenic satellite cells are an adult stem cell responsible for all post-hatch muscle growth in poultry. As a stem cell population, satellite cells are highly heterogeneous, but the origin of this heterogeneity remains unclear. Heterogeneity is, in part, regulated by gene expression. One method of endogenous gene regulation that may contribute to heterogeneity is microRNAs (miRNAs). Two miRNAs previously shown to regulate poultry myogenic satellite cell proliferation and differentiation, miR-128 and miR-24, were studied to determine if they also affected satellite cell migration. Satellite cell migration is an essential step for both proliferation and differentiation. During proliferation, satellite cells will migrate and align to form new myofibers or donate their nuclei to existing myofibers leading to muscle fiber hypertrophy or regeneration. Transient transfection of miRNA specific mimics to each miRNA reduced migration of satellite cells following a cell culture scratch at 72 h of proliferation when the cultures were 90 to 100% confluent. However, only the migration in cells transfected with miR-24 mimics at 24 and 30 h following the scratch was significantly reduced (P ≤ 0.05) to around 70% of the distance migrated by controls. Alternately, transfection with inhibitors specific to miR-128 or miR-24 significantly (P ≤ 0.05) increased migration between 147 and 252% compared to their controls between 24 and 48 h following the scratch. These data demonstrate that miR-128 and miR-24 play a role in myogenic satellite cell migration, which will impact muscle development and growth. © 2016 Poultry Science Association Inc.

  17. Offset correction system for 128-channel self-triggering readout chip with in-channel 5-bit energy measurement functionality

    Energy Technology Data Exchange (ETDEWEB)

    Otfinowski, P., E-mail: potfin@agh.edu.pl; Grybos, P.; Szczygiel, R.; Kasinski, K.

    2015-04-21

    We report on a novel, two-stage 8-bit trimming solution dedicated for multichannel systems with reduced trim DAC area occupancy. The presented design was used for comparator offset correction in a 128-channel particle tracking, self-triggering readout system and manufactured in 180 nm CMOS process. The 8-bit trim DAC has a range of ±165 mV, current consumption of 3.2 µA and occupies an area of 37 µm×17 µm in each channel, which corresponds to a 6-bit conventional current steering DAC with similar linearity.

  18. CIGB-128, as compassionate intracranial treatment in patients with non-operable or progressive high grade gliomas

    Directory of Open Access Journals (Sweden)

    Garcia-Vega Y

    2015-12-01

    Full Text Available Background: High grade glioma (HGG is the most aggressive and lethal primary brain tumor. The treatment of patients with HGG still remains palliative with improvement in the quality of life and encompasses surgery, radiotherapy, and chemotherapy. The use of interferons (IFNs in the treatment of HGG has been showed useful for these patients. Patients and methods: We report the use, outside of clinical trials, of recombinant IFNs-α and γ(CIGB-128 in 10 patients with glioma grade III-IV (1 anaplastic astrocytoma and 9 GBM. The aim of the study was to offer a treatment option to patients with malignant gliomas, primary (non-surgical or progressive (Karnofsky performance status (KPS >20, without other possible therapeutic options, and non-eligible for clinical trials. Patients received intralesional CIGB-128, 3 times per week, during one month, in doses from 3.5 MIU scalable up to 14.0 MIU. Safety was evaluated by the occurrence of adverse events. Others measurements were tumor responses measured by RECIST, KPS, muscular power (ASIA neurological assessment scale and overall survival. Depending of treatment tolerability, clinical improvement and medical criteria, patients were maintained under treatment for 3 more months. Results: 70% of treated patients had KS<50. Seven patients had objective response (3 CR, 4 PR, one lesion progressed and 2 were not evaluable. The treatment prolonged the survival of patients to a mean of 34±14 months since diagnosis. The quality of life improved as measured by the increase in the KPS (66% of patients scaled the category and improvement in muscular power in 50% of patients. CIGB-128 had an acceptable safety profile with fever as the most frequent adverse event, observed in 54.7%, followed by extrapyramidal symptoms and hypopotassemia in 14.2% of treated patients. All detected adverse events were reversible. There was no evidence of cumulative hematologic toxicity. Conclusions: CIGB-128 demonstrated signs of

  19. HTLV-I associated tropical spastic paraparesis: cerebral spinal fluid evolutive aspects in 128 cases Paraparesia espástica tropical associada ao HTLV-I: aspectos evolutivos do líquido cefalorraqueano em 128 casos

    Directory of Open Access Journals (Sweden)

    O.A. Moreno-Carvalho

    1995-09-01

    Full Text Available In order to evaluate if there is variation on the intensity of cerebral spinal fluid (CSF response during HTLV-I associated tropical spastic paraparesis (TSP evolution we retrospectively reviewed 128 cases.The results indicate that although CSF inflammatory alterations can persist over a 10-year period.they tend to become slight or even absent after the second year of TSP evolution.Com o objetivo de verificar se existe mudança na intensidade da resposta inflamatória do líquido cefalorraqueano (LCR no curso da paraparesia espástica tropical (PET associada ao HTLV-I foram estudados retrospectivamente os exames de LCR de 128 pacientes com PET. Os resultados indicam que embora as alterações inflamatórias possam persistir por período superior a 10 anos, existe tendência a diminuição de sua intensidade ou mesmo de normalização após o segundo ano de evolução da doença.

  20. A 128-channel 6 mW wireless neural recording IC with spike feature extraction and UWB transmitter.

    Science.gov (United States)

    Chae, Moo Sung; Yang, Zhi; Yuce, Mehmet R; Hoang, Linh; Liu, Wentai

    2009-08-01

    This paper reports a 128-channel neural recording integrated circuit (IC) with on-the-fly spike feature extraction and wireless telemetry. The chip consists of eight 16-channel front-end recording blocks, spike detection and feature extraction digital signal processor (DSP), ultra wideband (UWB) transmitter, and on-chip bias generators. Each recording channel has amplifiers with programmable gain and bandwidth to accommodate different types of biological signals. An analog-to-digital converter (ADC) shared by 16 amplifiers through time-multiplexing results in a balanced trade-off between the power consumption and chip area. A nonlinear energy operator (NEO) based spike detector is implemented for identifying spikes, which are further processed by a digital frequency-shaping filter. The computationally efficient spike detection and feature extraction algorithms attribute to an auspicious DSP implementation on-chip. UWB telemetry is designed to wirelessly transfer raw data from 128 recording channels at a data rate of 90 Mbit/s. The chip is realized in 0.35 mum complementary metal-oxide-semiconductor (CMOS) process with an area of 8.8 x 7.2 mm(2) and consumes 6 mW by employing a sequential turn-on architecture that selectively powers off idle analog circuit blocks. The chip has been tested for electrical specifications and verified in an ex vivo biological environment.

  1. Ca2+ Handling in Isolated Brain Mitochondria and Cultured Neurons Derived from the YAC128 Mouse Model of Huntington’s Disease

    Science.gov (United States)

    Pellman, Jessica J.; Hamilton, James; Brustovetsky, Tatiana; Brustovetsky, Nickolay

    2015-01-01

    We investigated Ca2+ handling in isolated brain synaptic and nonsynaptic mitochondria and in cultured striatal neurons from the YAC128 mouse model of Huntington’s disease (HD). Both synaptic and nonsynaptic mitochondria from 2- and 12-month-old YAC128 mice had larger Ca2+ uptake capacity than mitochondria from YAC18 and wild-type FVB/NJ mice. Synaptic mitochondria from 12-month-old YAC128 mice had further augmented Ca2+ capacity compared with mitochondria from 2-month-old YAC128 mice and age-matched YAC18 and FVB/NJ mice. This increase in Ca2+ uptake capacity correlated with an increase in the amount of mutant huntingtin protein (mHtt) associated with mitochondria from 12-month-old YAC128 mice. We speculate that this may happen due to mHtt-mediated sequestration of free fatty acids thereby increasing resistance of mitochondria to Ca2+-induced damage. In experiments with striatal neurons from YAC128 and FVB/NJ mice, brief exposure to 25 or 100μM glutamate produced transient elevations in cytosolic Ca2+ followed by recovery to near resting levels. Following recovery of cytosolic Ca2+, mitochondrial depolarization with FCCP produced comparable elevations in cytosolic Ca2+, suggesting similar Ca2+ release and, consequently, Ca2+ loads in neuronal mitochondria from YAC128 and FVB/NJ mice. Together, our data argue against a detrimental effect of mHtt on Ca2+ handling in brain mitochondria of YAC128 mice. PMID:25963273

  2. Chlorine stabilizer T-128 enhances efficacy of chlorine against cross-contamination by E. coli O157:H7 and Salmonella in fresh-cut lettuce processing.

    Science.gov (United States)

    Nou, Xiangwu; Luo, Yaguang; Hollar, LaVonda; Yang, Yang; Feng, Hao; Millner, Patricia; Shelton, Daniel

    2011-04-01

    During fresh-cut produce processing, organic materials released from cut tissues can rapidly react with free chlorine in the wash solution, leading to the potential survival of foodborne bacterial pathogens, and cross-contamination when the free chlorine is depleted. A reported chlorine stabilizer, T-128, has been developed to address this problem. In this study, we evaluated the ability of T-128 to stabilize free chlorine in wash solutions in the presence of high organic loads generated by the addition of lettuce extract or soil. Under conditions used in this study, T-128 significantly (Plettuce extract in wash solution. Application of T-128 significantly reduced the survival of bacterial pathogens in wash solutions with high organic loads and significantly reduced the potential of cross-contamination, when contaminated and uncontaminated produce were washed together. However, T-128 did not enhance the efficacy of chlorinated wash solutions for microbial reduction on contaminated iceberg lettuce. Evaluation of several produce quality parameters, including overall visual appearance, package headspace O2 and CO2 composition, and lettuce electrolyte leakage, during 15 d of storage indicated that iceberg lettuce quality and shelf life were not negatively impacted by washing fresh-cut lettuce in chlorine solutions containing 0.1% T-128.   Reported chlorine stabilizer is shown to enhance chlorine efficacy against potential bacterial cross-contamination in the presence of high organic loads without compromising product quality and shelf life.

  3. Purification, characterization, cDNA cloning, and expression of a xyloglucan endoglucanase from Geotrichum sp. M128.

    Science.gov (United States)

    Yaoi, Katsuro; Mitsuishi, Yasushi

    2004-02-27

    A novel xyloglucan-specific endo-beta-1,4-glucanase (XEG), xyloglucanase, with a molecular mass of 80 kDa and a pI of 4.8, was isolated from the fungus Geotrichum sp. M128. It was found to be an endoglucanase active toward xyloglucan and not active toward carboxymethylcellulose, Avicel, or barley 1,3-1,4-beta-glucan. Analysis of the precise substrate specificity using various xyloglucan oligosaccharide structures revealed that XEG has at least four subsites (-2 to +2) and specifically recognizes xylose branching at the +1 and +2 sites. The full-length cDNA encoding XEG was cloned and sequenced. It consists of a 2436-bp open reading frame encoding a 776-amino acid protein. From its deduced amino acid sequence, XEG can be classified as a family 74 glycosyl hydrolase. The cDNA encoding XEG was then expressed in Escherichia coli, and enzymatically active recombinant XEG was obtained.

  4. A 128-ch Δ-Σ ADC based mixed signal IC for full digital beamforming Wireless handheld Ultrasound imaging system.

    Science.gov (United States)

    Chirala, Mohan K; Phuong Huynh; Jaeyoung Ryu; Young-Hwan Kim

    2015-08-01

    This paper reports a massively integrated Δ-Σ ADC based mixed signal chipset for a handheld Wireless Ultrasound imaging system. The IC has been fabricated in a standard 0.13 μm 1.5V 7M2F CMOS process with 128 parallel channels containing Delta-Sigma (Δ-Σ) ADCs, Anti-aliasing filter, Decimation filters, Serializers and LVDS drivers. The entire chip is SPI controlled and allows group-level power control through an FPGA. The IC measures 15 × 15 mm and dissipates around ~ 4.6 W of power, with 12-bit resolution at 20 Msps sample rate. The chip was packaged in a thermally stable BGA package and demonstrated in a handheld ultrasound battery operated system with complete digital beamforming.

  5. Exéresis de las lesiones hiperplásicas de la cavidad bucal. Estudio retrospectivo de 128 casos

    OpenAIRE

    Tamarit Borràs, Meritxell; Delgado Molina, Esther; Berini Aytés, Leonardo; Gay Escoda, Cosme

    2005-01-01

    Objetivos: Este trabajo pretende, en base a nuestra experiencia, valorar y discutir las indicaciones, ventajas e inconvenientes de la exéresis de los épulis de la cavidad bucal con el láser de dióxido de carbono (CO2) respecto al láser de Erbio:YAG (Er:YAG), el láser de diodo y el bisturí frío. Material y método: Se ha realizado un estudio retrospectivo de un grupo de 120 pacientes en los que se extirparon 128 épulis con el láser de CO2, láser de Er:YAG, láser de diodo y bisturí frío. Se real...

  6. Simultaneous readout of 128 X-ray and gamma-ray transition-edge microcalorimeters using microwave SQUID multiplexing

    Science.gov (United States)

    Mates, J. A. B.; Becker, D. T.; Bennett, D. A.; Dober, B. J.; Gard, J. D.; Hays-Wehle, J. P.; Fowler, J. W.; Hilton, G. C.; Reintsema, C. D.; Schmidt, D. R.; Swetz, D. S.; Vale, L. R.; Ullom, J. N.

    2017-08-01

    The number of elements in most cryogenic sensor arrays is limited by the technology available to multiplex signals from the arrays into a smaller number of wires and readout amplifiers. The largest demonstrated arrays of transition-edge sensor (TES) microcalorimeters contain roughly 250 detectors and use time-division multiplexing with Superconducting Quantum Interference Devices (SQUIDs). The bandwidth limits of this technology constrain the number of sensors per amplifier chain, a quantity known as the multiplexing factor, to several 10s. With microwave SQUID multiplexing, we can expand the readout bandwidth and enable much larger multiplexing factors. While microwave SQUID multiplexing of TES microcalorimeters has been previously demonstrated with small numbers of detectors, we now present a fully scalable demonstration in which 128 TES detectors are read out on a single pair of coaxial cables.

  7. Brute-force mapmaking with compact interferometers: a MITEoR northern sky map from 128 to 175 MHz

    Science.gov (United States)

    Zheng, H.; Tegmark, M.; Dillon, J. S.; Liu, A.; Neben, A. R.; Tribiano, S. M.; Bradley, R. F.; Buza, V.; Ewall-Wice, A.; Gharibyan, H.; Hickish, J.; Kunz, E.; Losh, J.; Lutomirski, A.; Morgan, E.; Narayanan, S.; Perko, A.; Rosner, D.; Sanchez, N.; Schutz, K.; Valdez, M.; Villasenor, J.; Yang, H.; Zarb Adami, K.; Zelko, I.; Zheng, K.

    2017-03-01

    We present a new method for interferometric imaging that is ideal for the large fields of view and compact arrays common in 21 cm cosmology. We first demonstrate the method with the simulations for two very different low-frequency interferometers, the Murchison Widefield Array and the MIT Epoch of Reionization (MITEoR) experiment. We then apply the method to the MITEoR data set collected in 2013 July to obtain the first northern sky map from 128 to 175 MHz at ∼2° resolution and find an overall spectral index of -2.73 ± 0.11. The success of this imaging method bodes well for upcoming compact redundant low-frequency arrays such as Hydrogen Epoch of Reionization Array. Both the MITEoR interferometric data and the 150 MHz sky map are available at http://space.mit.edu/home/tegmark/omniscope.html.

  8. A 128-Channel FPGA-Based Real-Time Spike-Sorting Bidirectional Closed-Loop Neural Interface System.

    Science.gov (United States)

    Park, Jongkil; Kim, Gookhwa; Jung, Sang-Don

    2017-12-01

    A multichannel neural interface system is an important tool for various types of neuroscientific studies. For the electrical interface with a biological system, high-precision high-speed data recording and various types of stimulation capability are required. In addition, real-time signal processing is an important feature in the implementation of a real-time closed-loop system without unwanted substantial delay for feedback stimulation. Online spike sorting, the process of assigning neural spikes to an identified group of neurons or clusters, is a necessary step to make a closed-loop path in real time, but massive memory-space requirements commonly limit hardware implementations. Here, we present a 128-channel field-programmable gate array (FPGA)-based real-time closed-loop bidirectional neural interface system. The system supports 128 channels for simultaneous signal recording and eight selectable channels for stimulation. A modular 64-channel analog front-end (AFE) provides scalability and a parameterized specification of the AFE supports the recording of various electrophysiological signal types with 1.59 ± 0.76 root-mean-square noise. The stimulator supports both voltage-controlled and current-controlled arbitrarily shaped waveforms with the programmable amplitude and duration of pulse. An empirical algorithm for online real-time spike sorting is implemented in an FPGA. The spike-sorting is performed by template matching, and templates are created by an online real-time unsupervised learning process. A memory saving technique, called dynamic cache organizing, is proposed to reduce the memory requirement down to 6 kbit per channel and modular implementation improves the scalability for further extensions.

  9. The HCMV gH/gL/UL128-131 complex triggers the specific cellular activation required for efficient viral internalization into target monocytes.

    Directory of Open Access Journals (Sweden)

    Maciej T Nogalski

    Full Text Available We have established that HCMV acts as a specific ligand engaging and activating cellular integrins on monocytes. As a result, integrin signaling via Src activation leads to the functional activation of paxillin required for efficient viral entry and for the biological changes in monocytes needed for viral dissemination. These biological/molecular changes allow HCMV to use monocytes as "vehicles" for systemic spread and the establishment of lifelong persistence. However, it remains unresolved how HCMV specifically induces this observed monocyte activation. It was previously demonstrated that the HCMV gH/gL/UL128-131 glycoprotein complex facilitates viral entry into biologically relevant cell types. Nevertheless, the mechanism by which the gH/gL/UL128-131 complex promotes this process is unknown. We now show that only HCMV virions possessing the gH/gL/UL128-131 complex are capable of activating integrin/Src/paxillin-signaling in monocytes. In fibroblasts, this signaling is reversed, such that virus lacking the gH/gL/UL128-131 complex is the only virus able to induce the paxillin activation cascade. The presence of the gH/gL/UL128-131 complex also may have an inhibitory effect on integrin-mediated signaling pathway in fibroblasts. Furthermore, we demonstrate that the presence of the gH/gL/UL128-131 complex on the viral envelope, through its activation of the integrin/Src/paxillin pathway, is necessary for efficient HCMV internalization into monocytes and that appropriate actin and dynamin regulation is critical for this entry process. Importantly, productive infection in monocyte-derived macrophages was seen only in cells exposed to HCMV expressing the gH/gL/UL128-131 complex. From our data, the HCMV gH/gL/U128-131 complex emerges as the specific ligand driving the activation of the receptor-mediated signaling required for the regulation of the actin cytoskeleton and, consequently, for efficient and productive internalization of HCMV into monocytes

  10. Isomers in 128Pd and 126Pd: evidence for a robust shell closure at the neutron magic number 82 in exotic palladium isotopes.

    Science.gov (United States)

    Watanabe, H; Lorusso, G; Nishimura, S; Xu, Z Y; Sumikama, T; Söderström, P-A; Doornenbal, P; Browne, F; Gey, G; Jung, H S; Taprogge, J; Vajta, Zs; Wu, J; Yagi, A; Baba, H; Benzoni, G; Chae, K Y; Crespi, F C L; Fukuda, N; Gernhäuser, R; Inabe, N; Isobe, T; Jungclaus, A; Kameda, D; Kim, G D; Kim, Y K; Kojouharov, I; Kondev, F G; Kubo, T; Kurz, N; Kwon, Y K; Lane, G J; Li, Z; Moon, C-B; Montaner-Pizá, A; Moschner, K; Naqvi, F; Niikura, M; Nishibata, H; Nishimura, D; Odahara, A; Orlandi, R; Patel, Z; Podolyák, Zs; Sakurai, H; Schaffner, H; Simpson, G S; Steiger, K; Suzuki, H; Takeda, H; Wendt, A; Yoshinaga, K

    2013-10-11

    The level structures of the very neutron-rich nuclei 128Pd and 126Pd have been investigated for the first time. In the r-process waiting-point nucleus 128Pd, a new isomer with a half-life of 5.8(8) μs is proposed to have a spin and parity of 8(+) and is associated with a maximally aligned configuration arising from the g(9/2) proton subshell with seniority υ=2. For 126Pd, two new isomers have been identified with half-lives of 0.33(4) and 0.44(3) μs. The yrast 2(+) energy is much higher in 128Pd than in 126Pd, while the level sequence below the 8(+) isomer in 128Pd is similar to that in the N=82 isotone 130Cd. The electric quadrupole transition that depopulates the 8(+) isomer in 128Pd is more hindered than the corresponding transition in 130Cd, as expected in the seniority scheme for a semimagic, spherical nucleus. These experimental findings indicate that the shell closure at the neutron number N=82 is fairly robust in the neutron-rich Pd isotopes.

  11. MicroRNA 128a Increases Intracellular ROS Level by Targeting Bmi-1 and Inhibits Medulloblastoma Cancer Cell Growth by Promoting Senescence

    Science.gov (United States)

    Venkataraman, Sujatha; Alimova, Irina; Fan, Rong; Harris, Peter; Foreman, Nicholas; Vibhakar, Rajeev

    2010-01-01

    Background MicroRNAs (miRNAs) are a class of short non-coding RNAs that regulate cell homeostasis by inhibiting translation or degrading mRNA of target genes, and thereby can act as tumor suppressor genes or oncogenes. The role of microRNAs in medulloblastoma has only recently been addressed. We hypothesized that microRNAs differentially expressed during normal CNS development might be abnormally regulated in medulloblastoma and are functionally important for medulloblastoma cell growth. Methodology and Principal Findings We examined the expression of microRNAs in medulloblastoma and then investigated the functional role of one specific one, miR-128a, in regulating medulloblastoma cell growth. We found that many microRNAs associated with normal neuronal differentiation are significantly down regulated in medulloblastoma. One of these, miR-128a, inhibits growth of medulloblastoma cells by targeting the Bmi-1 oncogene. In addition, miR-128a alters the intracellular redox state of the tumor cells and promotes cellular senescence. Conclusions and Significance Here we report the novel regulation of reactive oxygen species (ROS) by microRNA 128a via the specific inhibition of the Bmi-1 oncogene. We demonstrate that miR-128a has growth suppressive activity in medulloblastoma and that this activity is partially mediated by targeting Bmi-1. This data has implications for the modulation of redox states in cancer stem cells, which are thought to be resistant to therapy due to their low ROS states. PMID:20574517

  12. Hérnias intra-raquidianas dos discos intervertebrais lombares: resultados da excisão em 128 casos

    Directory of Open Access Journals (Sweden)

    Rolando A. Tenuto

    1959-03-01

    ção discai estiver situada no buraco de conjugação, deve ser feita a facetectomia, sendo a intervenção completada com artródese para imobilização. Para a exposição de hérnia discai, a bainha durai da raiz raquidiana deve sempre ser deslocada para a linha mediana, qualquer que seja a situação do prolapso, pois, dêsse modo, são diminuídas as possibilidades de lesões traumáticas da raiz que está sendo manipulada. Fragmentos livres de disco intervertebral no espaço epidural devem ser extirpados; o cirurgião deve ter presente a possibilidade da existência de tais fragmentos em níveis situados imediatamente acima ou abaixo do disco herniado. A rizotomia posterior deve ser praticada quando existir fibrose intensa da bainha durai de raízes raquidianas e, eventualmente, quando a excisão da hérnia discai não fôr julgada satisfatória; a rizotomia posterior deve ser feita, também, tôdas as vêzes em que a reparação de uma lesão acidental da bainha de uma raiz raquidiana não tenha sido satisfatória. A electrocoagulação do ligamento longitudinal posterior, visando à destruição da maior parte do nervo sinuvertebral de Luschka, deve complementar a operação para diminuir a persistência ou a incidência de lombalgias. A hemostasia deve ser perfeita para diminuir a formação de tecido cicatricial, causa de sintomatologia dolorosa no pós-operatório. Com êsse mesmo intuito deve ser interposta lâmina de esponja de gelatina isolando a bainha durai da raiz raquidiana das formações circunvizinhas. Neste trabalho são apresentados os resultados obtidos em 128 casos, escolhidos entre 571 pacientes operados de hérnias intra-raquidianas de discos intervertebrals lombares; êstes 128 casos foram selecionados por terem seguimento de um ano, no mínimo, para permitir boa avaliação dos resultados. Foram considerados como bons tão sòmente os resultados obtidos nos pacientes que, um ano após a intervenção cirúrgica, não apresentavam qualquer sintoma

  13. Performance of a 128 channel analogue front-end chip for read-out of Si strip detector modules for LHC experiments

    CERN Document Server

    Chesi, Enrico Guido; Cindro, V; Dabrowski, W; Ferrère, D; Kramberger, G; Kaplon, J; Lacasta, C; Lozano-Bahilo, J; Mikuz, M; Morone, C; Roe, S; Szczygiel, R; Tadel, M; Weilhammer, Peter; Zsenei, A

    2000-01-01

    We present a 128-channel analogue front-end chip, SCT128A-HC, for readout of silicon strip detectors employed in the inner tracking detectors of the LHC experiment. The chip is produced in the radiation hard DMILL technology. The architecture of the chip and critical design issues are discussed. The performance of the chip has been evaluated in details in the test bench and is presented in the paper. The chip is used to read out prototype analogue modules compatible in size, functionality and performance with the ATLAS SCT base line modules. Several full size detector modules equipped with SCT128A-HC chips has been built and tested successfully in the lab with beta particles as well as in the test beam. The results concerning the signal-to-noise ratio, noise occupancy, efficiency and spatial resolution are presented. The radiation hardness issues are discussed. (5 refs).

  14. miR-128b is a potent glucocorticoid sensitizer in MLL-AF4 acute lymphocytic leukemia cells and exerts cooperative effects with miR-221.

    Science.gov (United States)

    Kotani, Ai; Ha, Daon; Hsieh, James; Rao, Prakash K; Schotte, Diana; den Boer, Monique L; Armstrong, Scott A; Lodish, Harvey F

    2009-11-05

    MLL-AF4 acute lymphocytic leukemia (ALL) has a poor prognosis. MicroRNAs (miRNA) are small noncoding RNAs that posttranscriptionally regulate expression of target mRNAs. Our analysis of previously published data showed that expression of miR-128b and miR-221 is down-regulated in MLL-rearranged ALL relative to other types of ALL. Reexpression of these miRNAs cooperatively sensitizes 2 cultured lines of MLL-AF4 ALL cells to glucocorticoids. Target genes down-regulated by miR-128b include MLL, AF4, and both MLL-AF4 and AF4-MLL fusion genes; miR-221 down-regulates CDKN1B. These results demonstrate that down-regulation of miR-128b and miR-221 is implicated in glucocorticoid resistance and that restoration of their levels is a potentially promising therapeutic in MLL-AF4 ALL.

  15. 128 - 131 Abdu Anticholinester

    African Journals Online (AJOL)

    DR. AMIN

    subjected to anticholinesterase enzyme assay and were found to arrest the function of acetyl cholinesterase .... homogenate (w/v) of the sheep liver was prepared in distilled water ... 1 and Table 1) which obeys Beer lamberts law. From Table 1 ...

  16. 128 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    urine (1). Urinary tract infection caused by bacterial isolates is of global concern and the major setback in its treatment using antibiotic is the emergent of highly resistant bacterial strains (2, 3). Common bacterial isolates usually involved in UTI, either uncomplicated or complicated, are Escherichia coli, which is the most.

  17. 128 - 131 Abdu Anticholinester

    African Journals Online (AJOL)

    DR. AMIN

    All the crude extract fractions were subjected to anticholinesterase enzyme assay and were found to arrest the function of acetyl cholinesterase enzyme even at low concentration of 5 g/cm3. The efficacies of these crude extract were comparable to that of Huperzine A as a reference standard for cholinesterase inhibition. The.

  18. 128 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Urinary tract infection (UTI) is a common disease and sometimes life threatening if not properly treated. In Nigeria, aside ... Antibiotic susceptibility test using standard antibiotic discs showed that all (100%) the bacterial isolates were multidrug resistant ... treatment of UTI due to high level of resistance (7, 8), three major ...

  19. 125 -128 _Mairiga

    African Journals Online (AJOL)

    User

    College of Agriculture & Animal Science, Division of Agricultural Colleges,. Ahmadu Bello ... The study was conducted to ascertain the perspective of extension in livestock production in. Makarfi, Ikara and Kudan ... extension services in livestock production were insufficient fund, ineffective research extension linkage, poor ...

  20. Estimation of radiation exposure of retrospective gated and prospective triggered 128-slice triple-rule-out CT angiography

    Energy Technology Data Exchange (ETDEWEB)

    Ketelsen, Dominik; Fenchel, Michael; Thomas, Christoph; Boehringer, Nadine; Tsiflikas, Ilias; Kaempf, Michael; Claussen, Claus D; Heuschmid, Martin (Dept. of Diagnostic and Interventional Radiology, Univ. Hospital Tuebingen, Tuebingen (Germany)), email: dominik.ketelsen@med.uni-tuebingen.de; Buchgeister, Markus (Depts. of Radiotherapy and Radiooncology, Univ. Hospital Tuebingen, Tuebingen (Germany))

    2011-09-15

    Background: CT has become an important role in the differential diagnosis of acute chest pain to exclude an aortic dissection, pulmonary embolism and acute coronary artery syndrome. However, the additional radiation exposure is a cause of concern and dose saving strategies should be applied, if possible. Purpose: To estimate effective dose of retrospective gated and prospective ECG-triggered triple-rule-out computed tomography angiography (TRO-CTA). Material and Methods: An Alderson-Rando-phantom equipped with thermoluminescent dosimeters was used for dose measurements. Exposure was performed on a 128-slice single source scanner. The following scan parameters were used (retrospective ECG-gated): 120 kV, 190 mAs/rot., collimation 128x0.6 mm, rotation time 0.3 s. Protocols with a simulated heart rate (HR) of 60 and 100 bpm were performed using the standard ECG-pulsing as well as MinDose. Additionally, a prospective triggered TRO-CTA was acquired (HR 60 bpm). Results: The estimated effective dose of retrospective ECG-gated TRO-CTA ranged from 7.4-13.4 mSv and from 10.1-17.5 mSv for men and women, respectively. Due to radiosensitive breast tissue, women received a significant increased effective dose of up to 64.7% +- 0.03% (p = 0.028) compared to men. MinDose reduces radiation exposure of up to 33.0% +- 6.5% in comparison to standard ECG-pulsing (p < 0.001). The effective dose increased significantly with lower heart rates (p < 0.001). Prospective ECG-triggered TRO-CTA showed an effective dose of 5.9 mSv and 8.2 mSv for men and women, respectively. Compared to retrospective ECG-gated TRO-CTA a significant dose reduction was observed (p < 0.001). Conclusion: Due to the significant different dose exposure, scan protocols should be specifically adapted in a patient- and problem-oriented manner

  1. An evaluation of the feasibility of assessment of volume perfusion for the whole lung by 128-slice spiral CT

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Haitao [Imaging Center of Taian Central Hospital, Taian, Shandong (China); Gao, Fei; Li, Ning; Liu, Cheng [Shandong Univ., Shandong Medical Imaging Research Inst., CT Room, Shandong (China)], e-mail: liucheng491025@sina.com

    2013-10-15

    Background: Lung perfusion based on dynamic scanning cannot provide a quantitative assessment of the whole lung because of the limited coverage of the current computed tomography (CT) detector designs. Purpose: To evaluate the feasibility of dynamic volume perfusion CT (VPCT) of the whole lung using a 128-slice CT for the quantitative assessment and visualization of pulmonary perfusion. Material and Methods: Imaging was performed in a control group of 17 subjects who had no signs of disturbance of pulmonary function or diffuse lung disease, and 15 patients (five patients with acute pulmonary embolism and 10 with emphysema) who constituted the abnormal lung group. Dynamic VPCT was performed in all subjects, and pulmonary blood flow (PBF), pulmonary blood volume (PBV), and mean transit time (MTT) were calculated from dynamic contrast images with a coverage of 20.7 cm. Regional and volumetric PBF, PBV, and MTT were statistically evaluated and comparisons were made between the normal and abnormal lung groups. Results: Regional PBF (94.2{+-}36.5, 161.8 {+-}29.6, 185.7 {+-}38.1 and 125.5 {+-}46.1, 161.9 {+-}31.4, 169.3 {+-}51.7), PBV (6.7 {+-}2.8, 10.9 {+-}3.0, 12.9 {+-}4.5 and 9.9 {+-}4.6, 10.3 {+-}2.9, 11.9 {+-}4.5), and MTT (5.8 {+-}2.4, 4.5 {+-}1.3, 4.7 {+-}2.1 and 5.6 {+-}2.3, 4.3 {+-}1.5, 4.9 {+-}1.5) demonstrated significant differences in the gravitational and isogravitational directions in the normal lung group (P < 0.05). The PBF (154.2 {+-}30.6 vs. 94.9 {+-}15.9) and PBV (11.1 {+-}4.0 vs. 6.6 {+-}1.7) by dynamic VPCT showed significant differences between normal and abnormal lungs (P < 0.05), notwithstanding the four large lungs that had coverage > 20.7 cm. Conclusion: Dynamic VPCT of the whole lung is feasible for the quantitative assessment of pulmonary perfusion by 128-slice CT, and may in future permit the evaluation of both morphological and functional features of the whole lung in a single examination.

  2. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    INTRODUCTION. Fluorescent materials, particularly blue fluorescent materials have gained strong interest because ... emitting complexes in different technical applications, such as emitting materials for organic light emitting ..... properties of three novel two-dimensional lanthanide coordination polymers with mixed aromatic ...

  3. Pyroelectric Ferroelectric and Resistivity Studies on Samarium ...

    African Journals Online (AJOL)

    Barium Strontium Sodium Niobate (Ba1-xSrx)2NaNb5O15 (BSNN) belongs to tungsten bronze ferroelectric morphotrophic phase boundary (MPB) system at x = 0.6, having large spontaneous polarisation, pyroelectric coefficient and low dielectic constant and is expected to be applicable for piezoceramic filter and ...

  4. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    emitting complexes in different technical applications, such as emitting materials for organic light emitting diodes, sensitizers in solar energy conversion, chemical sensors and so forth [6-9]. The ability of bipy to act as a rigid ..... properties of three-dimensional organic-inorganic hybrids based on α-metatungstate. Inorg. Chim.

  5. 1.28 Tbit/s/channel single-polarization DQPSK transmission over 525 km using ultrafast time-domain optical Fourier transformation

    DEFF Research Database (Denmark)

    Guan, P.; Mulvad, Hans Christian Hansen; Tomiyama, Y.

    2010-01-01

    A single-channel 1.28 Tbit/s transmission over 525 km is demonstrated for the first time with a single-polarization DQPSK signal. Ultrafast time-domain optical Fourier transformation is successfully applied to DQPSK signals and results in improved performance and increased system margin.......A single-channel 1.28 Tbit/s transmission over 525 km is demonstrated for the first time with a single-polarization DQPSK signal. Ultrafast time-domain optical Fourier transformation is successfully applied to DQPSK signals and results in improved performance and increased system margin....

  6. Black carbon record of the wildfire history of western Sichuan Province in China over the last 12.8 ka

    Science.gov (United States)

    Sun, Weiwei; Zhang, Enlou; Shen, Ji; Chen, Rong; Liu, Enfeng

    2016-12-01

    Wildfire is recognized as a critical Earth system process which affects the global carbon cycle, atmospheric chemistry, and ecosystem dynamics. Estimating the potential impact of future climate change on the incidence of fire requires an understanding of the long-term interactions of fire, climate, vegetation, and human activity. Accordingly, we analyzed the black carbon content and the pollen stratigraphy of sediments spanning the past 12.8 ka from Lake Muge Co, an alpine lake in western Sichuan Province, in order to determine the main factors influencing regional fire regimes. The results demonstrate that wildfires occurred frequently and intensively during the late deglaciation and the early Holocene when the regional vegetation was dominated by deciduous forests. Wildfire occurrence decreased significantly during the Holocene climatic optimum between 9.2 and 5.6 cal ka BP. Overall, the wildfire history of western Sichuan Province is similar to that of the Chinese Loess Plateau and of East Asia as a whole, suggesting that regional-scale fires depended mainly on changes in the intensity of the Asian summer monsoon. In addition, the fire regime of western Sichuan Province may have been influenced by the establishment of human settlement and agriculture in western Sichuan Province and the southeastern Tibetan Plateau after about 5.5 cal ka BP, and by an intensification of cereal cultivation coupled with population expansion in southwestern China during the last two millennia.

  7. On-field measurement trial of 4×128 Gbps PDM-QPSK signals by linear optical sampling

    Science.gov (United States)

    Bin Liu; Wu, Zhichao; Fu, Songnian; Feng, Yonghua; Liu, Deming

    2017-02-01

    Linear optical sampling is a promising characterization technique for advanced modulation formats, together with digital signal processing (DSP) and software-synchronized algorithm. We theoretically investigate the acquisition of optical sampling, when the high-speed signal under test is either periodic or random. Especially, when the profile of optical sampling pulse is asymmetrical, the repetition frequency of sampling pulse needs careful adjustment in order to obtain correct waveform. Then, we demonstrate on-field measurement trial of commercial four-channel 128 Gbps polarization division multiplexing quadrature phase shift keying (PDM-QPSK) signals with truly random characteristics by self-developed equipment. A passively mode-locked fiber laser (PMFL) with a repetition frequency of 95.984 MHz is used as optical sampling source, meanwhile four balanced photo detectors (BPDs) with 400 MHz bandwidth and four-channel analog-to-digital convertor (ADC) with 1.25 GS/s sampling rate are used for data acquisition. The performance comparison with conventional optical modulation analyzer (OMA) verifies that the self-developed equipment has the advantages of low cost, easy implementation, and fast response.

  8. Development of an implantable wireless ECoG 128ch recording device for clinical brain machine interface.

    Science.gov (United States)

    Matsushita, Kojiro; Hirata, Masayuki; Suzuki, Takafumi; Ando, Hiroshi; Ota, Yuki; Sato, Fumihiro; Morris, Shyne; Yoshida, Takeshi; Matsuki, Hidetoshi; Yoshimine, Toshiki

    2013-01-01

    Brain Machine Interface (BMI) is a system that assumes user's intention by analyzing user's brain activities and control devices with the assumed intention. It is considered as one of prospective tools to enhance paralyzed patients' quality of life. In our group, we especially focus on ECoG (electro-corti-gram)-BMI, which requires surgery to place electrodes on the cortex. We try to implant all the devices within the patient's head and abdomen and to transmit the data and power wirelessly. Our device consists of 5 parts: (1) High-density multi-electrodes with a 3D shaped sheet fitting to the individual brain surface to effectively record the ECoG signals; (2) A small circuit board with two integrated circuit chips functioning 128 [ch] analogue amplifiers and A/D converters for ECoG signals; (3) A Wifi data communication & control circuit with the target PC; (4) A non-contact power supply transmitting electrical power minimum 400[mW] to the device 20[mm] away. We developed those devices, integrated them, and, investigated the performance.

  9. A Re-configurable On-line Learning Spiking Neuromorphic Processor comprising 256 neurons and 128K synapses

    Directory of Open Access Journals (Sweden)

    Ning eQiao

    2015-04-01

    Full Text Available Implementing compact, low-power artificial neural processing systems with real-time on-line learning abilities is still an open challenge. In this paper we present a full-custom mixed-signal VLSI device with neuromorphic learning circuits that emulate the biophysics of real spiking neurons and dynamic synapses for exploring the properties of computational neuroscience models and for building brain-inspired computing systems. The proposed architecture allows the on-chip configuration of a wide range of network connectivities, including recurrent and deep networks with short-term and long-term plasticity. The device comprises 128 K analog synapse and 256 neuron circuits with biologically plausible dynamics and bi-stable spike-based plasticity mechanisms that endow it with on-line learning abilities. In addition to the analog circuits, the device comprises also asynchronous digital logic circuits for setting different synapse and neuron properties as well as different network configurations. This prototype device, fabricated using a 180 nm 1P6M CMOS process, occupies an area of 51.4 mm 2 , and consumes approximately 4 mW for typical experiments, for example involving attractor networks. Here we describe the details of the overall architecture and of the individual circuits and present experimental results that showcase its potential. By supporting a wide range of cortical-like computational modules comprising plasticity mechanisms, this device will enable the realization of intelligent autonomous systems with on-line learning capabilities.

  10. Single-channel 1.28 Tbit/s-525 km DQPSK transmission using ultrafast time-domain optical Fourier transformation and nonlinear optical loop mirror

    DEFF Research Database (Denmark)

    Guan, Pengyu; Mulvad, Hans Christian Hansen; Tomiyama, Yutaro

    2011-01-01

    We demonstrate a single-channel 1.28 Tbit/s-525 km transmission using OTDM of subpicosecond DQPSK signals. In order to cope with transmission impairments due to time-varying higherorder PMD, which is one of the major limiting factors in such a longhaul ultrahigh-speed transmission, we newly devel...

  11. 10 CFR 72.128 - Criteria for spent fuel, high-level radioactive waste, reactor-related greater than Class C waste...

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Criteria for spent fuel, high-level radioactive waste, reactor-related greater than Class C waste, and other radioactive waste storage and handling. 72.128... STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C...

  12. 12 CFR 220.128 - Treatment of simultaneous long and short positions in the same margin account when put or call...

    Science.gov (United States)

    2010-01-01

    ... positions in the same margin account when put or call options or combinations thereof on such stock are also...) Interpretations § 220.128 Treatment of simultaneous long and short positions in the same margin account when put...), if there are simultaneous long and short positions in the same security in the same margin account...

  13. Alterations in STriatal-Enriched protein tyrosine Phosphatase expression, activation, and downstream signaling in early and late stages of the YAC128 Huntington's disease mouse model.

    Science.gov (United States)

    Gladding, Clare M; Fan, Jing; Zhang, Lily Y J; Wang, Liang; Xu, Jian; Li, Edward H Y; Lombroso, Paul J; Raymond, Lynn A

    2014-07-01

    Striatal neurodegeneration and synaptic dysfunction in Huntington's disease are mediated by the mutant huntingtin (mHtt) protein. MHtt disrupts calcium homeostasis and facilitates excitotoxicity, in part by altering NMDA receptor (NMDAR) trafficking and function. Pre-symptomatic (excitotoxin-sensitive) transgenic mice expressing full-length human mHtt with 128 polyglutamine repeats (YAC128 Huntington's disease mice) show increased calpain activity and extrasynaptic NMDAR (Ex-NMDAR) localization and signaling. Furthermore, Ex-NMDAR stimulation facilitates excitotoxicity in wild-type cortical neurons via calpain-mediated cleavage of STriatal-Enriched protein tyrosine Phosphatase 61 (STEP61). The cleavage product, STEP33, cannot dephosphorylate p38 mitogen-activated protein kinase (MAPK), thereby augmenting apoptotic signaling. Here, we show elevated extrasynaptic calpain-mediated cleavage of STEP61 and p38 phosphorylation, as well as STEP61 inactivation and reduced extracellular signal-regulated protein kinase 1/2 phosphorylation (ERK1/2) in the striatum of 6-week-old, excitotoxin-sensitive YAC128 mice. Calpain inhibition reduced basal and NMDA-induced STEP61 cleavage. However, basal p38 phosphorylation was normalized by a peptide disrupting NMDAR-post-synaptic density protein-95 (PSD-95) binding but not by calpain inhibition. In 1-year-old excitotoxin-resistant YAC128 mice, STEP33 levels were not elevated, but STEP61 inactivation and p38 and ERK 1/2 phosphorylation levels were increased. These results show that in YAC128 striatal tissue, enhanced NMDAR-PSD-95 interactions contributes to elevated p38 signaling in early, excitotoxin-sensitive stages, and suggest that STEP61 inactivation enhances MAPK signaling at late, excitotoxin-resistant stages. The YAC128 Huntington's disease mouse model shows early, enhanced susceptibility to NMDA receptor-mediated striatal apoptosis, progressing to late-stage excitotoxicity resistance. This study shows that elevated NMDA

  14. Chimeric PD-1:28 Receptor Upgrades Low-Avidity T cells and Restores Effector Function of Tumor-Infiltrating Lymphocytes for Adoptive Cell Therapy.

    Science.gov (United States)

    Schlenker, Ramona; Olguín-Contreras, Luis Felipe; Leisegang, Matthias; Schnappinger, Julia; Disovic, Anja; Rühland, Svenja; Nelson, Peter J; Leonhardt, Heinrich; Harz, Hartmann; Wilde, Susanne; Schendel, Dolores J; Uckert, Wolfgang; Willimsky, Gerald; Noessner, Elfriede

    2017-07-01

    Inherent intermediate- to low-affinity T-cell receptors (TCR) that develop during the natural course of immune responses may not allow sufficient activation for tumor elimination, making the majority of T cells suboptimal for adoptive T-cell therapy (ATT). TCR affinity enhancement has been implemented to provide stronger T-cell activity but carries the risk of creating undesired cross-reactivity leading to potential serious adverse effects in clinical application. We demonstrate here that engineering of low-avidity T cells recognizing a naturally processed and presented tumor-associated antigen with a chimeric PD-1:28 receptor increases effector function to levels seen with high-avidity T cells of identical specificity. Upgrading the function of low-avidity T cells without changing the TCR affinity will allow a large arsenal of low-avidity T cells previously thought to be therapeutically inefficient to be considered for ATT. PD-1:28 engineering reinstated Th1 function in tumor-infiltrating lymphocytes that had been functionally disabled in the human renal cell carcinoma environment without unleashing undesired Th2 cytokines or IL10. Involved mechanisms may be correlated to restoration of ERK and AKT signaling pathways. In mouse tumor models of ATT, PD-1:28 engineering enabled low-avidity T cells to proliferate stronger and prevented PD-L1 upregulation and Th2 polarization in the tumor milieu. Engineered T cells combined with checkpoint blockade secreted significantly more IFNγ compared with T cells without PD-1:28, suggesting a beneficial combination with checkpoint blockade therapy or other therapeutic strategies. Altogether, the supportive effects of PD-1:28 engineering on T-cell function make it an attractive tool for ATT. Cancer Res; 77(13); 3577-90. ©2017 AACR. ©2017 American Association for Cancer Research.

  15. Enhanced inactivation of Salmonella and Pseudomonas biofilms on stainless steel by use of T-128, a fresh-produce washing aid, in chlorinated wash solutions.

    Science.gov (United States)

    Shen, Cangliang; Luo, Yaguang; Nou, Xiangwu; Bauchan, Gary; Zhou, Bin; Wang, Qin; Millner, Patricia

    2012-10-01

    The effect of the washing aid T-128 (generally recognized as safe [GRAS] formulation, composed mainly of phosphoric acid and propylene glycol) on inactivation of Salmonella and Pseudomonas populations in biofilms on stainless steel was evaluated under conditions of increasing organic matter loads in chlorinated wash solutions dominated by hypochlorous acid. Biofilms were formed statically on stainless steel coupons suspended in 2% lettuce extract after inoculation with Salmonella enterica serovar Thompson or Newport or with Pseudomonas fluorescens. Coupons with biofilms were washed in chlorine solutions (0, 0.5, 1, 2, 5, 10, or 20 mg/liter at pH 6.5, 5.0 and 2.9), with or without T-128, and with increasing loads of organic matter (0, 0.25, 0.5, 0.75, or 1.0% lettuce extract). Cell populations on coupons were dispersed using intermittent, pulsed ultrasonication and vortexing and enumerated by colony counts on XLT-4 or Pseudomonas agars. Cell responses to fluorescent viability staining of biofilm treatment washing solutions were examined using confocal laser scanning microscopy. Results showed that 0.1% T-128 (without chlorine) reduced P. fluorescens biofilm populations by 2.5 log(10) units but did not reduce Salmonella populations. For both Salmonella and Pseudomonas, the sanitizing effect of free chlorine (1.0 to 5.0 mg/liter) was enhanced (P biofilms compared to treatments without T-128. Image analysis of surfaces stained with SYTO and propidium iodide corroborate the cultural assay results showing that T-128 can aid in reducing pathogen viability in biofilms and thus can aid in sanitizing stainless steel contact surfaces during processing of fresh-cut produce.

  16. Genome-Wide Association Analyses in 128,266 Individuals Identifies New Morningness and Sleep Duration Loci.

    Science.gov (United States)

    Jones, Samuel E; Tyrrell, Jessica; Wood, Andrew R; Beaumont, Robin N; Ruth, Katherine S; Tuke, Marcus A; Yaghootkar, Hanieh; Hu, Youna; Teder-Laving, Maris; Hayward, Caroline; Roenneberg, Till; Wilson, James F; Del Greco, Fabiola; Hicks, Andrew A; Shin, Chol; Yun, Chang-Ho; Lee, Seung Ku; Metspalu, Andres; Byrne, Enda M; Gehrman, Philip R; Tiemeier, Henning; Allebrandt, Karla V; Freathy, Rachel M; Murray, Anna; Hinds, David A; Frayling, Timothy M; Weedon, Michael N

    2016-08-01

    Disrupted circadian rhythms and reduced sleep duration are associated with several human diseases, particularly obesity and type 2 diabetes, but until recently, little was known about the genetic factors influencing these heritable traits. We performed genome-wide association studies of self-reported chronotype (morning/evening person) and self-reported sleep duration in 128,266 white British individuals from the UK Biobank study. Sixteen variants were associated with chronotype (P23andMe participants; thirteen of the chronotype signals remained associated at P23andMe study. We also replicated 9 additional variants identified when the 23andMe study was used as a discovery GWAS of chronotype (all P<0.05 and meta-analysis P<5x10-8). For sleep duration, we replicated one known signal in PAX8 (2.6 minutes per allele, 95% CI [1.9, 3.2], P = 5.7x10-16) and identified and replicated two novel associations at VRK2 (2.0 minutes per allele, 95% CI [1.3, 2.7], P = 1.2x10-9; and 1.6 minutes per allele, 95% CI [1.1, 2.2], P = 7.6x10-9). Although we found genetic correlation between chronotype and BMI (rG = 0.056, P = 0.05); undersleeping and BMI (rG = 0.147, P = 1x10-5) and oversleeping and BMI (rG = 0.097, P = 0.04), Mendelian Randomisation analyses, with limited power, provided no consistent evidence of causal associations between BMI or type 2 diabetes and chronotype or sleep duration. Our study brings the total number of loci associated with chronotype to 22 and with sleep duration to three, and provides new insights into the biology of sleep and circadian rhythms in humans.

  17. Initial experience with prospectively triggered, sequential CT coronary angiography on a 128-slice scanner; Erste Erfahrungen mit der sequenziellen, prospektiv getriggerten CT-Koronarangiografie an einem 128-Schicht-Computertomografen

    Energy Technology Data Exchange (ETDEWEB)

    Anders, K.; Baum, U.; Kuefner, M.A.; Kuettner, A.; Uder, M. [Universitaetsklinikum Erlangen (Germany). Radiologisches Inst.; Gauss, S.; Achenbach, S.; Daniel, W.G.; Ropers, D. [Universitaetsklinikum Erlangen (Germany). Medizinische Klinik 2

    2009-04-15

    Purpose: Spiral CT angiography (CTA) of the coronaries using low-pitch scanning and ECG-gated image reconstruction is a robust method for detecting or excluding relevant coronary plaque. However, the resulting dose exposure is considerable. The aim of the present study was to evaluate image quality and artifacts as well as to record dose values for sequential coronary CTA using a 128-slice scanner with a temporal resolution of 150 ms. Materials und Methods: 20 patients with a regular heart rate and without contraindications for oral/I.V. beta blockers, who were referred for CTA of the coronaries for exclusion or detection of relevant plaques, were examined by sequential CTA with the following parameters: 120 kV, 200 ref mAs, collimation 2 x 64 x 0.6, table feed of 34.5 mm at a detector width of 38.4 mm. A total acquisition time of 380 ms per table position allowed for mild shifting of the reconstruction window within the cardiac cycle of {+-} 5 %. 50 ml of contrast agent were injected at 5 ml/s followed by a 50 ml split bolus (20 % contrast). The individual start delay was determined by a test bolus scan (10 ml contrast + 50 ml saline flush at 5 ml/s). The image quality for each segment, coronary artery, and patient was determined on a 4-point scale. Dose values were estimated based on the individual dose length product as provided by the scanner's patient protocol. Artifacts were evaluated to determine the cause (calcium vs. motion). Results: All patients received beta blocker pretreatment. The mean heart rate was 62 {+-} 5 beats/min. 5 % (13/286) of all segments in 5/20 patients were rated as non-diagnostic. The mean dose length product was 213 mGy x cm, and the mean effective dose was 3.6 mSv. Calcifications were the major cause of non-diagnostic images. However breathing or other motion artifacts occurred as well. (orig.)

  18. Genome-Wide Association Analyses in 128,266 Individuals Identifies New Morningness and Sleep Duration Loci.

    Directory of Open Access Journals (Sweden)

    Samuel E Jones

    2016-08-01

    Full Text Available Disrupted circadian rhythms and reduced sleep duration are associated with several human diseases, particularly obesity and type 2 diabetes, but until recently, little was known about the genetic factors influencing these heritable traits. We performed genome-wide association studies of self-reported chronotype (morning/evening person and self-reported sleep duration in 128,266 white British individuals from the UK Biobank study. Sixteen variants were associated with chronotype (P<5x10-8, including variants near the known circadian rhythm genes RGS16 (1.21 odds of morningness, 95% CI [1.15, 1.27], P = 3x10-12 and PER2 (1.09 odds of morningness, 95% CI [1.06, 1.12], P = 4x10-10. The PER2 signal has previously been associated with iris function. We sought replication using self-reported data from 89,283 23andMe participants; thirteen of the chronotype signals remained associated at P<5x10-8 on meta-analysis and eleven of these reached P<0.05 in the same direction in the 23andMe study. We also replicated 9 additional variants identified when the 23andMe study was used as a discovery GWAS of chronotype (all P<0.05 and meta-analysis P<5x10-8. For sleep duration, we replicated one known signal in PAX8 (2.6 minutes per allele, 95% CI [1.9, 3.2], P = 5.7x10-16 and identified and replicated two novel associations at VRK2 (2.0 minutes per allele, 95% CI [1.3, 2.7], P = 1.2x10-9; and 1.6 minutes per allele, 95% CI [1.1, 2.2], P = 7.6x10-9. Although we found genetic correlation between chronotype and BMI (rG = 0.056, P = 0.05; undersleeping and BMI (rG = 0.147, P = 1x10-5 and oversleeping and BMI (rG = 0.097, P = 0.04, Mendelian Randomisation analyses, with limited power, provided no consistent evidence of causal associations between BMI or type 2 diabetes and chronotype or sleep duration. Our study brings the total number of loci associated with chronotype to 22 and with sleep duration to three, and provides new insights into the biology of sleep and

  19. Adenosine stress high-pitch 128-slice dual-source myocardial computed tomography perfusion for imaging of reversible myocardial ischemia: comparison with magnetic resonance imaging.

    Science.gov (United States)

    Feuchtner, Gudrun; Goetti, Robert; Plass, André; Wieser, Monika; Scheffel, Hans; Wyss, Christophe; Stolzmann, Paul; Donati, Olivio; Schnabl, Johannes; Falk, Volkmar; Alkadhi, Hatem; Leschka, Sebastian; Cury, Ricardo C

    2011-09-01

    Coronary computed tomography angiography (CTA) enables accurate anatomic evaluation of coronary artery stenosis but lacks information about hemodynamic significance. The aim of this study was to evaluate 128-slice myocardial CT perfusion (CTP) imaging with adenosine stress using a high-pitch mode, in comparison with cardiac MRI (CMR). Thirty-nine patients with intermediate to high coronary risk profile underwent adenosine stress 128-slice dual source CTP (128×0.6 mm, 0.28 seconds). Among those, 30 patients (64 ± 10 years, 6% women) also underwent adenosine stress CMR (1.5T). The 2-step CTP protocol consisted of (1) adenosine stress-CTP using a high-pitch factor (3.4) ECG-synchronized spiral mode and (2) rest-CTP/coronary-CTA using either high-pitch (heart rate 63 bpm). Results were compared with CMR and with invasive angiography in 25 patients. The performance of stress-CTP for detection of myocardial perfusion defects compared with CMR was sensitivity, 96%; specificity, 88%; positive predictive value (PPV), 93%; negative predictive value (NPV), 94% (per vessel); and sensitivity, 78%; specificity, 87%; PPV, 83%; NPV, 84% (per segment). The accuracy of stress-CTP for imaging of reversible ischemia compared with CMR was sensitivity, 95%; specificity, 96%; PPV, 95%; and NPV, 96% (per vessel). In 25 patients who underwent invasive angiography, the accuracy of CTA for detection of stenosis >70% was (per segment): sensitivity, 96%; specificity, 88%; PPV, 67%; and NPV, 98.9%. The accuracy improved from 84% to 95% after adding stress CTP to CTA. Radiation exposure of the entire stress/rest CT protocol was only 2.5 mSv. Adenosine-induced stress 128-slice dual-source high-pitch myocardial CTP allows for simultaneously assessment of reversible myocardial ischemia and coronary stenosis, with good diagnostic accuracy as compared with CMR and invasive angiography, at a very low radiation exposure.

  20. Knockdown of miR-128a induces Lin28a expression and reverts myeloid differentiation blockage in acute myeloid leukemia.

    Science.gov (United States)

    De Luca, Luciana; Trino, Stefania; Laurenzana, Ilaria; Tagliaferri, Daniela; Falco, Geppino; Grieco, Vitina; Bianchino, Gabriella; Nozza, Filomena; Campia, Valentina; D'Alessio, Francesca; La Rocca, Francesco; Caivano, Antonella; Villani, Oreste; Cilloni, Daniela; Musto, Pellegrino; Del Vecchio, Luigi

    2017-06-01

    Lin28A is a highly conserved RNA-binding protein that concurs to control the balance between stemness and differentiation in several tissue lineages. Here, we report the role of miR-128a/Lin28A axis in blocking cell differentiation in acute myeloid leukemia (AML), a genetically heterogeneous disease characterized by abnormally controlled proliferation of myeloid progenitor cells accompanied by partial or total inability to undergo terminal differentiation. First, we found Lin28A underexpressed in blast cells from AML patients and AML cell lines as compared with CD34+ normal precursors. In vitro transfection of Lin28A in NPM1-mutated OCI-AML3 cell line significantly triggered cell-cycle arrest and myeloid differentiation, with increased expression of macrophage associate genes (EGR2, ZFP36 and ANXA1). Furthermore, miR-128a, a negative regulator of Lin28A, was found overexpressed in AML cells compared with normal precursors, especially in acute promyelocytic leukemia (APL) and in 'AML with maturation' (according to 2016 WHO classification of myeloid neoplasms and acute leukemia). Its forced overexpression by lentiviral infection in OCI-AML3 downregulated Lin28A with ensuing repression of macrophage-oriented differentiation. Finally, knockdown of miR-128a in OCI-AML3 and in APL/AML leukemic cells (by transfection and lentiviral infection, respectively) induced myeloid cell differentiation and increased expression of Lin28A, EGR2, ZFP36 and ANXA1, reverting myeloid differentiation blockage. In conclusion, our findings revealed a new mechanism for AML differentiation blockage, suggesting new strategies for AML therapy based upon miR-128a inhibition.

  1. Photodynamic therapy for actinic keratosis: Is the European consensus protocol for daylight PDT superior to conventional protocol for Aktilite CL 128 PDT?

    Science.gov (United States)

    Vignion-Dewalle, Anne-Sophie; Baert, Gregory; Thecua, Elise; Vicentini, Claire; Mortier, Laurent; Mordon, Serge

    2017-09-01

    Topical photodynamic therapy (PDT) is an established treatment modality for various dermato-oncologic conditions. In Europe, initially requiring irradiation with red light, PDT of actinic keratosis (AK) can now also be carried out with exposure to daylight that has been clinically proven to be as effective as and less painful than red light. In this paper, we propose a comparison between the conventional protocol for Aktilite CL 128 (red light source) PDT and the European consensus protocol for daylight PDT - with the exposure is assumed to be performed during either a clear sunny day or an overcast day - in the treatment of AK with methyl aminolevulinate through a mathematical modeling. This already published modeling that is based on an iterative procedure alternating determination of the local fluence rate and updating of the local optical properties enables to estimate the local damage induced by the therapy. The European consensus protocol for daylight PDT during a sunny day and an overcast day provides, on average, 6.50 and 1.79 times higher PDT local damages at the end of the treatment than those obtained using the conventional protocol for Aktilite CL 128 PDT, respectively. Results analysis shows that, even performed during an overcast day, the European consensus protocol for daylight PDT leads to higher PDT local damages than the efficient conventional protocol for Aktilite CL 128. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Exposure to Solute Stress Affects Genome-Wide Expression but Not the Polycyclic Aromatic Hydrocarbon-Degrading Activity of Sphingomonas sp. Strain LH128 in Biofilms

    Science.gov (United States)

    Fida, Tekle Tafese; Breugelmans, Philip; Lavigne, Rob; Coronado, Edith; Johnson, David R.; van der Meer, Jan Roelof; Mayer, Antonia P.; Heipieper, Hermann J.; Hofkens, Johan

    2012-01-01

    Members of the genus Sphingomonas are important catalysts for removal of polycyclic aromatic hydrocarbons (PAHs) in soil, but their activity can be affected by various stress factors. This study examines the physiological and genome-wide transcription response of the phenanthrene-degrading Sphingomonas sp. strain LH128 in biofilms to solute stress (invoked by 450 mM NaCl solution), either as an acute (4-h) or a chronic (3-day) exposure. The degree of membrane fatty acid saturation was increased as a response to chronic stress. Oxygen consumption in the biofilms and phenanthrene mineralization activities of biofilm cells were, however, not significantly affected after imposing either acute or chronic stress. This finding was in agreement with the transcriptomic data, since genes involved in PAH degradation were not differentially expressed in stressed conditions compared to nonstressed conditions. The transcriptomic data suggest that LH128 adapts to NaCl stress by (i) increasing the expression of genes coping with osmolytic and ionic stress such as biosynthesis of compatible solutes and regulation of ion homeostasis, (ii) increasing the expression of genes involved in general stress response, (iii) changing the expression of general and specific regulatory functions, and (iv) decreasing the expression of protein synthesis such as proteins involved in motility. Differences in gene expression between cells under acute and chronic stress suggest that LH128 goes through changes in genome-wide expression to fully adapt to NaCl stress, without significantly changing phenanthrene degrading activity. PMID:23001650

  3. Determination of specific radioactivity of samarium-153 product. 1. Quantitative determination of samarium by spectrophotometry

    Energy Technology Data Exchange (ETDEWEB)

    Izumo, Mishiroku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nemoto, Masahiro [Tokyo Nuclear Service Co., Ltd., Tokyo (Japan)

    2002-03-01

    On the specific radioactivity of Sm-153 for the radiotherapy of cancers, a simple method for determination of the amount of Sm was described. The method used Arsenazo III as a colorimetric reagent. The sample irradiated in the reactor was dissolved in 1M HCl solution. A small part of it was taken and mixed with Arsenazo III at pH 3.2, and the amount of Sm was determined by the spectrophotometric method at a wavelength of 652 nm. The molar absorptivity of Sm at 652 nm was 6.6x10{sup 3} m{sup -1}{center_dot}mm{sup -1}. The error of measurement in the partial different conditions was about 2% of the value determined. The effects of impurities, Fe, Zn and Cu mixing in the Sm during operation, were clarified. (author)

  4. Assessments of Coronary Artery Visibility and Radiation Dose in Infants with Congenital Heart Disease on Cardiac 128-slice CT and on Cardiac 64-slice CT.

    Science.gov (United States)

    Cui, Y; Huang, M; Zheng, J; Li, J; Liu, H; Liang, C

    2016-01-01

    The aim of this study was to compare the coronary artery visibility and radiation dose in infants with CHD on cardiac 128-slice CT and on cardiac 64-slice CT. The images of 200 patients were analyzed in this study, 100 patients were selected randomly from a group of 789 infants (coronary artery segments was graded on a four-point scale. The coronary arteries were considered to be detected or visible when grade was 2 or higher. The visibility of the coronary artery segments and the radiation dose was compared between the two groups. Except for the rate of LM (96 vs. 99%), the detection rates of the total, LAD, LCX, RCA, and the proximal segment of the RCA in the 256-slice CT group were significantly higher than those in the 64-slice CT group (51.7, 53.33, 33.67, 53.33, and 99 vs. 34.8, 34.33, 18, 30.67, and 75%, respectively). The counts of visibility score (4/3/2/1) for the LM and the proximal segment of the RCA were 62/22/12/4 and 56/20/17/7, respectively, in the 128-slice CT group and 17/42/30/1 and 9/30/38/25, respectively, in the 64-slice CT group. There were significant differences, especially for score 4 and 3, between the two groups. The radiation dose in the 128-slice CT group was significantly decreased than those in the 64-slice CT group (CTDIvol 1.88 ± 0.51 vs. 5.61 ± 0.63 mGy; SSDE 4.48 ± 1.15 vs. 13.97 ± 1.52 mGy; effective radiation dose 1.36 ± 0.44 vs. 4.06 ± 0.7 mSv). With reduced radiation dose, the visibility of the coronary artery in infants with CHD via prospective ECG-triggered mode on a 128-slice CT is superior to that of the 64-slice CT using retrospective ECG-gated spiral mode.

  5. Remaining Sites Verification Package for the 128-B-2, 100-B Burn Pit #2 Waste Site, Waste Site Reclassification Form 2005-038

    Energy Technology Data Exchange (ETDEWEB)

    R. A. Carlson

    2005-12-21

    The 128-B-2 waste site was a burn pit historically used for the disposal of combustible and noncombustible wastes, including paint and solvents, office waste, concrete debris, and metallic debris. This site has been remediated by removing approximately 5,627 bank cubic meters of debris, ash, and contaminated soil to the Environmental Restoration Disposal Facility. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  6. ESA astronaut (and former physicist at CERN) Christer Fuglesang returning a symbolic neutralino particle to CERN Director for research Sergio Bertolucci. Fuglesang flew the neutralino to the International Space Station on the occasion of his STS128 mission in 2009.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    ESA astronaut (and former physicist at CERN) Christer Fuglesang returning a symbolic neutralino particle to CERN Director for research Sergio Bertolucci. Fuglesang flew the neutralino to the International Space Station on the occasion of his STS128 mission in 2009.

  7. A novel mutation in the miR-128b gene reduces miRNA processing and leads to glucocorticoid resistance of MLL-AF4 acute lymphocytic leukemia cells.

    Science.gov (United States)

    Kotani, Ai; Ha, Daon; Schotte, Diana; den Boer, Monique L; Armstrong, Scott A; Lodish, Harvey F

    2010-03-15

    MLL-AF4 acute lymphocytic leukemia has a poor prognosis, and the mechanisms by which these leukemias develop are not understood despite intensive research based on well-known concepts and methods. MicroRNAs (miRNAs) are a new class of small noncoding RNAs that post-transcriptionally regulate expression of target mRNA transcripts. We recently reported that ectopic expression of miR-128b together with miR-221, two of the miRNAs downregulated in MLL-AF4 ALL, restores glucocorticoid resistance through downregulation of the MLL-AF4 chimeric fusion proteins MLL-AF4 and AF4-MLL that are generated by chromosomal translocation t(4;11). Here we report the identification of new mutations in miR-128b in RS4;11 cells, derived from MLL-AF4 ALL patient. One novel mutation significantly reduces the processing of miR-128b. Finally, this base change occurs in a primary MLL-AF4 ALL sample as an acquired mutation. These results demonstrate that the novel mutation in miR-128b in MLL-AF4 ALL alters the processing of miR-128b and that the resultant downregulation of mature miR-128b contributes to glucocorticoid resistance through the failure to downregulate the fusion oncogenes.

  8. Adenosine-stress low-dose single-scan CT myocardial perfusion imaging using a 128-slice dual-source CT: a comparison with fractional flow reserve.

    Science.gov (United States)

    Choo, Ki Seok; Hwangbo, Lee; Kim, June Hong; Park, Yong Hyun; Kim, Jeong Su; Kim, Jun; Chun, Kook Jin; Jeong, Dong Wook; Lim, Soo Jin

    2013-05-01

    Coronary CT angiography (CCTA) allows accurate evaluation of coronary artery stenosis but has limitations in information on hemodynamic significance of stenotic lesions. To determine the feasibility of adenosine-stress low-dose single-scan CT myocardial perfusion imaging (MPI) using a 128-slice dual-source CT scanner for the diagnosis of hemodynamically significant coronary artery stenosis as defined by fractional flow reserve (FFR). This study was proved by the Institutional Review Board and informed consent was obtained from the patients before enrollment in the study. Ninety-seven patients with chest pain and low-to-intermediate pretest probability of coronary artery disease were prospectively enrolled. Adenosine-stress CCTA using ECG-correlated maximum tube current modulation (Mindose(®)) with 128-slice dual-source CT was performed in all 97 patients. In 37 patients (38.1%; 28 men, nine women; mean age, 61.7 ± 20.5 years; mean heart rate, 74.6 ± 2.8 bpm) with significant stenosis at CCTA (lumen diameter reduction >50%), FFR was performed after CCTA, as a reference standard for the evaluation of myocardial perfusion. FFR value ≤0.75 was considered as positive. CTMPI and CCTA were read by two experienced radiologists with consensus, respectively. The effective radiation dose of adenosine-stress single-scan CTMPI was 4.63 ± 2.57 mSv. Compared with FFR, sensitivity, specificity, positive predictive value (PPV), and negative predictive value (NPV) for identifying significant coronary stenoses were 93.1%, 82.7%, 75.0%, and 95.6%, respectively, on CCTA and 93.1%, 90.3%, 84.4%, and 95.9%, respectively, on CTMPI. On combined CCTA and CTMPI, sensitivity, specificity, PPV, and NPV were 93.1%, 94.2%, 90.0%, and 96.0%, respectively. Adenosine-stress low-dose single scan CTMPI using a 128-slice dual-source CT can provide complementary information on the hemodynamical significance of coronary artery stenosis as well as anatomical information of coronary arteries.

  9. Design and performance of a low noise, 128-channel ASIC preamplifier for readout of active matrix flat-panel imaging arrays

    CERN Document Server

    Maolinbay, M; Yarema, R J; Antonuk, L E; El-Mohri, Y; Yeakey, M

    2002-01-01

    Design architecture and performance measurements of a low noise, 128-channel application-specific-integrated-circuit (ASIC) preamplifier are reported. The ASIC was designed for readout of active matrix flat-panel imager (AMFPI) arrays. Such arrays, which presently can be made as large as 41 cmx41 cm and with pixel-to-pixel pitches down to approx 70 mu m, require large numbers of low noise, high density, custom integrated readout circuits. The design of this new chip is specifically tailored for research and development of active matrix flat-panel arrays for various medical imaging applications. The design architecture includes the following features: (1) Programmable signal gain which allows acquisition of a wide range of signal sizes from various array designs so as to optimize the signal-to-noise ratio; (2) Correlated double sampling (CDS) which significantly reduces certain noise components; (3) Pipelined readout (simultaneously sampling and multiplexing signals) which reduces image acquisition time; (4) P...

  10. Polymorphism of UGT1A1*28 (TA)7 and liver damage in hepatitis B virus-positive patients in Albania.

    Science.gov (United States)

    Marku, E; Maltese, P E; Koni, M; Capodicasa, N; Qendro, I S; Rigoni, E; Cecchin, S; Bertelli, M

    2015-05-18

    Hepatitis B virus (HBV) is the infectious agent of both acute and chronic hepatitis. HBV exists in multiple genotypic variants that differ in their capacity to become persistent chronic infections and in their clinical manifestations, including hepatocellular carcinoma. The 8 genotypes (A-H) of HBV show a specific worldwide geographic distribution and are correlated with different disease course, severity, and response to therapy. We isolated DNA from 75 HBV-positive blood donors, chosen randomly from the database of the National Blood Bank in Tirana, to specifically analyze the UGT1A1 polymorphism to determine its correlations with bilirubin levels and liver function. The large number of subjects who were HBV-positive carriers of heterozygosis or homozygosis for the UGT1A1*28 (TA)7 polymorphism suggests that these individuals may be more susceptible to cancer and should follow a strict regime of prevention.

  11. Remaining Sites Verification Package for the 128-F-2, 100-F Burning Pit Waste Site, Waste Site Reclassification Form 2008-031

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2008-12-01

    The 128-F-2 waste site consisted of multiple burn and debris filled pits located directly east of the 107-F Retention Basin and approximately 30.5 m east of the northeast corner of the 100-F Area perimeter road that runs along the riverbank. The burn pits were used for incinerating nonradioactive, combustible materials from 1945 to 1965. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  12. Performance of a radiation hard 128 channel analogue front-end chip for the readout of a silicon-based hybrid photon detector

    CERN Document Server

    Lacasta, C; Dulinski, W; Chesi, Enrico Guido; Joram, C; Kaplon, J; Lozano-Bahilo, J; Séguinot, Jacques; Szczygiel, R; Weilhammer, Peter; Ypsilantis, Thomas

    2003-01-01

    The performance is described of a front-end chip, the SCT128A-LC chip, originally developed for the readout of a silicon based Hybrid Photon Detector (HPD), which is part of an RICH detector to be run in an LHC experimental environment. The relatively low signal charge from single photoelectrons, impinging on the silicon pad sensor, put very stringent requirements on the noise performance of the front-end chip. An absolute noise calibration using X-ray sources and a **2**4**1Am gamma source was performed. It is demonstrated that sufficiently good signal over noise ratio can be obtained to use this chip for the read-out of an HPD in LHC experiments.

  13. Prospective ECG triggering versus low-dose retrospective ECG-gated 128-channel CT coronary angiography: comparison of image quality and radiation dose

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Q.; Yin, Y.; Hua, X.; Zhu, R.; Hua, J. [Department of Radiology, Renji Hospital, Shanghai Jiaotong University School of Medicine, Shanghai (China); Xu, J., E-mail: xujianr@hotmail.co [Department of Radiology, Renji Hospital, Shanghai Jiaotong University School of Medicine, Shanghai (China)

    2010-10-15

    Aim: To evaluate image quality and radiation dose for 128-detector prospective electrocardiogram (ECG)-gated computed tomography coronary angiography (CTCA) compared with a low-dose retrospective ECG-gated imaging protocol. Materials and methods: Thirty-one and 47 patients suspected of having coronary artery disease were enrolled into groups examined using prospective and low-dose retrospective ECG-gated CT protocols respectively. All examinations were performed on a 128-detector CT system (Definition AS, Siemens Healthcare, Forchheim, Germany). Prospective CTCA was performed using following parameters: tube voltage 100 kV; tube current 205 mAs; centre of acquisition window 70% of the RR interval. The tube current for low-dose retrospective ECG-gated CTCA was full dose during 40-70% of the RR interval and partial dose for the rest of RR interval. The pitch varied between 0.2 and 0.5 depending on heart rate and patient size. Image quality of coronary arteries was evaluated using a four-point grading scale. The signal-to-noise ratios (SNRs) of enhanced arteries and myocardium were also measured, corresponding contrast-to-noise ratios (CNRs) were calculated, and the radiation doses received were recorded. Results: There was a significant difference in the image quality scores between the retrospective and prospective gating protocols (Chi-square = 15.331, p = 0.009). There was no significant difference between the SNRs of the contrasted artery and myocardium in these two groups, but the CNRs were increased in the prospective group. The mean radiation dose of prospective gating group was 2.71 {+-} 0.67 mSv (range, 1.67-3.59 mSv), which was significantly lower than that of the retrospective group (p < 0.001). Conclusion: Prospective CT angiography can achieve lower radiation dose than that of low-dose retrospective CT angiography, with preserved image quality.

  14. 128-slice CT angiography of the aorta without ECG-gating: efficacy of faster gantry rotation time and iterative reconstruction in terms of image quality and radiation dose

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Vincenzo; Garattoni, Monica; Buia, Francesco; Attina, Domenico; Lovato, Luigi; Zompatori, Maurizio [University Hospital ' ' S.Orsola' ' , Cardio-Thoracic-Vascular Department, Cardio-Thoracic Radiology Unit, Bologna (Italy)

    2016-02-15

    To evaluate image quality and radiation dose of non ECG-gated 128-slice CT angiography of the aorta (CTAA) with fast gantry rotation time and iterative reconstruction. Four hundred and eighty patients underwent non ECG-gated CTAA. Qualitative and quantitative image quality assessments were performed. Radiation dose was assessed and compared with the dose of patients who underwent ECG-gated CTAA (n = 126) and the dose of previous CTAA performed with another CT (n = 339). Image quality (aortic root-ascending portion) was average-to-excellent in more than 94 % of cases, without any non-diagnostic scan. For proximal coronaries, image quality was average-to-excellent in more than 50 %, with only 21.5 % of non-diagnostic cases. Quantitative analysis results were also good. Mean radiation dose for thoracic CTAA was 5.6 mSv versus 20.6 mSv of ECG-gated protocol and 20.6 mSv of 16-slice CTAA scans, with an average dose reduction of 72.8 % (p < 0.001). Mean radiation dose for thoracic-abdominal CTAA was 9.7 mSv, versus 20.9 mSv of 16-slice CTAA scans, with an average dose reduction of 53.6 % (p < 0.001). Non ECG-gated 128-slice CTAA is feasible and able to provide high quality visualization of the entire aorta without significant motion artefacts, together with a considerable dose and contrast media volume reduction. (orig.)

  15. L-allo-threonine aldolase with an H128Y/S292R mutation from Aeromonas jandaei DK-39 reveals the structural basis of changes in substrate stereoselectivity.

    Science.gov (United States)

    Qin, Hui-Min; Imai, Fabiana Lica; Miyakawa, Takuya; Kataoka, Michihiko; Kitamura, Nahoko; Urano, Nobuyuki; Mori, Koji; Kawabata, Hiroshi; Okai, Masahiko; Ohtsuka, Jun; Hou, Feng; Nagata, Koji; Shimizu, Sakayu; Tanokura, Masaru

    2014-06-01

    L-allo-Threonine aldolase (LATA), a pyridoxal-5'-phosphate-dependent enzyme from Aeromonas jandaei DK-39, stereospecifically catalyzes the reversible interconversion of L-allo-threonine to glycine and acetaldehyde. Here, the crystal structures of LATA and its mutant LATA_H128Y/S292R were determined at 2.59 and 2.50 Å resolution, respectively. Their structures implied that conformational changes in the loop consisting of residues Ala123-Pro131, where His128 moved 4.2 Å outwards from the active site on mutation to a tyrosine residue, regulate the substrate specificity for L-allo-threonine versus L-threonine. Saturation mutagenesis of His128 led to diverse stereoselectivity towards L-allo-threonine and L-threonine. Moreover, the H128Y mutant showed the highest activity towards the two substrates, with an 8.4-fold increase towards L-threonine and a 2.0-fold increase towards L-allo-threonine compared with the wild-type enzyme. The crystal structures of LATA and its mutant LATA_H128Y/S292R reported here will provide further insights into the regulation of the stereoselectivity of threonine aldolases targeted for the catalysis of L-allo-threonine/L-threonine synthesis.

  16. Shape-controlled tunable homochromatic luminescence and inner photoelectric effect of hexagonal Na1.23Ca0.12Y1.28Er0.24F6 phosphors.

    Science.gov (United States)

    Wang, Xiangfu; Yan, Xiaohong; Wang, Tao; Bu, Yanyan; Kan, Caixia; Chen, Yuan

    2012-05-21

    Novel hexagonal Na1.23Ca0.12Y1.28Er0.24F6 nanodisks, microtubes, and nanorods were synthesized hydrothermally for the first time. Time-dependent morphology evolution showed that the resulting nanodisks, microtubes, and nanorods were synthesized by a dissolution-reconstruction formation mechanism. With the help of a 980 nm semiconductor laser, tunable homochromatic luminescence was observed by exciting single hexagonal Na1.23Ca0.12Y1.28Er0.24F6 nanodisks, microtubes, and nanorods, respectively. Simultaneously, the inner photoelectric effect was witnessed in the hexagonal Na1.23Ca0.12Y1.28Er0.24F6 nanodisks, microtubes, and nanorods under 980 nm excitation. We attributed anomalous inner photoelectric current to the presence of a laser stepped resonant excitation energy migration in the Na1.23Ca0.12Y1.28Er0.24F6 matrix when a laser was applied to it. Simultaneous control of homochromatic luminescence and inner photoelectric effect were achieved by modifying morphological shapes of single Na1.23Ca0.12Y1.28Er0.24F6 phosphors.

  17. 128x128 Ultra-High Density Optical Interconnect Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Future NASA programs like Tertiary Planet Finder (TPF) require high-density deformable mirrors with up to 16,000 actuators to enable direct imaging of planets around...

  18. 128x128 Ultra-High Density Optical Interconnect Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Future NASA programs like Tertiary Planet Finder (TPF) require high density deformable mirrors with upto 16,000 actuators to enable direct imaging of planets around...

  19. Real-time demonstration of 128-QAM-encoded optical OFDM transmission with a 5.25bit/s/Hz spectral efficiency in simple IMDD systems utilizing directly modulated DFB lasers.

    Science.gov (United States)

    Jin, X Q; Giddings, R P; Hugues-Salas, E; Tang, J M

    2009-10-26

    The feasibility of implementing 128-QAM in off-the-shelf component-based real-time optical OFDM (OOFDM) transceivers incorporating advanced channel estimation, on-line performance monitoring and live parameter optimisation, is experimentally investigated, for the first time, in intensity-modulation and direct-detection (IMDD) single-mode fibre (SMF) and multi-mode fibre (MMF) transmission systems involving directly modulated DFB lasers. The highest ever spectral efficiency of 5.25bit/s/Hz is demonstrated successfully in the aforementioned simple systems. Experimental investigations show that, it is feasible to transmit 5.25 Gb/s 128-QAM-encoded OOFDM real-time signals over 25 km MetroCor(TM) SMFs and 500 m 62.5/125 microm OM1 MMFs. The impact of key parameters on the transmission performance of the real-time OOFDM transceivers with 128-QAM encoding are explored, based on which optimum signal clipping ratios are identified.

  20. What are the risk factors for dislocation in primary total hip arthroplasty? A multicenter case-control study of 128 unstable and 438 stable hips.

    Science.gov (United States)

    Fessy, M H; Putman, S; Viste, A; Isida, R; Ramdane, N; Ferreira, A; Leglise, A; Rubens-Duval, B; Bonin, N; Bonnomet, F; Combes, A; Boisgard, S; Mainard, D; Leclercq, S; Migaud, H

    2017-09-01

    Dislocation after total hip arthroplasty (THA) is a leading reason for surgical revision. The risk factors for dislocation are controversial, particularly those related to the patient and to the surgical procedure itself. The differences in opinion on the impact of these factors stem from the fact they are often evaluated using retrospective studies or in limited patient populations. This led us to carry out a prospective case-control study on a large population to determine: 1) the risk factors for dislocation after THA, 2) the features of these dislocations, and 3) the contribution of patient-related factors and surgery-related factors. Risk factors for dislocation related to the patient and procedure can be identified using a large case-control study. A multicenter, prospective case-control study was performed between January 1 and December 31, 2013. Four patients with stable THAs were matched to each patient with a dislocated THA. This led to 566 primary THA cases being included: 128 unstable, 438 stable. The primary matching factors were sex, age, initial diagnosis, surgical approach, implantation date and type of implants (bearing size, standard or dual-mobility cup). The patients with unstable THAs were 67±12 [37-73]years old on average; there were 61 women (48%) and 67 men (52%). Hip osteoarthritis (OA) was the main reason for the THA procedure in 71% (91/128) of the unstable group. The dislocation was posterior in 84 cases and anterior in 44 cases. The dislocation occurred within 3 months of the primary surgery in 48 cases (38%), 3 to 12 months after in 23 cases (18%), 1 to 5years after in 20 cases (16%), 5 to 10years after in 17 cases (13%) and more than 10years later in 20 cases. The dislocation recurred within 6 months of the initial dislocation in 23 of the 128 cases (18%). The risk factors for instability were a high ASA score with an odds ratio (OR) of 1.93 (95% CI: 1.4-2.6), neurological disability (cognitive, motor or psychiatric disorders) with

  1. 128 | P a g e

    African Journals Online (AJOL)

    Fr. Ikenga

    and political climate that generates xenophobia and racism (defensive reactions against migrants). 18 Declaration on Racism, discrimination, xenophobia and related intolerance against Migrants and trafficked persons. Asia-Pacific NGO Meeting for the world conference against Racism, Racial Discrimination, Xenophobia.

  2. 123 - 128 Sadau et al.

    African Journals Online (AJOL)

    User

    1* Department of Human Physiology, College of Medical Sciences, Gombe State University, Gombe, Nigeria. 2 Department of Human Physiology, Ahmadu Bello University, Zaria, Nigeria. 3 Department of Veterinary Physiology and Pharmacology, Ahmadu Bello University, Zaria, Nigeria. 4 Department of Human Physiology, ...

  3. RT 128: New Project Incubator

    Science.gov (United States)

    2015-09-04

    the real systems problem. As Erik Herzog of SAAB stated at a recent workshop, “Success does not come from excellence in a single property, but by...excelling in the combination of properties ( Herzog , 2015).” Now is the time to focus on the integration of formal methods in order to address the...10. ACM, 2006. ( Herzog , 2015) Herzog , E., SAAB, Searching for a Partner in .SE, Abstract for LCCC-ACCESS workshop on Model- Based Engineering, Lund

  4. Neutralization of Diverse Human Cytomegalovirus Strains Conferred by Antibodies Targeting Viral gH/gL/pUL128-131 Pentameric Complex.

    Science.gov (United States)

    Ha, Sha; Li, Fengsheng; Troutman, Matthew C; Freed, Daniel C; Tang, Aimin; Loughney, John W; Wang, Dai; Wang, I-Ming; Vlasak, Josef; Nickle, David C; Rustandi, Richard R; Hamm, Melissa; DePhillips, Pete A; Zhang, Ningyan; McLellan, Jason S; Zhu, Hua; Adler, Stuart P; McVoy, Michael A; An, Zhiqiang; Fu, Tong-Ming

    2017-04-01

    Human cytomegalovirus (HCMV) is the leading cause of congenital viral infection, and developing a prophylactic vaccine is of high priority to public health. We recently reported a replication-defective human cytomegalovirus with restored pentameric complex glycoprotein H (gH)/gL/pUL128-131 for prevention of congenital HCMV infection. While the quantity of vaccine-induced antibody responses can be measured in a viral neutralization assay, assessing the quality of such responses, including the ability of vaccine-induced antibodies to cross-neutralize the field strains of HCMV, remains a challenge. In this study, with a panel of neutralizing antibodies from three healthy human donors with natural HCMV infection or a vaccinated animal, we mapped eight sites on the dominant virus-neutralizing antigen-the pentameric complex of glycoprotein H (gH), gL, and pUL128, pUL130, and pUL131. By evaluating the site-specific antibodies in vaccine immune sera, we demonstrated that vaccination elicited functional antiviral antibodies to multiple neutralizing sites in rhesus macaques, with quality attributes comparable to those of CMV hyperimmune globulin. Furthermore, these immune sera showed antiviral activities against a panel of genetically distinct HCMV clinical isolates. These results highlighted the importance of understanding the quality of vaccine-induced antibody responses, which includes not only the neutralizing potency in key cell types but also the ability to protect against the genetically diverse field strains.IMPORTANCE HCMV is the leading cause of congenital viral infection, and development of a preventive vaccine is a high public health priority. To understand the strain coverage of vaccine-induced immune responses in comparison with natural immunity, we used a panel of broadly neutralizing antibodies to identify the immunogenic sites of a dominant viral antigen-the pentameric complex. We further demonstrated that following vaccination of a replication

  5. Newly Discovered Hydrothermal Plumes Along the Furious Fifties, South East Indian Ridge (SEIR; 128°E-140°E)

    Science.gov (United States)

    Boulart, C.; Chavagnac, V.; Briais, A.; Revillon, S.; Donval, J. P.; Guyader, V.

    2015-12-01

    We report on the first evidence for hydrothermal activity along the intermediate-spreading South-East Indian Ridge (SEIR) between Australia and Antarctica (128°E-140°E), discovered during the STORM cruise of R/V L'Atalante. This section of the SEIR is located east of the low-magma Australian-Antarctic Discordance (AAD), where the ridge has the morphology of a slow-spreading mid-ocean ridge despite its intermediate spreading rate of 75 mm/yr. The axial depth decreases eastward, reflecting an eastward increase in magma budget.Using in-situ geochemical tracers based on optical backscatter, temperature, redox potential sensor and in situ mass spectrometer (ISMS) anomalies, we establish the existence of several distinct hydrothermal plumes within the water column along the 500 nautical miles ridge section. At one site, the combination of near-bottom temperature anomalies of 0.1°C together with strong dissolved methane and dissolved carbon dioxide anomalies revealed by the ISMS provides the precise location of an active vent in the Deep Southern Indian Ocean off Tasmania. Hydrothermal venting along the 128°E-140°E section of the SEIR appears to be significant, an observation consistent with the global link between spreading rate and plume occurrence (Baker and German, 2004). Moreover, the plume incidence increases westward and, in the eastern part, hydrothermal venting seems to be less significant, suggesting a possible influence of the high magma budget, as observed in mid-ocean ridge sections affected by hotspots. Future investigation will focus on the direct identification of venting sources and the study of hydrothermal circulation within the specific settings of the AAD. The observation of new venting sites at the frontier between Pacific and Indian Oceans may also provide new insights on the biogeography (diversity and distribution) of hydrothermal fauna. Baker, E. T., and C. R. German (2004), On the global distribution of hydrothermal vent fields, in Mid

  6. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  7. NMR measurement system including two synchronized ring buffers, with 128 rf coils for in situ water monitoring in a polymer electrolyte fuel cell

    Science.gov (United States)

    Ogawa, Kuniyasu; Haishi, Tomoyuki; Aoki, Masaru; Hasegawa, Hiroshi; Morisaka, Shinichi; Hashimoto, Seitaro

    2017-01-01

    A small radio-frequency (rf) coil inserted into a polymer electrolyte fuel cell (PEFC) can be used to acquire nuclear magnetic resonance (NMR) signals from the water in a membrane electrode assembly (MEA) or in oxygen gas channels in the PEFC. Measuring the spatial distribution of the water in a large PEFC requires using many rf probes, so an NMR measurement system which acquires NMR signals from 128 rf probes at intervals of 0.5 s was manufactured. The system has eight rf transceiver units with a field-programmable gate array (FPGA) for modulation of the excitation pulse and quadrature phase detection of the NMR signal, and one control unit with two ring buffers for data control. The sequence data required for the NMR measurement were written into one ring buffer. The acquired NMR signal data were then written temporarily into the other ring buffer and then were transmitted to a personal computer (PC). A total of 98 rf probes were inserted into the PEFC that had an electrical generation area of 16 cm × 14 cm, and the water generated in the PEFC was measured when the PEFC operated at 100 A. As a result, time-dependent changes in the spatial distribution of the water content in the MEA and the water in the oxygen gas channels were obtained.

  8. 3T MRI and 128-slice dual-source CT cisternography images of the cranial nerves a brief pictorial review for clinicians.

    Science.gov (United States)

    Roldan-Valadez, Ernesto; Martinez-Anda, Jaime J; Corona-Cedillo, Roberto

    2014-01-01

    There is a broad community of health sciences professionals interested in the anatomy of the cranial nerves (CNs): specialists in neurology, neurosurgery, radiology, otolaryngology, ophthalmology, maxillofacial surgery, radiation oncology, and emergency medicine, as well as other related fields. Advances in neuroimaging using high-resolution images from computed tomography (CT) and magnetic resonance (MR) have made highly-detailed visualization of brain structures possible, allowing normal findings to be routinely assessed and nervous system pathology to be detected. In this article we present an integrated perspective of the normal anatomy of the CNs established by radiologists and neurosurgeons in order to provide a practical imaging review, which combines 128-slice dual-source multiplanar images from CT cisternography and 3T MR curved reconstructed images. The information about the CNs includes their origin, course (with emphasis on the cisternal segments and location of the orifices at the skull base transmitting them), function, and a brief listing of the most common pathologies affecting them. The scope of the article is clinical anatomy; readers will find specialized texts presenting detailed information about particular topics. Our aim in this article is to provide a helpful reference for understanding the complex anatomy of the cranial nerves. Copyright © 2013 Wiley Periodicals, Inc.

  9. Adenosine-stress dynamic myocardial perfusion imaging using 128-slice dual-source CT: optimization of the CT protocol to reduce the radiation dose.

    Science.gov (United States)

    Kim, Sung Mok; Kim, Yoo Na; Choe, Yeon Hyeon

    2013-04-01

    The aim of this study was to compare the radiation dose and image quality of different adenosine-stress dynamic myocardial perfusion CT protocols using a 128-slice dual-source computed tomography (DSCT) scanner. We included 330 consecutive patients with suspected coronary artery disease. Protocols employed the following dynamic scan parameters: protocol I, a 30-s scan with a fixed tube current (FTC, n = 172); protocol II, a 30-s scan using an automatic tube current modulation (ATCM) technique (n = 108); protocol III, a 14-s scan using an ATCM (n = 50). To determine the scan interval for protocol III, we analyzed time-attenuation curves of 26 patients with myocardial perfusion who had been scanned using protocol I or II. The maximum attenuation difference between normal and abnormal myocardium occurred at 18.0 s to 30.3 s after initiation of contrast injection. Myocardial perfusion images of FTC and ATCM were of diagnostic image quality based on visual analysis. The mean radiation dose associated with protocols I, II, and III was 12.1 ± 1.6 mSv, 7.7 ± 2.5 mSv, and 3.8 ± 1.3 mSv, respectively (p stress CT enables significant dose reduction while maintaining diagnostic image quality.

  10. NMR measurement system including two synchronized ring buffers, with 128 rf coils for in situ water monitoring in a polymer electrolyte fuel cell.

    Science.gov (United States)

    Ogawa, Kuniyasu; Haishi, Tomoyuki; Aoki, Masaru; Hasegawa, Hiroshi; Morisaka, Shinichi; Hashimoto, Seitaro

    2017-01-01

    A small radio-frequency (rf) coil inserted into a polymer electrolyte fuel cell (PEFC) can be used to acquire nuclear magnetic resonance (NMR) signals from the water in a membrane electrode assembly (MEA) or in oxygen gas channels in the PEFC. Measuring the spatial distribution of the water in a large PEFC requires using many rf probes, so an NMR measurement system which acquires NMR signals from 128 rf probes at intervals of 0.5 s was manufactured. The system has eight rf transceiver units with a field-programmable gate array (FPGA) for modulation of the excitation pulse and quadrature phase detection of the NMR signal, and one control unit with two ring buffers for data control. The sequence data required for the NMR measurement were written into one ring buffer. The acquired NMR signal data were then written temporarily into the other ring buffer and then were transmitted to a personal computer (PC). A total of 98 rf probes were inserted into the PEFC that had an electrical generation area of 16 cm × 14 cm, and the water generated in the PEFC was measured when the PEFC operated at 100 A. As a result, time-dependent changes in the spatial distribution of the water content in the MEA and the water in the oxygen gas channels were obtained.

  11. Influence of coupling with shear horizontal surface acoustic wave on lateral propagation of Rayleigh surface acoustic wave on 128°YX-LiNbO3

    Science.gov (United States)

    Zhang, Benfeng; Han, Tao; Tang, Gongbin; Zhang, Qiaozhen; Omori, Tatsuya; Hashimoto, Ken-ya

    2017-07-01

    In this paper, we investigate the impact of the coupling with shear horizontal (SH) surface acoustic wave (SAW) on the propagation of Rayleigh SAW in periodic grating structures on 128°YX-LiNbO3. First, the frequency dispersion behavior with longitudinal and lateral wavenumbers of Rayleigh SAW is calculated using the finite element method (FEM) software COMSOL. It is shown that the coupling causes (1) the satellite stopband and (2) variation of the anisotropy factor. It is also shown these phenomena remain even when the electromechanical coupling factor of SH SAW is zero. Then, the extended thin plate model which can take coupling between two SAWs into account, is applied to simulate the result of FEM. Good agreement between these results indicated that the mechanical coupling is responsible for these two phenomena. Finally, including electrical excitation and detection, the model is applied to the infinitely long interdigital transducer (IDT) structure and the calculated result is compared with that obtained by the three-dimensional FEM. The excellent agreement of both results confirms the effectiveness of the extended thin plate model.

  12. EVI-1 zinc finger protein works as a transcriptional activator via binding to a consensus sequence of GACAAGATAAGATAAN1-28 CTCATCTTC.

    Science.gov (United States)

    Morishita, K; Suzukawa, K; Taki, T; Ihle, J N; Yokota, J

    1995-05-18

    Previously, the DNA-binding consensus sequences for domains 1 (GACAAGATAAGATAA) and 2 (GAAGATGAG) of the EVI-1 protein were identified using GST fusion proteins of each domain in binding and amplification reactions. We have utilized full-length EVI-1 protein to confirm these consensus sequences and determine the spacial and orientation requirements for binding. Our data demonstrate that full-length EVI-1 can independently bind the consensus sequences in gel mobility shift assays. In binding and amplification reactions only the domain 1 consensus sequence (D1-CONS) was obtained with full-length EVI-1 protein. However, by using constructs in which D1-CONS was anchored, products were obtained in which the domain 2 consensus sequence (D2-CONS) was observed with the spacing and orientation of GACAAGATAATATAAN1-28 CTCATCTTC. Using this consensus sequence we show that EVI-1 can activate transcription from reporter constructs. No transcriptional activation was seen with the reporter construct containing D1-CONS alone while activation was seen with the construct-containing D2-CONS alone. These results indicate that the EVI-1 protein works as a transcriptional activator and the binding of the domain 2 with D2-CONS is essential for its activation.

  13. Gilbert syndrome, UGT1A1*28 allele, and cardiovascular disease risk: possible protective effects and therapeutic applications of bilirubin.

    Science.gov (United States)

    Schwertner, Harvey A; Vítek, Libor

    2008-05-01

    Serum bilirubin has been shown to be inversely related to cardiovascular disease (CVD) in both retrospective and prospective studies. Meta-analysis of existing studies has also confirmed that serum bilirubin concentrations are inversely related to CVD. Less information is known about the protective effects of slightly elevated serum bilirubin concentrations. In this review, we will focus primarily on the association of serum bilirubin and CVD and the possible protective roles of bilirubin, heme oxygenase (HO), and bilirubin UDP-glucuronosyltransferase (UGT1A1). HO and biliverdin reductase control the formation of bilirubin, whereas UGT1A1 controls bilirubin conjugation and clearance. Because of the health and therapeutic implications of slightly elevated serum bilirubin concentrations, we will discuss the recent prospective studies on cardiovascular risk in individuals with Gilbert syndrome (GS) as well as those with the UGT1A1*28 allele. Such individuals have decreased hepatic bilirubin UDP-glucuronosyltransferase activity, decreased bilirubin clearance, and increased serum bilirubin concentrations. Lastly, we will discuss some of the therapeutic approaches that could be used to increase serum bilirubin concentrations to prevent CVD and other oxidative and inflammatory diseases.

  14. Four Kentucky Organizations Receive EPA Honors as 2015 Energy Star Partner of the Year for Sustained Excellence in Energy Management, Acting on Climate The agency recognizes 128 partners in 33 states including DIRECTV, The Home Depot, Staples, and Verizon

    Science.gov (United States)

    04/06/15 - ATLANTA, GA - The U.S. Environmental Protection Agency (EPA) and the U.S. Department of Energy (DOE) are honoring 128 businesses and organizations in 33 states, including four in the Commonwealth of Kentucky, with the Energy Star's Partner of th

  15. Aspectos epidemiológicos, clínicos e anatomopatológicos do linfoma em bovinos: 128 casos (1965-2013

    Directory of Open Access Journals (Sweden)

    Welden Panziera

    2014-09-01

    Full Text Available Por meio de um estudo retrospectivo, os aspectos epidemiológicos, clínicos e anatomopatológicos de 128 casos de linfoma bovino são descritos. Dos protocolos que informavam o sexo (n=111, 84,7% correspondiam a fêmeas e 15,3% a machos. Dos protocolos em que constava a raça (n=108, a mais prevalente foi a holandesa (63%. Em relação à idade (n=107, houve uma variação entre um e 14 anos. A maioria dos bovinos era adulta (89,7% e a maior concentração dos casos ocorreu ao redor de 5-8 anos (57,9%. Em relação aos sinais clínicos (n=89, linfadenomegalia foi o achado mais frequentemente observado (74,1%. Outros sinais clínicos, principalmente aqueles relacionados com os sistemas respiratório (dispneia, estertoração pulmonar e taquipneia, cardiovascular (taquicardia, edema subcutâneo e pulso venoso positivo, digestório (atonia ruminal, timpanismo e diarreia e nervoso (paresia dos membros pélvicos e andar cambaleante, foram pouco prevalentes. Na necropsia (n=125, 71,2% dos bovinos apresentavam aumento de volume dos linfonodos; essa linfadenomegalia foi classificada como localizada em 89,6% dos casos e generalizada em 10,3% dos casos. Dos protocolos que informavam os linfonodos acometidos (n=58, a distribuição foi a seguinte: mesentéricos (51,7%, mediastínicos (37,9%, pré-escapulares (29,3%, ilíacos internos (27,6%, inguinais superficiais (25,8% e traqueobrônquicos (18,9%. Além dos linfonodos, outros órgãos comumente afetados pelo linfoma neste estudo incluíram: coração (40%, fígado (15,2%, rim (14,4%, abomaso (12,8%, útero (11,2%, intestino (10,4% e pulmão (7,2%. A presença de massas tumorais no canal vertebral foi observada em poucos casos (3,2%. Com base na epidemiologia e na localização das lesões, a maioria dos casos (96% foi classificada como linfoma enzoótico e o restante (4% como linfoma esporádico. Os resultados encontrados neste estudo irão auxiliar clínicos de grandes animais e patologistas veterin

  16. Evaluation of a Chest Circumference-Adapted Protocol for Low-Dose 128-Slice Coronary CT Angiography with Prospective Electrocardiogram Triggering

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Chenying; Wang, Zufei; Ji, Jiansong; Wang, Hailin; Hu, Xianghua; Chen, Chunmiao [Department of Radiology, Lishui Central Hospital, The Fifth Affiliated Hospital of Wenzhou Medical College, Lishui, Zhejiang 323000 (China)

    2015-11-01

    To assess the effect of chest circumference-adapted scanning protocol on radiation exposure and image quality in patients undergoing prospective electrocardiogram (ECG)-triggered coronary CT angiography (CCTA). One hundred-eighty-five consecutive patients, who had undergone prospective ECG triggering CCTA with a 128-slice CT, were included in the present study. Nipple-level chest circumference, body weight and height were measured before CT examinations. Patients were divided into four groups based on kV/ref·mAs = 100/200, 100/250, 120/200, and 120/250, when patient's chest circumference was ≤ 85.0 (n = 56), 85.0-90.0 (n = 53), 90.0-95.0 (n = 44), and > 95.0 (n = 32), respectively. Image quality per-segment was independently assessed by two experienced observers. Image noise and attenuation were also measured. Signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) were calculated. The effective radiation dose was calculated using CT dose volume index and the dose-length product. A significant correlation was observed between patients' chest circumference and body mass index (r = 0.762, p < 0.001). Chest circumference ranged from 74 to 105 cm, and the mean effective radiation dose was 1.9-3.8 mSv. Diagnostic image quality was obtained in 98.5% (2440/2478) of all evaluated coronary segments without any significant differences among the four groups (p = 0.650). No significant difference in image noise was observed among the four groups (p = 0.439), thus supporting the validity of the chest circumference-adapted scanning protocol. However, vessel attenuation, SNR and CNR were significantly higher in the 100 kV groups than in the 120 kV groups (p < 0.05). A measure of chest circumference can be used to adapt tube voltage and current for individualized radiation dose control, with resultant similar image noise and sustained diagnostic image quality.

  17. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    2016-10-07

    Oct 7, 2016 ... 1Department of Physics, Faculty of Science, Taif University, Taif 888, Saudi Arabia. 2Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo, Egypt. 3Materials Science Unit, Department of Chemistry, Faculty of Science, Tanta University, 31725 Tanta, Egypt. 4Department of ...

  18. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    The optical properties of a new family of Sm2O3–(40–)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at ... The refractive index, molar refraction and polarizability of oxide ions have been calculated by using Lorentz–Lorentz relations. The non-linear variations of the above optical ...

  19. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. The optical properties of a new family of xSm2O3–(40–x)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at room temperature in the UV-visible region. From the absorption edge studies, the values of optical bandgap energies have been evaluated. The refractive index, molar ...

  20. Measurement of radiative lifetime in atomic samarium using ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... In this paper, we report the investigations of lifetime measurement of odd-parity energy level 19009.52 cm. −1 .... introduced by an electronic delay generator between the two Q-switch pulses of Nd-YAG laser. The slope of the .... Our values of the lifetimes are free from the common systematic errors. Thus ...

  1. A novel samarium complex with interesting photoluminescence and ...

    African Journals Online (AJOL)

    The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

  2. Lithium samarium polyphosphate, LiSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-02-01

    Full Text Available The mixed-metal rare-earth polyphosphate LiSm(PO34 consists of a three-dimensional framework in which zigzag [(PO3n]n− chains with a periodicity of four PO4 tetrahedra are connected through Li+ and Sm3+ ions (both with 2. symmetry.

  3. Sodium samarium tetrakis(polyphosphate, NaSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-07-01

    Full Text Available NaSm(PO34 has been prepared by solid state reactions. It belongs to type II of the structural family of MILnIII(PO34 compounds (MI = alkali metal and LnIII = rare earth metal and is composed of ∞(PO3n]n− polyphosphate chains with a repeating unit of four PO4 tetrahedra. The chains extend parallel to [100] and share O atoms with irregular SmO8 polyhedra, forming a three-dimensional framework which delimits tunnels occupied by Na+ cations in a distorted octahedral environment.

  4. Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

    Energy Technology Data Exchange (ETDEWEB)

    Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-08

    The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

  5. Synthesis of copper, silver, and samarium chalcogenides by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Ohtani, T.; Maruyama, K.; Ohshima, K. [Okayama Univ. of Science (Japan). Lab. for Solid State Chemistry

    1997-03-01

    CuInX{sub 2} (X = S, Se, Te), Ag{sub 2}S, Ag{sub 2}Se, Ag{sub 3}Te{sub 2}, Ag{sub 1.9}Te, AgCuSe, Sm{sub 3}Se{sub 4}, Sm{sub 2}Se{sub 3}, and SmTe were synthesized by a mechanical alloying method, using a high-energy planetary ball mill. The compounds were obtained by milling mixtures of the elements with desired ratios in agate or Cu-Be vials for 60--180 min.

  6. Oriented growth of thin films of samarium oxide by MOCVD

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Thin films of Sm2O3 have been grown on Si(100) and fused quartz by low-pressure chemical va- pour deposition using an adducted β-diketonate precursor. The films on quartz are cubic, with no preferred orientation at lower growth temperatures (~ 550°C), while they grow with a strong (111) orientation as the.

  7. 150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

    Science.gov (United States)

    1978-12-01

    considerable hand labor. Addition of a provision for suitable electrical connection by the SCR manufacturer wou;d be desirable for production runs. Predicted...licen- sing the holder or any other person or corporation, or conveying any rights or permission to manufacture , use, or sell any patented invent,’n...tesile strength to contain the magnets and pole pieces up through the overspeed rating of the rotor. The cho.;en process uses maraging steel as the

  8. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Glasses with the composition, (Sm2O3)(ZnO)(40–)(TeO2)(60), were prepared by conventional melt quenching method. The density, molar volume, and optical energy band gap of these glasses have been measured. The refractive index, molar refraction and polarizability of oxide ion have been calculated by using ...

  9. Nuclear deformation and the two-neutrino double- {beta} decay in {sup 124,126}Xe, {sup 128,130}Te, {sup 130,132}Ba and {sup 150}Nd isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Singh, S.; Chandra, R.; Rath, P.K. [University of Lucknow, Department of Physics, Lucknow (India); Raina, P.K. [IIT, Department of Physics and Meteorology, Kharagpur (India); Hirsch, J.G. [Universidad Nacional Autonoma de Mexico, Instituto de Ciencias Nucleares, A.P. 70-543, Mexico (Mexico)

    2007-09-15

    The two-neutrino double-beta decay of {sup 124,126}Xe, {sup 128,} {sup 130}Te,{sup 130,132}Ba and {sup 150}Nd isotopes is studied in the Projected Hartree-Fock-Bogoliubov (PHFB) model. Theoretical 2 {nu} {beta}{sup -}{beta}{sup -} half-lives of {sup 128,130}Te, and {sup 150}Nd isotopes, and 2{nu}{beta}{sup +}{beta}{sup +}, 2 {nu} {beta}{sup +}EC and 2{nu}ECEC for {sup 124,126}Xe and {sup 130,132}Ba nuclei are presented. Calculated quadrupolar transition probabilities B(E2:0{sup +}{yields}2{sup +}), static quadrupole moments and g-factors in the parent and daughter nuclei reproduce the experimental information, validating the reliability of the model wave functions. The anticorrelation between nuclear deformation and the nuclear transition matrix element M{sub 2{nu}} is confirmed. (orig.)

  10. Identification of opsA, a Gene Involved in Solute Stress Mitigation and Survival in Soil, in the Polycyclic Aromatic Hydrocarbon-Degrading Bacterium Novosphingobium sp. Strain LH128

    Science.gov (United States)

    Fida, Tekle Tafese; Breugelmans, Philip; Lavigne, Rob; van der Meer, Jan Roelof; De Mot, René; Vaysse, Pierre-Joseph

    2014-01-01

    The aim of this study was to identify genes involved in solute and matric stress mitigation in the polycyclic aromatic hydrocarbon (PAH)-degrading Novosphingobium sp. strain LH128. The genes were identified using plasposon mutagenesis and by selection of mutants that showed impaired growth in a medium containing 450 mM NaCl as a solute stress or 10% (wt/vol) polyethylene glycol (PEG) 6000 as a matric stress. Eleven and 14 mutants showed growth impairment when exposed to solute and matric stresses, respectively. The disrupted sequences were mapped on a draft genome sequence of strain LH128, and the corresponding gene functions were predicted. None of them were shared between solute and matric stress-impacted mutants. One NaCl-affected mutant (i.e., NA7E1) with a disruption in a gene encoding a putative outer membrane protein (OpsA) was susceptible to lower NaCl concentrations than the other mutants. The growth of NA7E1 was impacted by other ions and nonionic solutes and by sodium dodecyl sulfate (SDS), suggesting that opsA is involved in osmotic stress mitigation and/or outer membrane stability in strain LH128. NA7E1 was also the only mutant that showed reduced growth and less-efficient phenanthrene degradation in soil compared to the wild type. Moreover, the survival of NA7E1 in soil decreased significantly when the moisture content was decreased but was unaffected when soluble solutes from sandy soil were removed by washing. opsA appears to be important for the survival of strain LH128 in soil, especially in the case of reduced moisture content, probably by mitigating the effects of solute stress and retaining membrane stability. PMID:24657861

  11. Restricting 32-128 km horizontal scales hardly affects the MJO in the Superparameterized Community Atmosphere Model v.3.0 but the number of cloud-resolving grid columns constrains vertical mixing

    Science.gov (United States)

    Pritchard, Michael S.; Bretherton, Christopher S.; DeMott, Charlotte A.

    2014-09-01

    The effects of artificially restricting the 32-128 km horizontal scale regime on MJO dynamics in the Superparameterized Community Atmosphere Model v.3.0 have been explored through reducing the extent of its embedded cloud resolving model (CRM) arrays. Two and four-fold reductions in CRM extent (from 128 to 64 km and 32 km) produce statistical composite MJO signatures with spatial scale, zonal phase speed, and intrinsic wind-convection anomaly structure that are all remarkably similar to the standard SPCAM's MJO. This suggests that the physics of mesoscale convective organization on 32-128 km scales are not critical to MJO dynamics in SPCAM and that reducing CRM extent may be a viable strategy for 400% more computationally efficient analysis of superparameterized MJO dynamics. However several unexpected basic state responses caution that extreme CRM domain reduction can lead to systematic mean state issues in superparameterized models. We hypothesize that an artificial limit on the efficiency of vertical updraft mixing is set by the number of grid columns available for compensating subsidence in the embedded CRM arrays. This can lead to reduced moisture ventilation supporting too much liquid cloud and thus an overly strong cloud shortwave radiative forcing, particularly in regions of deep convection.

  12. Step-and-shoot prospectively ECG-gated versus retrospectively ECG-gated with tube current modulation coronary CT angiography using the 128-slice MDCT: comparison of image quality and radiation dose

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Dong Wook (Dept. of Family Medicine, Medial Research Institute, Pusan National Univ. Yangsan Hospital, School of Medicine, Gyeongsangnam-do, (Korea, Republic of)); Choo, Ki Seok; Baik, Seung Kug; Kim, Yong Woo; Jeon, Ung Bae (Dept. of Radiology, Medial Research Institute, Pusan National Univ. Yangsan Hospital, School of Medicine, Gyeongsangnam-do, (Korea, Republic of)), email: kschoo0618@naver.com; Kim, Jeong Soo (Dept. of Cardiology, Medial Research Institute, Pusan National Univ. Yangsan Hospital, School of Medicine, Gyeongsangnam-do (Korea, Republic of)); Lim, Soo Jin (Dept. of Cardiology, Kim Hae Joongang Hospital, Gyeongsangnam-do (Korea, Republic of))

    2011-02-15

    Background: Little is known regarding image quality and the required radiation dose for step-and-shoot and retrospective coronary computed tomography angiography (CCTA) with tube current modulation (TCM) in 128-slice multidetector CT (MDCT) coronary angiography. Purpose: To compare image quality and radiation dose in patients who underwent 128-slice MDCT by the step-and- shoot method with those in patients who underwent 128-slice MDCT with retrospective CCTA with TCM. Material and Methods: CCTA obtained with 128-slice MDCT was retrospectively evaluated in 160 patients. Two independent reviewers separately scored the subjective image quality of the coronary artery segments (1, excellent; 4, poor) for step-and-shoot (68, mean heart rate [HR]: 59.3+-6.8) and retrospective CCTA with TCM (77, mean HR: 59.1+-9.8). Interobserver variability was calculated. Effective radiation doses of both scan techniques were calculated with dose-length product. Results: There was good agreement for quality scores of coronary artery segment images between the independent reviewers (k=0.72). The number of coronary artery segments that could not be evaluated was 2.85% (27 of 947) in the step-and-shoot and 1.87% (20 of 1071) in retrospective CCTA with TCM. Image quality scores were not significantly different (P>.05). Mean patient radiation dose was 63% lower for step-and-shoot (1.94+-0.70 mSv) than for retrospective CCTA with TCM (4.51+-1.18 mSv) (P<0.0001). For patients who underwent step-and-shoot or retrospective CCTA with TCM, an average HR of 63.5 beats per minute was identified as the threshold for the prediction of non-diagnostic image quality for both protocols. There were no significant differences in the image quality of both methods between obese (body mass index [BMI>=25) and non-obese patients (BMI<25), but radiation doses were higher in the obesity group than in the non-obesity group for both methods. Conclusion: Both step-and-shoot and retrospective CCTA with TCM using 128

  13. Accuracy, image quality and radiation dose comparison of high-pitch spiral and sequential acquisition on 128-slice dual-source CT angiography in children with congenital heart disease

    Energy Technology Data Exchange (ETDEWEB)

    Nie, Pei; Wang, Ximing; Cheng, Zhaoping; Ji, Xiaopeng; Duan, Yanhua [Shandong University, Shandong Provincial Key Laboratory of Diagnosis and Treatment of Cardio-cerebral Vascular Diseases, Shandong Medical Imaging Research Institute, Jinan, Shandong (China); Chen, Jiuhong [CT Research Collaboration, Siemens Ltd. China, Beijing (China)

    2012-10-15

    To compare accuracy, image quality and radiation dose between high-pitch spiral and sequential modes on 128-slice dual-source computed tomographic (DSCT) angiography in children with congenital heart disease (CHD). Forty patients suspected with CHD underwent 128-slice DSCT angiography with high-pitch mode and sequential mode respectively. All the anomalies were confirmed by the surgical and/or the conventional cardiac angiography (CCA) findings. The diagnostic accuracy, the subjective and objective image quality and effective radiation doses were compared. There was no significant difference in diagnostic accuracy ({chi}{sup 2} = 0.963, P > 0.05), the objective parameters for image quality (P > 0.05) and the image quality of great vessels (u = 167.500, P > 0.05) between the two groups. The image quality of intracardiac structures and coronary arteries was significantly better in the sequential mode group than that in the high-pitch group (u = 112.500 and 100.000, P < 0.05). The mean effective dose in high-pitch group (0.17 {+-} 0.05 mSv) was significantly lower (t = 5.287, P < 0.05) than that in the sequential mode group (0.29 {+-} 0.09 mSv). Both the high-pitch and the sequential modes for 128-slice DSCT angiography provide high accuracy for the assessment of CHD in children, while the high-pitch mode, even with some image quality decrease, further significantly lowers the radiation dose. (orig.)

  14. Paleomagnetism of Basaltic Lava Flows in Coreholes ICPP 213, ICPP-214, ICPP-215, and USGS 128 Near the Vadose Zone Research Park, Idaho Nuclear Technology and Engineering Center, Idaho National Engineering and Environmental Laboratory, Idaho

    Science.gov (United States)

    Champion, Duane E.; Herman, Theodore C.

    2003-01-01

    A paleomagnetic study was conducted on basalt from 41 lava flows represented in about 2,300 ft of core from coreholes ICPP-213, ICPP-214, ICPP-215, and USGS 128. These wells are in the area of the Idaho Nuclear Technology and Engineering Center (INTEC) Vadose Zone Research Park within the Idaho National Engineering and Environmental Laboratory (INEEL). Paleomagnetic measurements were made on 508 samples from the four coreholes, which are compared to each other, and to surface outcrop paleomagnetic data. In general, subhorizontal lines of correlation exist between sediment layers and between basalt layers in the area of the new percolation ponds. Some of the basalt flows and flow sequences are strongly correlative at different depth intervals and represent important stratigraphic unifying elements. Some units pinch out, or thicken or thin even over short separation distances of about 1,500 ft. A more distant correlation of more than 1 mile to corehole USGS 128 is possible for several of the basalt flows, but at greater depth. This is probably due to the broad subsidence of the eastern Snake River Plain centered along its topographic axis located to the south of INEEL. This study shows this most clearly in the oldest portions of the cored sections that have differentially subsided the greatest amount.

  15. Accuracy, image quality and radiation dose comparison of high-pitch spiral and sequential acquisition on 128-slice dual-source CT angiography in children with congenital heart disease.

    Science.gov (United States)

    Nie, Pei; Wang, Ximing; Cheng, Zhaoping; Ji, Xiaopeng; Duan, Yanhua; Chen, Jiuhong

    2012-10-01

    To compare accuracy, image quality and radiation dose between high-pitch spiral and sequential modes on 128-slice dual-source computed tomographic (DSCT) angiography in children with congenital heart disease (CHD). Forty patients suspected with CHD underwent 128-slice DSCT angiography with high-pitch mode and sequential mode respectively. All the anomalies were confirmed by the surgical and/or the conventional cardiac angiography (CCA) findings. The diagnostic accuracy, the subjective and objective image quality and effective radiation doses were compared. There was no significant difference in diagnostic accuracy (χ ( 2 ) = 0.963, P > 0.05), the objective parameters for image quality (P > 0.05) and the image quality of great vessels (u = 167.500, P > 0.05) between the two groups. The image quality of intracardiac structures and coronary arteries was significantly better in the sequential mode group than that in the high-pitch group (u = 112.500 and 100.000, P < 0.05). The mean effective dose in high-pitch group (0.17 ± 0.05 mSv) was significantly lower (t = 5.287, P < 0.05) than that in the sequential mode group (0.29 ± 0.09 mSv). Both the high-pitch and the sequential modes for 128-slice DSCT angiography provide high accuracy for the assessment of CHD in children, while the high-pitch mode, even with some image quality decrease, further significantly lowers the radiation dose. • Modern CT provides excellent anatomical detail of congenital heart disease. • Dual source CT systems offer high-pitch spiral and sequential modes. • The high-pitch mode provides high accuracy for the assessment of CHD. • A few images using the high-pitch mode were occasionally slightly degraded. • But the high-pitch mode significantly lowers the radiation dose.

  16. 800Gb/s (8x128Gb/s) unrepeatered transmission over 515-km large-area ultra-low-loss fiber using 2nd-order Raman pumping.

    Science.gov (United States)

    Zhu, B; Borel, P I; Geisler, T; Jensen, R; Leng, L; Jiang, X; Peckham, D W; Lingle, R L; Vaidya, D; Yan, M F; Wisk, P W; DiGiovanni, D J

    2016-10-31

    We demonstrate unrepeatered transmission of 8x128Gb/s PDM-QPSK signals over a 515k-m fiber link. This ultra-long distance of 800 Gb/s unrepeatered transmission in a single fiber configuration is achieved by employing enabling techniques such as large-effective-area ultra-low-attenuation fibers, co-propagating and counter-propagating 2nd-order-pumped distributed Raman amplification, and remote optically pumped amplifier (ROPA). The ROPA itself is also counter-propagating 2nd-order Raman pumped. The designs and characteristics of the ROPA and 2nd-order pumped distributed Raman amplification are described, and optimization of the transmission performance of this ultra-long reach 800Gb/s unrepeatered transmission fiber link is discussed in this paper.

  17. Detection of ischaemic myocardial lesions with coronary CT angiography and adenosine-stress dynamic perfusion imaging using a 128-slice dual-source CT: diagnostic performance in comparison with cardiac MRI.

    Science.gov (United States)

    Kim, S M; Choi, J-H; Chang, S-A; Choe, Y H

    2013-12-01

    We assessed the diagnostic performance of adenosine-stress dynamic CT perfusion (ASDCTP) imaging and coronary CT angiography (CCTA) for the detection of ischaemic myocardial lesions using 128-slice dual-source CT compared with that of 1.5 T cardiac MRI. This prospective study included 33 patients (61±8 years, 82% male) with suspected coronary artery diseases who underwent ASDCTP imaging and adenosine-stress cardiac MRI. Two investigators independently evaluated ASDCTP images in correlation with significant coronary stenosis on CCTA using two different thresholds of 50% and 70% diameter stenosis. Hypoattenuated myocardial lesions on ASDCTP associated with significant coronary stenoses on CCTA were regarded as true perfusion defects. All estimates of diagnostic performance were calculated and compared with those of cardiac MRI. With use of a threshold of 50% diameter stenosis on CCTA, the diagnostic estimates per-myocardial segment were as follows: sensitivity, 81% [95% confidence interval (CI): 70-92%]; specificity, 94% (95% CI: 92-96%); and accuracy 93% (95% CI: 91-95%). With use of a threshold of 70%, the diagnostic estimates were as follows: sensitivity, 48% (95% CI: 34-62%); specificity, 99% (95% CI: 98-100%); and accuracy, 94% (95% CI: 92-96%). Dynamic CTP using 128-slice dual-source CT enables the assessment of the physiological significance of coronary artery lesions with high diagnostic accuracy in patients with clinically suspected coronary artery disease. Combined CCTA and ASDCTP yielded high accuracy in the detection of perfusion defects regardless of the threshold of significant coronary stenosis.

  18. Partnerships for technology introduction -- Putting the technologies of tomorrow into the marketplace of today. Report to Congress on Sections 127 and 128 of the Energy Policy Act of 1992

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-01

    This report to Congress was prepared on behalf of the Secretary of the US Department of Energy (DOE) in response to Sections 127 and 128 of the Energy Policy Act of 1992 (EPAct), Pub. L. 102-486. In preparing the report to the Congress, DOE has assessed the national and regional energy savings potential of products already on the market and those that will be available to consumers by the late 1990s. The Department has also examined the present cost-effectiveness of these emerging appliances as mature technologies. To help in its assessment, DOE organized eight workshops at which representatives from manufacturing and building industries, utilities, retailers and wholesalers, public interest groups and Federal and state government agencies could express their views. The information derived from these workshops was key to the formulation of the report`s general and specific recommendations. DOE has concluded that the Federal Government can effectively stimulate the market for emerging technologies by forming partnerships with the appliance industry and other interested parties promoting the use of highly efficient appliances. Based on the interaction with industry at the eight workshops and through direct contact, DOE has concluded that Federal action and technical assistance is not only desired by industry, but crucial to the expansion of these markets. Section 128 of EPAct requires an assessment of the energy savings and environmental benefits of replacing older, less efficient appliances with more efficient products than currently required by Federal law. Since early replacement of appliances is but one possible market-stimulating action, DOE has elected to include its discussion as part of the overall report to the Congress.

  19. Nail and skin lesions caused by scytalidium dimidiatum in Medellín (Colombia, 1990-1999: report of 128 cases and review of the name of the agent Lesiones ungueales y cutáneas por Scytalidium dimidiatum en Medellín (Colombia, 1990-1999. Presentación de 128 casos y revisión del problema del nombre del agente

    Directory of Open Access Journals (Sweden)

    Jaime Carmona Fonseca

    2000-03-01

    Full Text Available Aim: To review the problem of the name of the agent, and to report epidemiologic features of 128 cases of nail and skin lesions caused by S.dimidiatum. Design: Descriptive study, partly retrospective (1990-1996 and partly prospective (1997-1999. Reference frame: Until recently there were problems with the nomenclature of the agent but now there exist arguments for solving the difficulties, and that was the first objective of our work: to present such arguments and to indicate the correct use of the different names. On the other hand, the importance of S. dimidiatum as agent of human lesions is increasing. This report is restricted to nail and skin lesions, of which we found 128 cases between 1990 and 1999. Methods: Laboratory records were reviewed and doubts were solved by means of consensus criteria. Mycological diagnostic criteria were established. Statistical analysis was performed with the Epi Info program, version 6.04; it consisted mainly of evaluating the association of variables with chi2 and in comparing positions of continuous and organized data according to their magnitude by means of the Kruskal-Wallis H test. Results: The different names of the agent should be used in precise situations, that are described. A total of 128 specimens was studied from which S. dimidiatum had been isolated in culture: 102 were from nails (92% from the feet and 26 from the skin (73% interdigital from feet. Epidemiologic features of a typical case of nail lesion due to S. dimidiatum indicate that in 41% the patients was an woman, 21-49 year-old, who uses “risk” shoes, presents hyperhydrosis and practices a sport. On the other hand typical epidemiologic features of a skin lesion due to S. dimidiatum are similar to these the only difference being the predominance of males (69%. Direct examination was positive in 97% of the cases and the most frequently found structures were threadlike hyphae charateristic of dermatophytes (72%, followed by sinous fungal

  20. 128 COLONIALISM: NEXUS FOR MYRIAD RELIGIOUS ...

    African Journals Online (AJOL)

    In this regard, Mercado writers that,. The missionary version of Christianity accepted by Africans (under colonial rule) can be described as hypocritical because many African Christians still patronizes ATR, especially, in times of emergency. This means that the influence of ATR is still strong especially in moment of crisis.

  1. Experiment information: 128 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available of AIDS in HIV-1-infected individuals, and the CCR5 or CXCR4, which are used by HIV to gain entry into cell...s. This result may explain why AIDS takes longer to develop in HIV-1-infected individuals carrying the CCR2V64I mutation. 10466720

  2. Fungal Planet description sheets: 128–153

    NARCIS (Netherlands)

    Crous, P.W.; Shivas, R.G.; Wingfield, M.J.; Summerell, B.A.; Rossman, A.Y.; Alves, J.L.; Adams, G.C.; Barreto, R.W.; Bell, A.; Coutinho, M.L.; Flory, S.L.; Gates, G.K.R.; Hardy, G.E.St.J.; Kleczewski, N.M.; Lombard, L.; Longa, C.M.O.; Louis-Seize, G.; Macedo, F.; Mahoney, D.P.; Maresi, G.; Martin-Sanchez, P.M.; Marvanova, L.; Minnis, A.M.; Morgado, L.N.; Noordeloos, M.E.; Phillips, A.J.L.; Quaedvlieg, W.; Ryan, P.G.; Saiz-Jimenez, C.; Seifert, K.A.; Swart, W.J.; Tan, Y.P.; Tanney, J.B.; Thu, P.Q.; Videira, S.I.R.; Walker, D.M.; Groenewald, J.Z.

    2012-01-01

    Novel species of microfungi described in the present study include the following from Australia: Catenulostroma corymbiae from Corymbia, Devriesia stirlingiae from Stirlingia, Penidiella carpentariae from Carpentaria, Phaeococcomyces eucalypti from Eucalyptus, Phialophora livistonae from Livistona,

  3. Publications | Page 128 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  4. Fungal Planet description sheets: 128–153

    OpenAIRE

    Crous, Pedro; Decock, Cony

    2012-01-01

    Novel species of fungi described in the present study include the following from South Africa: Alanphillipsia aloeicola from Aloe sp., Arxiella dolichandrae from Dolichandra unguiscati, Ganoderma austroafricanum from Jacaranda mimosifolia, Phacidiella podocarpi and Phaeosphaeria podocarpi from Podocarpus latifolius, Phyllosticta mimusopisicola from Mimusops zeyheri and Sphaerulina pelargonii from Pelargonium sp. Furthermore, Barssia maroccana is described from Cedrus atlantica (Morocco), Codi...

  5. Systems Office Organization. SPEC Kit 128.

    Science.gov (United States)

    Miller, R. Bruce

    Based on responses solicited from 26 Association of Research Library (ARL) members reflecting a variety of systems office configurations, this report describes the configurations at several ARL institutions and presents some major organizational patterns for systems offices and their relationship to the larger library organization. Original…

  6. 40 CFR 86.128-79 - Transmissions.

    Science.gov (United States)

    2010-07-01

    ... accelerator pedal movement to maintain the desired speed. (e) Accelerations shall be driven smoothly following... pedal during each shift and accomplish the shift with minimum time. If the vehicle cannot accelerate at the specified rate, the vehicle shall be operated at maximum available power until the vehicle speed...

  7. 78 FR 128 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-01-02

    ... procedures, the firm's business activities for consistency with its risk management guidelines. The staff... establish, document, and maintain a system of internal risk management controls. The Rule sets forth the..., documenting, and reviewing its internal risk management control system, which are designed to, among other...

  8. Fungal Planet description sheets: 128–153

    OpenAIRE

    Crous, P.W.; Shivas, R.G.; Wingfield, M.J.; Summerell, B.A.; Rossman, A.Y.; Alves, J. L.; Adams, G.C.; Barreto, R.W; Bell, A.; COUTINHO, M. L.; Flory, S.L.; Gates, G.K.R.; Hardy, G.E.St.J.; Kleczewski, N.M.; Lombard, L.

    2012-01-01

    Novel species of microfungi described in the present study include the following from Australia: Catenulostroma corymbiae from Corymbia, Devriesia stirlingiae from Stirlingia, Penidiella carpentariae from Carpentaria, Phaeococcomyces eucalypti from Eucalyptus, Phialophora livistonae from Livistona, Phyllosticta aristolochiicola from Aristolochia, Clitopilus austroprunulus on sclerophyll forest litter of Eucalyptus regnans and Toxicocladosporium posoqueriae from Posoqueria. Several species are...

  9. Fungal Planet description sheets: 128-153.

    Science.gov (United States)

    Crous, P W; Shivas, R G; Wingfield, M J; Summerell, B A; Rossman, A Y; Alves, J L; Adams, G C; Barreto, R W; Bell, A; Coutinho, M L; Flory, S L; Gates, G; Grice, K R; Hardy, G E St J; Kleczewski, N M; Lombard, L; Longa, C M O; Louis-Seize, G; Macedo, F; Mahoney, D P; Maresi, G; Martin-Sanchez, P M; Marvanová, L; Minnis, A M; Morgado, L N; Noordeloos, M E; Phillips, A J L; Quaedvlieg, W; Ryan, P G; Saiz-Jimenez, C; Seifert, K A; Swart, W J; Tan, Y P; Tanney, J B; Thu, P Q; Videira, S I R; Walker, D M; Groenewald, J Z

    2012-12-01

    Novel species of microfungi described in the present study include the following from Australia: Catenulostroma corymbiae from Corymbia, Devriesia stirlingiae from Stirlingia, Penidiella carpentariae from Carpentaria, Phaeococcomyces eucalypti from Eucalyptus, Phialophora livistonae from Livistona, Phyllosticta aristolochiicola from Aristolochia, Clitopilus austroprunulus on sclerophyll forest litter of Eucalyptus regnans and Toxicocladosporium posoqueriae from Posoqueria. Several species are also described from South Africa, namely: Ceramothyrium podocarpi from Podocarpus, Cercospora chrysanthemoides from Chrysanthemoides, Devriesia shakazului from Aloe, Penidiella drakensbergensis from Protea, Strelitziana cliviae from Clivia and Zasmidium syzygii from Syzygium. Other species include Bipolaris microstegii from Microstegium and Synchaetomella acerina from Acer (USA), Brunneiapiospora austropalmicola from Rhopalostylis (New Zealand), Calonectria pentaseptata from Eucalyptus and Macadamia (Vietnam), Ceramothyrium melastoma from Melastoma (Indonesia), Collembolispora aristata from stream foam (Czech Republic), Devriesia imbrexigena from glazed decorative tiles (Portugal), Microcyclospora rhoicola from Rhus (Canada), Seiridium phylicae from Phylica (Tristan de Cunha, Inaccessible Island), Passalora lobeliae-fistulosis from Lobelia (Brazil) and Zymoseptoria verkleyi from Poa (The Netherlands). Valsalnicola represents a new ascomycete genus from Alnus (Austria) and Parapenidiella a new hyphomycete genus from Eucalyptus (Australia). Morphological and culture characteristics along with ITS DNA barcodes are also provided.

  10. Publications | Page 128 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    However, changes in climate, socio-economic factors, and ecological contexts contribute to changing risks of infections. From initial findings of a study in South East Asian (SEA) centres... Experts point to poor sanitation, lack of awareness as main causes for spread of parasitic diseases : news release (restricted access).

  11. 31 CFR 128.12 - Periodic reports.

    Science.gov (United States)

    2010-07-01

    ... liabilities positions with foreigners held for their own account and for the accounts of their customers. (2... specified claims and liabilities positions with unaffiliated foreigners. (b) Transactions in certain...

  12. Calculations ofB1Distribution, Specific Energy Absorption Rate, and Intrinsic Signal-to-Noise Ratio for a Body-Size Birdcage Coil Loaded with Different Human Subjects at 64 and 128 MHz.

    Science.gov (United States)

    Liu, W; Collins, C M; Smith, M B

    2005-03-01

    A numerical model of a female body is developed to study the effects of different body types with different coil drive methods on radio-frequency magnetic ( B 1 ) field distribution, specific energy absorption rate (SAR), and intrinsic signal-to-noise ratio (ISNR) for a body-size birdcage coil at 64 and 128 MHz. The coil is loaded with either a larger, more muscular male body model (subject 1) or a newly developed female body model (subject 2), and driven with two-port (quadrature), four-port, or many (ideal) sources. Loading the coil with subject 1 results in significantly less homogeneous B 1 field, higher SAR, and lower ISNR than those for subject 2 at both frequencies. This dependence of MR performance and safety measures on body type indicates a need for a variety of numerical models representative of a diverse population for future calculations. The different drive methods result in similar B 1 field patterns, SAR, and ISNR in all cases.

  13. The crystal structure of a xyloglucan-specific endo-beta-1,4-glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate specificity.

    Science.gov (United States)

    Yaoi, Katsuro; Kondo, Hidemasa; Hiyoshi, Ayako; Noro, Natsuko; Sugimoto, Hiroshi; Tsuda, Sakae; Miyazaki, Kentaro

    2009-09-01

    Geotrichum sp. M128 possesses two xyloglucan-specific glycoside hydrolases belonging to family 74, xyloglucan-specific endo-beta-1,4-glucanase (XEG) and oligoxyloglucan reducing-end-specific cellobiohydrolase (OXG-RCBH). Despite their similar amino acid sequences (48% identity), their modes of action and substrate specificities are distinct. XEG catalyzes the hydrolysis of xyloglucan polysaccharides in endo mode, while OXG-RCBH acts on xyloglucan oligosaccharides at the reducing end in exo mode. Here, we determined the crystal structure of XEG at 2.5 A resolution, and compared it to a previously determined structure of OXG-RCBH. For the most part, the amino acid residues that interact with substrate are conserved between the two enzymes. However, there are notable differences at subsite positions -1 and +2. OXG-RCBH has a loop around the +2 site that blocks one end of the active site cleft, which accounts for its exo mode of action. In contrast, XEG lacks a corresponding loop at this site, thereby allowing binding to the middle of the main chain of the substrate. At the -1 site in OXG-RCBH, Asn488 interacts with the xylose side chain of the substrate, whereas the -1 site is occupied by Tyr457 in XEG. To confirm the contribution of this residue to substrate specificity, Tyr457 was substituted by Gly in XEG. The wild-type XEG cleaved the oligoxyloglucan at a specific site; the Y457G variant cleaved the same substrate, but at various sites. Together, the absence of a loop in the cleft and the presence of bulky Tyr457 determine the substrate specificity of XEG.

  14. Hair analysis by liquid chromatography-tandem mass spectrometry in toxicological investigation of drug-facilitated crimes: report of 128 cases over the period June 2003-May 2004 in metropolitan Paris.

    Science.gov (United States)

    Chèze, Marjorie; Duffort, Gaëlle; Deveaux, Marc; Pépin, Gilbert

    2005-10-04

    In recent years, reports of drug-facilitated crimes (DFC) have been increasing. The drugs involved are sometimes difficult to detect, because of their low dosages and the long time ellapsed between alleged DFC and blood and urine sampling. In order to detect benzodiazepines and benzodiazepine-like hypnotics, we developed an approach for hair analysis by liquid chromatography-tandem mass spectrometry using a triple stage quadrupole with an electrospray ionization (LC-ESI-MS/MS). Separation was performed on an Uptisphere ODB C18 column using a gradient of 2mM formate buffer and acetonitrile. For the 23 compounds studied, detection limits are lower than 2 pg/mg, but a specific extraction procedure is needed for 7-amino metabolites. Over a 1-year period within the city limits of Paris and three suburbs, we tested blood and urine from victims of sexual assaults, robbery and battery in which psychoactive substances were suspected of being involved. Hair was collected 4-8 weeks after the alleged DFC. Over the 128 cases studied, results of simultaneous analysis of blood, urine, and hair allowed us to conclude that 23 cases were real DFC. In 18 cases, no conclusion was possible since no hair was sampled and/or results were negative. In 56 cases, victims were previously using narcotics, cannabis, and/or a prescribed drug, according to the compounds detected in hair strands. Thirty-one cases were not DFC cases. This study indicates that the prevalence of zolpidem and clonazepam is high, followed by bromazepam, nordazepam, and midazolam. Others benzodiazepines and analogs are rare. LC-ESI-MS/MS is a good tool for toxicological investigations of DFC. Testing blood, urine, and hair by this technique may reveal drug presence, even if it was administered at a single therapeutic dose. That may be helpful to prosecute perpretators or to exclude a drug-facilitated crime.

  15. Adenosine-stress dynamic myocardial perfusion imaging using 128-slice dual-source CT in patients with normal body mass indices: effect of tube voltage, tube current, and iodine concentration on image quality and radiation dose.

    Science.gov (United States)

    Kim, Sung Mok; Cho, Young Kwon; Choe, Yeon Hyeon

    2014-12-01

    The aim of this study was to evaluate the image quality and radiation dose in adenosine-stress dynamic myocardial CT perfusion (CTP) imaging using different tube voltages, tube current settings, and contrast materials containing different iodine concentrations in subjects with normal body mass indices (BMI). We included 92 patients (BMI range, 18.5-24.8) who underwent dynamic CTP for the evaluation of coronary artery disease using a 128-slice dual-source computed tomography. The protocols employed the following dynamic scan parameters: protocol I with 100 kV, fixed tube current (FTC), and medium-concentration contrast material (MC, 350 mg iodine/mL); protocol II with 100 kV, automatic tube current modulation (ATCM), and MC; protocol III with 100 kV, ATCM, and high-concentration contrast material (HC, 400 mg iodine/mL); protocol IV with 80 kV, adopted FTC, and HC. Subjective image quality on a 1-3 point scale and objective image quality with respect to the contrast-to-noise ratio (CNR) and signal-to-noise ratio (SNR) were assessed. Protocol IV showed higher CNR and SNR than the other protocols (P < 0.01), while the CNR and SNR values did not significantly differ among the other three protocols. There was no significant difference in subjective image quality among the protocols. The radiation dose in protocol IV was the lowest among the protocols (P < 0.01), while protocol IV resulted in a 54% overall reduction in mean effective radiation dose compared with protocol I. Dynamic myocardial CTP performed at 80 kV with adapted FTC provided high CNR and SNR while preserving subjective image quality and reducing radiation exposure.

  16. Calendar Year 2007 Resource Conservation and Recovery Act Annual Monitoring Report for the U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee - RCRA Post-Closure Permit Nos. TNHW-113, TNHW-116, and TNHW-128

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental

    2008-02-01

    This report contains groundwater quality monitoring data obtained during calendar year (CY) 2007 at the following hazardous waste treatment, storage, and disposal (TSD) units located at the US Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) in Oak Ridge, Tennessee; this S-3 Site, Oil Landfarm, Bear Creek Burial Grounds/Walk-In Pits (BCBG/WIP), Eastern S-3 Site Plume, Chestnut Ridge Security Pits (CRSP), Chestnut Ridge Sediment Disposal Baste (CRSDB), few Hollow Quarry (KHQ), and East Chestnut Ridge Waste Pile (ECRWP). Hit monitoring data were obtained in accordance with the applicable Resource Conservation and Recovery Act of 1976 (RCRA) hazardous waste post-closure permit (PCP). The Tennessee Department of Environment and Conservation (TDEC) - Division of Solid Waste Management issued the PCPs to define the requirements for RCRA post-closure inspection, maintenance, and groundwater monitoring at the specified TSD units located within the Bear Creek Hydrogeologic Regime (PCP no. TNHW-116), Upper East Fork Poplar Creek Hydrogeologic Regime (PCP no. TNHW-113), and Chestnut Ridge Hydrogeologic Regime (PCP no. TNHW-128). Each PCP requires the Submittal of an annual RCRA groundwater monitoring report containing the groundwater sampling information and analytical results obtained at each applicable TSD unit during the preceding CY, along with an evaluation of groundwater low rates and directions and the analytical results for specified RCRA groundwater target compounds; this report is the RCRA annual groundwater monitoring report for CY 2007. The RCRA post-closure groundwater monitoring requirements specified in the above-referenced PCP for the Chestnut Ridge Regime replace those defined in the previous PCP (permit no. TNHW-088), which expired on September 18, 2005, but remained effective until the TDEC issued the new PCP in September 2006. The new PCP defines site-specific groundwater sampling and analysis requirements for the

  17. Brandaris 128: A digital 25 million frames per second camera with 128 highly sensitive frames

    NARCIS (Netherlands)

    Chin, Chien Ting; Lancée, Charles; Borsboom, Jerome; Mastik, Frits; Frijlink, Martijn E.; de Jong, N.; Versluis, Michel; Lohse, Detlef

    2003-01-01

    A high-speed camera that combines a customized rotating mirror camera frame with charge coupled device (CCD) image detectors and is practically fully operated by computer control was constructed. High sensitivity CCDs are used so that image intensifiers, which would degrade image quality, are not

  18. Brandaris 128: a rotating-mirror digital camera with 128 frames at 25 Mfps

    NARCIS (Netherlands)

    de Jong, N.; Chin, Chien Ting; Lancée, Charles; Borsboom, Jerome; Mastik, Frits; Versluis, Michel; Lohse, Detlef; Parker, Vance; Cavailler, Claude; Haddleton, Graham P.; Hugenschmidt, Manfred

    2003-01-01

    For studying microbubbles in a medical ultrasound field (ultrasound frequency between 0.5 and 5 MHz) ultra high-speed imaging camera is required. The ultrasound typically lasts 3 - 20 cycles during which the response of the microbubbles can be highly non-linear. The frame rate of such a high-speed

  19. Contribution to the study of samarium-151 excited levels; Contribution a l'etude des niveaux excites du samarium-151

    Energy Technology Data Exchange (ETDEWEB)

    Locard, P. [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

    1967-07-01

    The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces transitions, nous avons donc entrepris des experiences de coincidences gamma-gamma (et de ''spectre de somme'') a l'aide d'un ensemble de spectrometrie a scintillation realise au laboratoire (chapitre 2). L'etude des intensites de ces coincidences (chapitre 3) nous amene a modifier le dernier schema propose: nous supprimons les niveaux a 405,5 et 650 keV, nous ajoutons des niveaux a 245,6 - 306,6 - 522 - 952 et 962 keV. Nous avons egalement verifie la multipolarite des principales transitions et mesure la duree de vie de certains des niveaux (chapitre 3) (nous trouvons une periode de 1,1 {+-} 0,5) nanoseconde pour le niveau a 167,7 keV). Le chapitre 4 est enfin consacre a la comparaison de nos resultats avec les predictions des differents modeles decrits au chapitre 1. (auteur)

  20. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    Administrator

    Key Laboratory for Special Functional Aggregate Materials of Education Ministry,. School of Chemistry and Chemical ... been flourishing since its excellent electric properties were discovered in the 1980s.1 At present SDC is ... absolute ethanol three times and dried in an electric oven at 60°C overnight, and then calcined at ...

  1. Trichloridotris{N-[phenyl(pyridin-2-ylmethylidene]hydroxylamine-κ2N,N′}samarium(III

    Directory of Open Access Journals (Sweden)

    Yahong Li

    2012-03-01

    Full Text Available The SmIII ion in the title compound, [SmCl3(C12H10N2O3], shows a coordination number of nine with a slightly distorted tricapped trigonal prismatic geometry based on a Cl3N6 donor set. The molecular structure is stabilized by three intramolecular O—H...Cl hydrogen bonds.

  2. Biological studies of samarium-153 bleomycin complex in human breast cancer murine xenografts for therapeutic applications

    Energy Technology Data Exchange (ETDEWEB)

    Bahrami-Samani, A. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Ghannadi-Maragheh, M. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran); Jalilian, A.R.; Mazidi, M. [Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran)

    2010-07-01

    In this work, a potential therapeutic DNA targeting agent, {sup 153}Sm-bleomycin complex ({sup 153}Sm-BLM), was developed and the tumor accumulation studies were performed using single photon emission computed tomography (SPECT) and scarification studies. {sup 153}Sm-BLM was prepared at optimized conditions (room temperature, 4-8 h, 0.1 mg bleomycin for 740-3700 MBq {sup 153}SmCl{sub 3}, radiochemical purity over 98%, HPLC, specific activity = 55 TBq/mmol). {sup 153}Sm-BLM was administered into human breast cancer murine xenografts and the biodistribution and imaging studies were performed up to 48 h. {sup 153}Sm-BLM demonstrated superior tumor accumulation properties in contrast with the other radiolabeled bleomycins with tumor:blood ratios of 41, 72 and 182 at 4, 24 and 48 h, respectively, and tumor:muscle ratios of 23, 33 and > 1490 at 4, 24 and 48 h, respectively, while administered intravenously. The SPECT images also demonstrated the obvious tumor uptake at the chest region of the breast-tumor bearing mice. These initial experiments demonstrate significant accumulation of {sup 153}Sm-BLM in tumor tissues. (orig.)

  3. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    CSIR Research Space (South Africa)

    Mandiwana, V

    2015-09-01

    Full Text Available .63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems...

  4. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    National Research Council Canada - National Science Library

    Gangu, Kranthi Kumar; Maddila, Suresh; Maddila, Surya Narayana; Jonnalagadda, Sreekantha B

    2016-01-01

    ...) and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp) were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine...

  5. Samarium(III) picrate tetraethylene glycol complex: Photoluminescence study and active material in monolayer electroluminescent

    Energy Technology Data Exchange (ETDEWEB)

    Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I. [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Za' aba, Noor K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)

    2011-09-15

    A mononuclear Sm(III) complex involving Pic and EO4 (where Pic=picrate anion and EO4=tetraethylene glycol) has been studied. It shows a bright-orange emission when used as active material in a monolayer electroluminescent device of ITO/EO4-Sm-Pic/Al. The crystal structure of the complex consists of [Sm(Pic){sub 2}(H{sub 2}O)(EO4)]{sup +} cation and [Pic]{sup -} anion. The Sm(III) ion is coordinated with nine oxygen atoms from one EO4 ligand in a pentadentate mode, two Pic anions each in bidentate and monodentate modes, and one water molecule. Both the terminal alcohol groups of the acyclic EO4 ligand were involved in the O-H...O hydrogen bonding by infinite one-dimensional (1D) chain within a symmetry direction [0 1 0]. The photoluminescence (PL) spectrum of the thin film shows the typical spectral features of the Sm(III) ion ({sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} transitions). The root-mean-square (rms) of the roughness of thin film is 30.605 nm and indicates that the formation of the monolayer electroluminescent device is not uniform and retains a high crystallinity. Typical semiconductor current-voltage (I-V) property was also observed in this device with threshold and turn voltages of 2.8 and 6.2 V, respectively. The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex can be applied as a luminescent center in OLED for bright-orange emission. - Highlights: > The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in monolayer device structure of ITO/EO4-Sm-Pic/Al. > The photoluminescence spectrum of the crystalline and thin film shows a bright-orange emission. > The current-voltage property showed the turn on voltage of 6.2 V.

  6. Pulsed laser deposition and optical characterizations of the magnetic samarium orthoferrite

    Energy Technology Data Exchange (ETDEWEB)

    Berini, Bruno, E-mail: bruno.berini@uvsq.fr [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France); Mistrik, Jan [Institute of Applied Physics and Mathematics, Faculty of Chemical Technology, University of Pardubice, Studentska 84, 532 10 Pardubice (Czech Republic); Dumont, Yves; Popova, Elena; Fouchet, Arnaud; Scola, Joseph; Keller, Niels [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France)

    2012-01-01

    Pulsed Laser Deposition of magnetically ordered polycrystalline SmFeO{sub 3} films has been optimized onto SiO{sub 2} glass substrates as function of substrate temperature, oxygen pressure and pulsed laser fluency. Using a KrF excimer laser, crystallization temperature is found to be about 1048 K for a weak fluency of only 1.7 J cm{sup -2}. We show that this growth temperature can be reduced using higher fluency and that it is possible to obtain a film texturation along the c axis by reducing the oxygen pressure at given temperature and fluency. In a second part, we focus on the SmFeO{sub 3} optical constants determined by in situ ellipsometry using a stacking model and the Cauchy dispersion relation for SmFeO{sub 3} layer. We show a good correlation between the transmission and reflection calculated from these data and measured by ex situ spectrophotometry in the visible range.

  7. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    Directory of Open Access Journals (Sweden)

    Kranthi Kumar Gangu

    2016-09-01

    Full Text Available An investigation was conducted into the influence of the amino acids as organic modifiers in the facile synthesis of metal incorporated fluorapatites (FAp and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine. The materials were characterized by various techniques including X-ray diffraction (XRD, Fourier transform infra-red spectroscopy (FT-IR, field emission scanning electron microscopy (FE-SEM, energy-dispersive X-ray spectroscopy (EDX, high resolution transmission electron microscopy (HR-TEM, N2-adsorption/desorption isotherm, temperature programmed desorption (TPD and fluorescence spectrophotometry. Under similar conditions, Sm-FAp prepared using different amino acids exhibited distinctly different morphological structures, surface area and pore properties. Their activity as catalysts was assessed and Sm-FAp/Glycine displayed excellent efficiency in the synthesis of 1,2,4-triazole catalyzing the reaction between 2-nitrobenzaldehyde and thiosemicarbazide with exceptional selectivity and 98% yield in a short time interval (10 min. The study provides an insight into the role of organic modifiers as controllers of nucleation, growth and aggregation which significantly influence the nature and activity of the catalytic sites on Sm-FAp. Sm-FAp could also have potential as photoactive material.

  8. Body composition analysis by DEXA by using dynamically changing samarium filtration

    DEFF Research Database (Denmark)

    Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

    1997-01-01

    , which depends on the current-absorber thickness. With this system we found a good agreement (r = 0.99) between reference and measured amounts of tissue or fat percentages in a plastic phantom and in smaller (approximately 0.5-4 kg) and larger (approximately 5-20 kg) piles of tissue (ox muscle and lard......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

  9. Synthesis, thermal and photoluminescent properties of ZnSe- based oxyfluoride glasses doped with samarium

    Science.gov (United States)

    Kostova, I.; Okada, G.; Pashova, T.; Tonchev, D.; Kasap, S.

    2014-12-01

    Rare earth (RE) doped glasses and glass ceramic materials have recently received considerable attention because of their potential or realized applications as X-ray intensifying screens, phosphors, detectors, waveguides, lasers etc. [1]. In this work, we present a new RE doped ZnO-ZnSe-SrF2-P2O5-B2O3-Sm2O3-SmF3 (ZSPB) glass system synthesized by melt quenching technique. The resulting glasses were visually fully transparent and stable with glass the transition temperatures around 530°C. The thermal properties of this glass system were characterized by Modulated Differential Scanning Calorimetry (MDSC) measurements before and after annealing at 650°C. We have characterized these glasses by Raman spectroscopy and photoluminescence (PL) measurements over the UV-VIS range using light emitting diodes (LED) and laser diodes (LD) excitation sources. We have also irradiated thermally treated and non-treated glass samples by X-rays and have studied the resulting PL. We discuss the results in terms of previously reported models for Sm-doped Zn-borophosphate oxide, oxyfluoride and oxyselenide glasses.

  10. Laser-Induced Luminescence Study of Samarium(III) Thiodiglycolate Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Dong Yong; Lee, Eil Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kimura, Takaumi [Japan Atomic Energy Research Institute, Ibaraki-ken (Japan)

    2003-09-15

    The hydration number of Sm(III) has been obtained by using the difference in the decay rate constants in H{sub 2}O and D{sub 2}O solutions. In general, k{sub obs}(H{sub 2}O) >> k{sub obs}(D{sub 2}O), k{sub obs}(D{sub 2}O) ≅ constant, and ligands are not as effective in causing non-radiative de-excitation of the excited state. For Sm(III), a relationship has been proposed in which the hydration number is related directly to the decay rate constant in H{sub 2}O. If there is no contribution from the ligand to the de-excitation of the luminescence excited state, the hydration of Sm(III) in the different complexes can be obtained directly from the values of k{sub obs} measured in H{sub 2}O. The number and the geometric distribution of solvent molecules around a metal ion in solution are an important factor in the structural and chemical behavior of cation. Indeed, such information has been utilized to design novel ionophores and receptors. However, there have been few studies of hydration structure for lanthanides. The fact that many f-element salts which have relatively large lattice energies are fairly soluble in water is a reflection of the strength of the interactions between the metal cations and water molecules.

  11. Oxygen Fugacity of the Martian Mantle from Pigeonite/Melt Partitioning of Samarium, Europium and Gadolinium

    Science.gov (United States)

    Musselwhite, S.; Jones, J. H.; Shearer, C.

    2004-01-01

    This study is part of an ongoing effort to calibrate the pyroxene/melt Eu oxybarometer for conditions relevant to the martian meteorites. There is fairly good agreement between a determinations using equilibria between Fe-Ti oxides and the estimates from Eu anomalies in shergottite augites in tenns of which meteorites are more or less oxidized. The Eu calibration was for angrite composition pyroxenes which are rather extreme. However, application of a calibration for martian composition augites 113 does not significantly reduce the discrepancy between the two methods. One possible reason for this discrepancy is that augites are non-liquidus. The use of pigeonite rather than augite as the oxy-barometer phase is considered. We have conducted experiments on martian composition pigeonite/melt REE partitioning as a function of fO2.

  12. Doping controlled spin reorientation in dysprosium-samarium orthoferrite single crystals

    Science.gov (United States)

    Cao, Shixun; Zhao, Weiyao; Kang, Baojuan; Zhang, Jincang; Ren, Wei

    2015-03-01

    As one of the most important phase transitions, spin reorientation (SR) in rare earth transition metal oxides draws much attention of emerging materials technologies. The origin of SR is the competition between different spin configurations which possess different free energy. We report the control of spin reorientation (SR) transition in perovskite rare earth orthoferrite Dy1-xSmxFeO3, a whole family of single crystals grown by optical floating zone method from x =0 to 1. Temperature dependence of the magnetizations under zero-field-cooling (ZFC) and field-cooling (FC) processes are studied. We have found a remarkable linear change of SR transition temperature in Sm-rich samples for x>0.2, which covers an extremely wide temperature range including room temperature. The a-axis magnetization curves under FCC process bifurcate from and then jump down to that of warming process (ZFC and FCW curves) in single crystals when x =0.5-0.9, suggesting complicated 4f-3d electron interactions among Dy3+-Sm3+, Dy3+-Fe3+, and Sm3+-Fe3+ sublattices of diverse magnetic configurations for materials physics and design. The magnetic properties and the doping effect on SR transition temperature in these single crystals might be useful in the spintronics device application. This work is supported by the National Key Basic Research Program of China (Grant No. 2015CB921600), and the National Natural Science Foundation of China (NSFC, Nos. 51372149, 50932003, 11274222).

  13. Synthesis, crystal structure and luminescent properties of a new samarium-fluorescein metal-organic framework

    Science.gov (United States)

    Thomas, Jesty; Ambili, K. S.

    2015-10-01

    A new metal-organic framework with empirical formula C43H30NO12Sm was solvothermally synthesized using SmCl3, fluorescein and N, N-Dimethyl formamide (DMF) and characterized by single crystal X-ray diffraction, powder X-ray diffraction, infrared spectroscopy, UV-Visible spectroscopy, scanning electron microscopy, optical microscopy, photoluminescence spectroscopy, CHN elemental analysis and thermogravimetric analysis. Single crystal X-ray diffraction revealed that the crystal structure belongs to the triclinic system, P-1 space group with a = 12.113 (6) Å, b = 12.1734 (7) Å, c = 13.2760(8) Å, α = 67.930(3)⁰, β = 87.779(3)⁰, γ = 77.603(3)⁰ and V = 1769.71 (17) Å3. The photoluminescence spectrum showed emission peaks at 550 nm, 600 nm and 647 nm due to the characteristic transitions 4G5/2 to 6H5/2, 4G5/2 to 6H7/2 and 4G5/2 to 6H9/2 respectively, when excited at 398 nm.

  14. High-temperature heat capacity of samarium and erbium titanates with pyrochlore structure

    Science.gov (United States)

    Denisova, L. T.; Chumilina, L. G.; Denisov, V. M.; Ryabov, V. V.

    2017-12-01

    Titanates Sm2Ti2O7 and Er2Ti2O7 with pyrochlore structure have been prepared by solid-phase synthesis in air from stoichiometric Sm2O3 (Er2O3)-TiO2 mixtures sequentially at 1673 and 1773 K. Hightemperature heat capacity of the oxide compounds has been determined by differential scanning calorimetry. Their thermodynamic properties have been calculated from experimental temperature dependence C p = f( T).

  15. JCSC_128_6_957_965_SI.docx

    Indian Academy of Sciences (India)

    Darbha  Srinivas

    . d.srinivas@ncl.res.in. *For correspondence. Figure S1 Catalyst preparation. Tables S1-S2 Catalytic activity data and product distribution. Figure S1. HRTEM images ... Reaction temperature.(oC), Product distribution (mmol), Mass balance (%).

  16. JCSC_128_6_941_950_SI_a.docx

    Indian Academy of Sciences (India)

    bray

    a Department of Chemistry, Faculty of Science, Banaras Hindu University, Varanasi 221 005, India. b School of Material Science and Technology, Indian Institute of Technology, Banaras Hindu University, Varanasi 221 005, India. # Present address: Nanshan District Key Lab for Biopolymers and Safety Evaluation, College ...

  17. JCSC_128_6_1003_1010_SI.docx

    Indian Academy of Sciences (India)

    Atanu

    Tables S4-S6 give the number of solvent molecules from the ion within a spherical volume of radius 3.5 Е, 4.0Е and 4.5Е. Table S7 gives the distance at which .... Figure S2. Running co-ordination numbers for Na+Cl- in Water-DMSO mixed solvent where xDMSO = 0.21 using 12-6-1 potential model. (CIP) (SAIP). Figure S3.

  18. JCSC_128_8_1303_1313_SI.docx

    Indian Academy of Sciences (India)

    vijay

    phenylamino)(thiophen-2-yl)methylphosphonate (5a): Yellowsolid, M.p.: 181-183 oC. IR (cm-1) υmax: 3364 (N-H, str), 2982 (C-H, str), 1576 (C=C, str), 1455 (C-H, bend), ..... Std. – Norfloxacin was used as a standard to compare the activity results.

  19. JCSC_128_7_1141_1148_SI_b.docx

    Indian Academy of Sciences (India)

    donia

    'Fc^*^=kFc[1+0.001xFc^2^\\l^3^/sin(2\\q)]^-1/4^'. _refine_ls_number_reflns 3277. _refine_ls_number_parameters 227. _refine_ls_number_restraints 0. _refine_ls_R_factor_all 0.0368. _refine_ls_R_factor_gt 0.0302. _refine_ls_wR_factor_ref 0.0915. _refine_ls_wR_factor_gt 0.0872. _refine_ls_goodness_of_fit_ref 1.093.

  20. JCSC_128_5_707-718_SI.docx

    Indian Academy of Sciences (India)

    MMC14

    Theoretical and Computational Chemistry Laboratory, Department of Chemistry, Kwame Nkrumah University of Science and Technology, Kumasi, Ghana. Table of Contents. Fig S1: Reaction profile for the formation of the epoxide precursor from the addition of WO2Cl2 to ethylene at the B3LYP level (s = singlet state, ...

  1. JCSC_128_9_1479_1487_SI.doc

    Indian Academy of Sciences (India)

    Structural, Vibrational, NMR, Quantum chemical, DNA Binding and Protein Docking Studies of two Flexible Imine oximes. YUNUS KAYA. Department of Chemistry, Faculty of Arts and Sciences, Uludag University, 16059 Bursa, Turkey. Email: ykaya@uludag.edu.tr. Contents. Table S1. Elemental analysis results. Table S2.

  2. JCSC_128_7_1163_1173_SI.docx

    Indian Academy of Sciences (India)

    head

    RAJU BATHINI, SREE KANTH SIVAN, SABIHA FATIMA and VIJJULATHA MANGA*. Molecular Modeling and Medicinal Chemistry Group, Department of Chemistry,. University College of Science, Osmania University, Hyderabad 500 007, India. Email: vijjulathamanga@gmail.com. *For correspondence ...

  3. JCSC_128_6_883_891_SI.doc

    Indian Academy of Sciences (India)

    ... frequencies and electronic transitions of HMBED Schiff base and its copper complex (Table S1); Crystal data of HMBED and structure refinement parameters (Table S2). Figure S1. FTIR spectra of HMBED Schiff base. Figure S2. Semilogarithmic plots of L-lactide conversion in time catalyzed by Cu-HMBPD in the presence ...

  4. 128 AUTOMATION OF MICRO FINANCE INSTITUTIONS IN NIGERIA

    African Journals Online (AJOL)

    2009-01-24

    Jan 24, 2009 ... Abbasi Alireza (2007), E-Commerce development in Iran Webology, volume 4 number 4. December 2007. http:/www.webology.ir/2007/4n4/a49.html. Agboola A.A (2001) ,“Impact of Electronic Banking on Customer Services in Lagos,. Nigeria”, Ife Journal of Economics and Finance. Vol. 5 No. 1&2. Agboola ...

  5. Dicty_cDB: CHQ128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available /CSM/VH/VHO5-D/VHO596Q.Seq.d/ 297 4e-80 VHN622 (VHN622Q) /CSM/VH/VHN6-A/VHN622Q.Seq.d/ 297 4e-80 VFE418 (VFE418Q...) /CSM/VF/VFE4-A/VFE418Q.Seq.d/ 297 4e-80 CHR552 (CHR552Q) /CSM/CH/CHR5-C/CHR552Q.Seq.d/ 297 4e-80 CHN18

  6. JCSC_128_12_1855_1860_SI.doc

    Indian Academy of Sciences (India)

    Choline-based biodegradable ionic liquid catalyst for Mannich-type reaction. PENG HUANa, HU YULINb, XING RONGa, b and FANG DONG*,a, b. a College of Chemical Engineering, Nanjing Tech University, Nanjing 210009, P.R. China. bSchool of Chemistry & Environmental Engineering, Yancheng Teachers University, ...

  7. Dicty_cDB: CFJ128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *n*t*cksigkxletstfrxil*yek yxtc**slhklcneskewctcstfynvkmlksmatxsysi*q Translated ...nlfcngsninv*gnnl*nhqw*ren*n*t*cksigkxletstfrxil*yek yxtc**slhklcneskewctcstfynvkmlksmatxsysi*q Frame C: ykfi

  8. Dicty_cDB: VSF128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value N CA903142 |CA903142.1 PCSC20414 Scarlet Runner Bean Suspensor Region TriplEx2 Phaseolus...sequence. 50 9e-05 2 CA903144 |CA903144.1 PCSC21037 Scarlet Runner Bean Suspensor Region TriplEx2 Phaseolus...sequence. 50 9e-05 2 CA903143 |CA903143.1 PCSC20975 Scarlet Runner Bean Suspensor Region TriplEx2 Phaseolus...sequence. 52 0.008 1 CA903132 |CA903132.1 PCSC13732 Scarlet Runner Bean Suspensor Region TriplEx2 Phaseolus...sequence. 42 0.011 2 CA903131 |CA903131.1 PCSC13701 Scarlet Runner Bean Suspensor Region TriplEx2 Phaseolus

  9. JCSC_128_12_1895_1904_SI_a.doc

    Indian Academy of Sciences (India)

    aKey Laboratory of Nuclear Medicine, Ministry of Health, Jiangsu Key Laboratory of Molecular Nuclear Medicine, Jiangsu Institute of Nuclear Medicine, Wuxi 214063, P. R. China. bInstitute for Computation in Molecular and Material Science, School of Chemical Engineering, Nanjing University of Science and Technology, ...

  10. JCSC_128_4_613-620_SIa.docx

    Indian Academy of Sciences (India)

    Admin

    ARUNABHA THAKUR#,*, PAVAN K VARDHANAPU¥, GONELA VIJAYKUMAR¥ and SUSHIL RANJAN BHATTA#. #Department of Chemistry, National Institute of Technology Rourkela, Rourkela 769 008, India. ¥ Department of Chemical Science, Indian Institute of Science Education and Research, Kolkata.

  11. JCSC_128_9_1475_1478_SI.docx

    Indian Academy of Sciences (India)

    sony

    SUPPLEMENTARY INFORMATION. An efficient PEG-400 mediated catalyst free green synthesis of 2-amino-thiazoles from α-diazoketones and thiourea. B HARI BABU1*, K VIJAY2, K BALA MURALI KRISHNA1, N SHARMILA1 and M BABY RAMANA1. 1Department of Chemistry, Acharya Nagarjuna University, N Nagar, ...

  12. What we do | Page 128 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Distance Education Technology. In Asia, demographic pressure has strained the education sector to the point that many countries may not meet their education targets within the Millennium Development Goals by 2015. Central Asia, Far East Asia, South Asia, Laos, Malaysia, Mongolia, Nepal, Pakistan, Philippines, Japan.

  13. 40 CFR 93.128 - Traffic signal synchronization projects.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Traffic signal synchronization... synchronization projects. Traffic signal synchronization projects may be approved, funded, and implemented without... include such regionally significant traffic signal synchronization projects. ...

  14. What we do | Page 128 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Training Institute : Women's Rights, Citizenship and Governance in sub-Saharan Africa. This project aims to build capacity for feminist research and analysis in relation to women's rights, citizenship and governance in sub-Saharan Africa. Africa, South Of Sahara. PROJECT ...

  15. What we do | Page 128 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Training Institute : Women's Rights, Citizenship and Governance in sub-Saharan Africa. This project aims to build capacity for feminist research and analysis in relation to women's rights, citizenship and governance in sub-Saharan Africa. North Of Sahara, South Of Sahara. PROJECT ...

  16. Publications | Page 128 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    TICs en las PYMES de Centroamérica : Impacto de la adopción de las tecnologías de la información y la comunicación. La révolution numérique, les technologies de l'information et de la communication (TIC) et la mondialisation font peser de nouvelles menaces sur la performance des micro, petites et moyennes ...

  17. JCSC_128_8_1285_1290_SI.doc

    Indian Academy of Sciences (India)

    Synthesis and characterization of Trichloroisocyanouric acid functionalized mesoporous silica nanocomposite (SBA/TCCA) for the Acylation of Indole. G ROBIN WILSON and AMIT DUBEY*. Department of Chemistry, Maulana Azad National Institute of Technology (MANIT), Bhopal Madhya Pradesh, 462 003 India.

  18. JCSC_128_2_297-309_SI.doc

    Indian Academy of Sciences (India)

    cState Scientific Institution “Institute for Single Crystals”, National Academy of Science of Ukraine, 60 Leninaave, Kharkiv, 61001, Ukraine. dCSIR-National Physical Laboratory, Dr. K S Krishnan Road, New Delhi 110 012, India. ePG& Research Department of Physics, Arignar Anna Government Arts College, Musiri 621 211, ...

  19. JCSC_128_8_1175_1189_SI.docx

    Indian Academy of Sciences (India)

    IISC

    -31+G(d,p) level of theory for ACl:NH3 complexes (where A features F, Cl, OH and CN substituents). Figure S2. Time evolution of the α and the β orbitals in NCCl:NH3 complex, computed at the wB97XD/6-31+G(d,p) level of theory. Figure S1.

  20. JCSC_128_9_1345_1354_SI.doc

    Indian Academy of Sciences (India)

    Figure S8 Calibration graph of DOX at different concentrations. Figure S1 Raman spectrum of microcrystalline graphite (G) before FC acylation. Figure S2 Raman spectra of the FC acylated microcrystalline graphite (G─FC) obtained from reactions performed at various temperatures. The extent of functionalization was found ...

  1. 41 CFR 128-1.5006-1 - Head of bureau.

    Science.gov (United States)

    2010-07-01

    ... space are readily available to satisfy program needs while minimizing operating costs and inventory levels. (b) The creation and maintenance of complete, accurate inventory control and accountability... Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.50-Authorities and Responsibilities for...

  2. Dicty_cDB: VSK128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available found ****** Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Number of Hits to DB: 42207 Number...129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension:

  3. JCSC_128_9_1469_1473_SI.docx

    Indian Academy of Sciences (India)

    Userman

    Yellow oil. 1H NMR (300MHz, CDCl3, ppm): δ 7.22–7.16 (m, 2H), 6.74–6.68 (m, 1H), 6.65–6.58 (m, 2H), 3.67 (s, 1H), 2.82 (s, 3H). 13C NMR (125MHz, CDCl3, ppm): δ 149.22, 129.06, 117.06, 112.27, 30.56. 4-Methyl- N-methylaniline 1. Yellow oil. 1H NMR (300MHz, CDCl3, ppm): δ 7.04–6.98 (m, 2H), 6.58–6.52 (m, 2H), ...

  4. 31 CFR 128.23 - Special survey reports.

    Science.gov (United States)

    2010-07-01

    ... foreign exchange positions and related information at such times as the Secretary determines that there is a need for prompt or expanded information on current conditions in the foreign exchange markets... INTERNATIONAL CAPITAL AND FOREIGN-CURRENCY TRANSACTIONS AND POSITIONS Reports on Foreign Currency Positions...

  5. Dicty_cDB: SFH128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC091811 |pid:none) Oryza sativa chromosome 3 BAC OSJ... 40 0.057 BT068289_1( BT068289 |pid:none) Zea mays...AC090882 |pid:none) Oryza sativa chromosome 3 BAC OSJ... 39 0.098 CR855144_15( CR855144 |pid:none) Oryza

  6. JCSC_128_11_1737_1744_SI_c.doc

    Indian Academy of Sciences (India)

    International Tables Vol C Tables 4.2.6.8 and 6.1.1.4'. _space_group_crystal_system monoclinic. _space_group_IT_number 14. _space_group_name_H-M_alt 'P 21/c'. _space_group_name_Hall '-P 2ybc'. _shelx_space_group_comment.

  7. JCSC_128_4_523-536_SIe.docx

    Indian Academy of Sciences (India)

    user

    O5 O 0.5604(3) 0.4007(2) 0.2191(2) 0.0545(8) Uani 1 1 d . . . C28 C 1.1051(2) 0.6427(2) 0.5012(2) 0.0213(5) Uani 1 1 d . . . N1 N 0.79213(18) 0.85074(19) 0.86478(17) 0.0195(4) Uani 1 1 d . . . C23 C 0.6377(2) 0.9938(2) 0.62515(19) 0.0172(5) Uani 1 1 d . . . C25 C 1.0387(2) 0.7370(2) 0.6963(2) 0.0225(5) Uani 1 1 d .

  8. 7 CFR 993.128 - Nominations for membership.

    Science.gov (United States)

    2010-01-01

    .... 2. That portion of Sutter County north of a line extending along Franklin Road easterly to the Yuba... of a line extending along Franklin Road easterly to the Yuba County line and westerly to the Colusa... Trinity. District No. 5. All of Butte County. District No. 6. All of Yuba County. District No. 7. The...

  9. JCSC_128_6_967_976_SI_a.doc

    Indian Academy of Sciences (India)

    But our titration result explains that only 5.7 % of carboxylic groups were free for catalyzing the reaction. The difference of 1.8 % in the theoretical and experimental value may be due to some of these possible reasons;. it might be possible that both carboxylic groups of some of the molecules of diphenic acid may undergo ...

  10. 32 CFR 552.128 - Requirements for possession and use.

    Science.gov (United States)

    2010-07-01

    ..., ammunition, pellet and BB guns, knives, bows and arrows, and crossbows under the following conditions: (a) Privately-owned firearms, crossbows, pellet and BB guns possessed or stored on the installation must be... local law enforcement personnel when in the performance of official law enforcement duties. (b...

  11. JCSC_128_8_1337_1343_SI.doc

    Indian Academy of Sciences (India)

    Figure S3. Fluorescence responses of sensor L1 (10 μM) and control compound L2 (10 μM) to Zn2+. Figure S4. Job's plot for evaluating the binding ratio of Zn2+ and L1 with a total concentration of 20 μM. Figure S5. UV-vis absorption spectrum changes of L1 in the presence of different concentrations of Zn2+. CL1 = 40 μM.

  12. 128 EAST AFRICAN MEDICAL JOURNAL March 2001 East African ...

    African Journals Online (AJOL)

    Background: In 1992, Kenyatta National Hospital Lactation Management Education Centre. (KNH LME) was establised in collaboration with the University of Nairobi (UoN) and the. Ministry of Health (MoH). The aim of the programme was to train multidisciplinary teams of health professionals in lactation management ...

  13. 128 EVALUATION OF RANGE CONDITION AND TREND OF ...

    African Journals Online (AJOL)

    2010-03-01

    . Email-mrmbaya@gmail.com GSM-08057884935 ... Range condition is used as a guide to ensure sustainable land use; to determine ... Range trend assessments depend upon evaluation of the general health of individual.

  14. 41 CFR 128-50.100 - Storage and care.

    Science.gov (United States)

    2010-07-01

    ... bureau preparing a seized vehicle for storage should be at a minimum; (1) Protect the cooling system from freezing; (2) Protect the battery by assuring it is properly watered; (3) Protect the tires by inflating to...

  15. 46 CFR 128.420 - Keel cooler installations.

    Science.gov (United States)

    2010-10-01

    ... of this chapter. (b) Approved metallic flexible connections may be located below the deepest-load.... (c) Fillet welds may be used in the attachment of channels and half-round pipe sections to the bottom of the vessel. (d) Short lengths of approved non-metallic flexible hose fixed by metallic or non...

  16. 31 CFR 128.1 - General reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... pertaining to— (i) United States claims on, and liabilities to, foreigners; (ii) Transactions in securities and other financial assets with foreigners; and (iii) The monetary reserves of the United States. (2...

  17. Laparoscopy in 100 consecutive patients with 128 impalpable testes

    DEFF Research Database (Denmark)

    Cortes, Dina; Thorup, J M; Lenz, K

    1995-01-01

    To investigate the value of laparoscopy in boys with impalpable testes, to carry out a histological examination of testicular biopsies or orchidectomy specimens, and to present a clinical description of boys with impalpable testes.......To investigate the value of laparoscopy in boys with impalpable testes, to carry out a histological examination of testicular biopsies or orchidectomy specimens, and to present a clinical description of boys with impalpable testes....

  18. JCSC_128_7_1057_1066_SI.doc

    Indian Academy of Sciences (India)

    Copper(II) Schiff base complexes and their mixed thin layers with ZnO nanoparticles. MAGDALENA BARWIOLEK*, ROBERT SZCZĘSNY and EDWARD SZŁYK. Faculty of Chemistry, Nicholas Copernicus University in Torun, 87-100 Torun, Poland. E-mail: mbarwiolek@umk.pl. *For correspondence. Table of Contents. Fig.

  19. JCSC_128_2_217-226_SI_a.doc

    Indian Academy of Sciences (India)

    Absorption spectrum was measured by using JASCO V-550 UV/VIS Spectrophotometer and Fluorescence spectrum was measured by using Hitachi F-2500 Fluorescence Spectrophotometer. X-ray data for the compound were collected at room temperature using a Bruker Apex II KY CCD diffractometer with graphite ...

  20. JCSC_128_12_1879_1885_SI.docx

    Indian Academy of Sciences (India)

    Administrator

    Electrochemical capacitance measurements to determine the surface area of CFP-Co3O4 NW (a), CFP-Co(OH)(CO3)0.5 NW (b) andCFP-Co3O4 NR (c). The capacitive current from double layer charging can be measured from cyclic voltammograms in a potential range (1.1 V -1.2 V vs. RHE) where no Faradic processes ...

  1. JCSC_128_2_279-285_SI.doc

    Indian Academy of Sciences (India)

    Total energy (MP2/aug-cc-pVDZ) = -94.322888 au. Zero-Point correction to Energy = 0.040428 au. Vibrational frequencies: 1090.2350, 1095.6102, 1177.1919, 1402.5537, 1503.2504, 1678.7733, 3093.1060, 3212.7850, 3492.4140. TSa. C -1.30565100 -0.64357000 0.14027400. C 0.65568700 1.19870900 0.10177800.

  2. 41 CFR 128-1.8006 - Seismic Safety Program requirements.

    Science.gov (United States)

    2010-07-01

    ... Component Seismic Safety Coordinator shall ensure that an individual familiar with seismic design provisions... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Seismic Safety Program... Management Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.80-Seismic Safety Program...

  3. JCSC_128_6_913_920_SI_a.doc

    Indian Academy of Sciences (India)

    2. Figure S3. Electronic absorption spectrum of HL (concentration = 1 x 10-5 M, path length = 1.0 cm) in acetonitrile. 3. Figure S4. Electronic absorption spectrum of the complex (conconcentration = 5.0 x 10-5 M, path length = 1.0 cm) in acetonitrile (inset shows d-d transition.) 3. Figure S5. PXRD pattern of the complex (Black ...

  4. JCSC_128_4_523-536_SIa.docx

    Indian Academy of Sciences (India)

    user

    Mn(II) complexes with bipyridine, phenanthroline and benzoic acid: Biological and catalase-like activity. IBRAHIM KANI,a,*, ÖZLEMATLIERa and KIYMETGÜVENb. a Department of Chemistry, Faculty of Sciences, Anadolu University, Eskişehir, Turkey. b Department of Biology, Faculty of Sciences, Anadolu University, ...

  5. JCSC_128_7_1141_1148_SI_a.docx

    Indian Academy of Sciences (India)

    donia

    TGA–DTA thermograms of the compound (1). Figure S3. UV–vis absorption spectra of compound (1) in water solution (5.10-5M). Figure S4. Cyclic voltammetry at a glassy carbon working electrode of 2.10-3 mol/L compound (1) solutions 0.5mol/L CH3COONa/CH3COOH buffer, pH=4.8, scan rate of 20 mV/s. Figure S5.

  6. 19 CFR 12.8 - Inspection; bond; release.

    Science.gov (United States)

    2010-04-01

    ...) All imported meat, meat-food products horse meat and horse meat-food products offered for entry into... or an inspector of the Food Safety and Inspection Service, Meat and Poultry Inspection, with import... for proper sealing, the cords shall be furnished and affixed by the importer or his agent. Import-meat...

  7. 7 CFR 58.128 - Equipment and utensils.

    Science.gov (United States)

    2010-01-01

    ... discharge a clean dry can and cover and shall be kept properly timed in accordance with the instructions of... required minimum temperature treatment. (2) Recording thermometers. (i) Recording thermometers that are accurate within 1 °F., plus or minus, for the applicable temperature range, shall be used on each heat...

  8. 27 CFR 555.128 - Discontinuance of business.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Discontinuance of business... Discontinuance of business. Where an explosive materials business or operations is discontinued and succeeded by... such facts and shall be delivered to the successor. Where discontinuance of the business or operations...

  9. JCSC_128_12_1831_1840_SI.docx

    Indian Academy of Sciences (India)

    S Roy

    ... fused carbocyclic and oxacyclic medium-sized rings: Competition between Grubbs-II catalyzed ring closing olefin metathesis and ring closing carbonyl-olefin metathesis. P CHAKRABORTY and S C ROY*. Department of Organic Chemistry, Indian Association for the Cultivation of Science, Jadavpur, Kolkata 700 032, India.

  10. JCSC_128_11_1783_1788_SI.docx

    Indian Academy of Sciences (India)

    Sky123.Org

    Bovine Serum Albumin Metal Complexes for Mimic of SOD. GUIFANG YAN, YUFENG HE*, GANG LI, YUBING XIONG, PENGFEI SONG and RONG-MIN WANG*. Key Lab. Eco-Environment-Related Polymer Materials of Ministry of Education, Key Lab. Polymer Materials of Gansu Province, College of Chemistry & Chemical ...

  11. JCSC_128_6_929_939_SI.docx

    Indian Academy of Sciences (India)

    RAM

    Figure S7: 1H NMR spectra of compound 5c. Figure S8: 1H NMR spectra of compound 5d. Figure S9: 1H NMR spectra of compound 5e. Figure S10: 1H NMR spectra of compound 5f. Figure S11: 1H NMR spectra of compound 5g. Figure S12: 1H NMR spectra of compound 5h. Figure S13: 1H NMR spectra of compound 5i.

  12. JCSC_128_9_1445_1449_SI.docx

    Indian Academy of Sciences (India)

    setareh

    one (5c): Pale yellow solid, (0.30 g, 91%); m.p. 140-142 oC; IR (KBr): 1687, 1459, 1328, 1069, 777, 686 cm−1; 1H NMR (500 MHz, DMSO-d6) δ = 2.26 (s, 3H), 5.50 (s, 2H), 5.63 (s, 2H), 7.13 (d, J = 8.0 Hz, 2H), 7.20 (d, J = 8.0 Hz, 2H), 7.93 (t, ...

  13. 42 CFR 483.128 - PASARR evaluation criteria.

    Science.gov (United States)

    2010-10-01

    ... having MI or MR and is being referred to the State mental health or mental retardation authority for... mental health services which are of a lesser intensity than specialized services that are required to... specific mental retardation or mental health services required to meet the evaluated individual's needs...

  14. JCSC_128_4_523-536_SIf.docx

    Indian Academy of Sciences (India)

    user

    2010-11-01

    Nov 1, 2010 ... C5 C -0.1493(4) 0.1560(3) 0.06667(14) 0.0240(6) Uani 1 1 d . . . C8 C -0.2482(4) 0.4318(3) 0.07034(18) 0.0373(8) Uani 1 1 d . . . H8 H -0.3324 0.4779 0.0532 0.045 Uiso 1 1 calc R . . O6 O 0.4708(6) -0.0989(3) 0.1411(2) 0.0980(16) Uani 1 1 d . . . C19 C 0.6655(5) 0.3243(3) 0.2436(2) 0.0399(9) Uani 1 1 d ...

  15. JCSC_128_7_1095_1102_SI_c.doc

    Indian Academy of Sciences (India)

    C5 C 0.1324(4) 0.3477(3) 0.30817(19) 0.0206(8) Uani 1 1 d . . . C9 C 0.6458(3) 0.5274(3) 0.47736(17) 0.0131(7) Uani 1 1 d . B . C13 C 1.2088(3) 0.4178(3) 0.62186(18) 0.0187(9) Uani 1 1 d . . . C11 C 1.0204(3) 0.3794(3) 0.59087(17) 0.0150(8) Uani 1 1 d . . . C27 C 0.6542(4) 0.3302(3) 0.4960(2) 0.0262(9) Uani 1 1 d .

  16. 7 CFR 762.128 - Environmental and special laws.

    Science.gov (United States)

    2010-01-01

    ... accept as evidence of due diligence the most current version of the American Society of Testing Materials... applicant on the basis of race, color, religion, national origin, sex, marital status, or age, provided the...

  17. JCSC_128_11_1813_1821_SI.doc

    Indian Academy of Sciences (India)

    1H NMR spectra were run on a Bruker Avance 500 spectrometer with tetramethylsilane (1H) as an internal standard. Electrospray Ionization ESI mass spectra were performed on a Finnigan LCQ quadrupole ion trap mass spectrometer (samples were dissolved in HPLC grade methanol). Elemental analyses were performed ...

  18. Dicty_cDB: VHE128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HTFVIDNIKINNHRDDPEMVADLYHRIADNNKSNADTR-- - ---nsietidqrtepisnevrskvpnpkntststsryskits*hwstgnl*sifgn*pnk wcl*...lsigtn*ks*rkvlslflgscsealfinkglvenqssqefqeemeqgyiqltdlme slgvlppegsyyptlnsnsngtssnnnlsnssiygssnnfggsgspviqln

  19. JCSC_128_7_1025_1032_SI_a.doc

    Indian Academy of Sciences (India)

    Li[H3B(EFc)] ( E = S, Se, Te; Fc = C5H5-Fe-C5H4): The reaction of the 1.2 equiv. of [LiBH4.thf] (0.14 mL, 0.276 mmol) with [Fc2S2] (0.1 g, 0.230 mmol) in THF resulted Li[H3B(SFc)] and the 1H coupled 11B NMR of the reaction mixture displayed a quartet at δ = -28.2 ppm for Li[H3B(SFc)]. Similarly the Se and Te analogues ...

  20. JCSC_128_11_1789_1794_SI.docx

    Indian Academy of Sciences (India)

    Santosh Reddy

    13C NMR spectrum of compound 8 5. Figure S7. 1H NMR spectrum of compound 5 6. Figure S8. 13C NMR spectrum of compound 5 6. Figure S9. 1H NMR spectrum of compound 7 7. Figure S10. 13C NMR spectrum of compound 7 7. Figure S11. 1H NMR spectrum of compound 12 8. Figure S12. 13C NMR spectrum of ...

  1. JCSC_128_6_875_881_SI.doc

    Indian Academy of Sciences (India)

    A solution of primary or secondary amine (0.99 mmol) in toluene (1.0 mL) was added drop wise into the reaction mixure of carbodiimide (0.99 mmol) and DippBIAOZnCl2 (1) (0.276 mmol) to a 25 mL dry Schlenk flask inside the glovebox. The dark red reaction mixture was stirred for 12 h at 90˚C temperature. Solvent was ...

  2. JCSC_128_2_269-277_SI.docx

    Indian Academy of Sciences (India)

    Lnmr Lab

    10-6 M) in the 0.01 M Tris buffer (pH 7.3, 24°C). The absorption descended with increasing concentration of CT DNA from top to bottom (0–20 μM bp, in 2 μM intervals). Figure S12. Spectrophotometric titration of 2-(allylimino)-thiazolidinone 5b ...

  3. 7 CFR 4280.128 - Application and documentation.

    Science.gov (United States)

    2010-01-01

    ...-score the project using the evaluation criteria in § 4280.112(e) as specified in § 4280.111(b)(6). (vi...-level feasibility study must at least include an evaluation of economic, market, technical, financial...) Project Summary. Provide a concise summary of the proposed project and applicant information, project...

  4. 128 THE SOCIAL SCIENCES AND THE SOCIALLY OPPRESSED IN ...

    African Journals Online (AJOL)

    Ike Odimegwu

    does not only focus attention on the human elements but also on the physical, psychological and other factors that relate to him and affect him. Prominent amongst scholars who have studied the behavioral patterns of man are Sigmund Freud, Auguste Comte,. Emile Durkheim, etc. (Omoregbe, 1998) The social scientists.

  5. JCSC_128_11_1775_1782_SI.doc

    Indian Academy of Sciences (India)

    Plot of rate vs. [substrate] in presence of 1 in MeCN. Figure S6. ESI Mass spectrum of the reaction mixture between 1 and 3,5-DTBC in acetonitrile solution. Figure S1. Molecular packing diagram of 1. Figure S2. Cu1 unit attached with Cu2 unit via moderately strong H-bonding between sulphur atoms (yellow coloured) of ...

  6. Excitation functions and yields of proton induced reactions at intermediate energies leading to important diagnostics radioisotopes of {sup 52}Fe, {sup 77}Br, {sup 82}Rb, {sup 97}Ru, {sup 111}In, {sup 123}I, {sup 127}Xe, {sup 128}Cs, {sup 178}Ta and {sup 201}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Rurarz, E. [Soltan Inst. for Nuclear Studies, Otwock-Swierk (Poland)

    1994-12-31

    This report describes investigations of the excitation functions of the proton induced reactions on 14 targets (Mn, Co, Br, Rb, {sup 99}Tc, {sup 113}Cd, {sup 114}Cd, Cd, I, Cs, Ta, {sup 206,207,208}Pb) leading directly or indirectly to the formation of radionuclides {sup 52}Fe, {sup 77}Br, {sup 82}Rb, {sup 97}Ru, {sup 111}In, {sup 123}I, {sup 127}Xe, {sup 128}Cs, {sup 178}Ta and {sup 201}Tl frequently used in diagnostic procedures of nuclear medicine. The measurements of the excitation functions were made over a wide proton energy range from the reaction threshold up to 100 MeV using the stacked foil (or pellet) technique. Small energy steps were used to allow for accurate determination of the structure of excitation functions. For {sup 97}Ru, {sup 111}In and {sup 127}Xe formation with protons, new reaction channels and targets were used and data concerning this method are published for the first time. The data for {sup 52}Fe, {sup 77}Br, {sup 82}Rb, {sup 123}I, {sup 128}Cs and {sup 201}Tl obtained in the present work for the E{sub p}=70-100 MeV region are also published for the first time. The measured excitation functions for the formation of desired (and undesired) radionuclides (altogether 28 excitation functions) are compared with the theoretical ones calculated on the basis of a hybrid model of nuclear reactions in the form of the Overlaid Alice computer code. In order to determine the contribution of the competitive reaction channels to the purity of the produced, desired radionuclide, the excitation functions of the accompanying reactions were also calculated. The 122 calculated excitation functions for the possible contaminant are given. The comparison of experimental excitation functions with the results of model calculations showed satisfactory agreement; no parameter adjustment for individual reaction products was undertaken. Production yields for 28 radionuclides mentioned above were determined (author). 262 refs, 65 figs, 34 tabs.

  7. High-pressure high-temperature decomposition of CeCoGa to the Laves phases CeCo{sub 0.58}Ga{sub 1.42}, CeCo{sub 0.72}Ga{sub 1.28}, and CeCo{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Niehaus, Oliver; Rodewald, Ute C.; Heying, Birgit; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Heymann, Gunter; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie

    2016-07-01

    The monoclinic intermediate-valent gallide CeCoGa decomposes under high-pressure (HP) (9.5 GPa) high-temperature (HT) (1470 K) conditions into the Laves phases CeCo{sub 0.58}Ga{sub 1.42} (MgCu{sub 2} type), CeCo{sub 0.72}Ga{sub 1.28} (MgZn{sub 2} type; major product phase), and CeCo{sub 2} (MgCu{sub 2} type). The structures of the ternary Laves phases were refined from single crystal X-ray diffractometer data: Fd anti 3m, a=778.3(1) pm, wR2=0.0310, 63 F{sup 2} values, five variables for CeCo{sub 0.58(3)}Ga{sub 1.42(3)} and P6{sub 3}/mmc, a=547.24(5), c=858.76(7) pm, wR2=0.1009, 195 F{sup 2} values, 13 variables for CeCo{sub 0.72(1)}Ga{sub 1.28(1)}. Partial substitution of cobalt by gallium leads to a significant increase of the distances within the tetrahedral network: 253 pm Co-Co in CeCo{sub 2} as compared to 275 pm in CeCo{sub 0.58(3)}Ga{sub 1.42(3)} and 265-277 pm in CeCo{sub 0.72(1)}Ga{sub 1.28(1)}. The crystal chemical consequences are briefly discussed.

  8. Fluorescence enhancement of samarium (III) perchlorate by 1,10-phenanthroline on Phenylnaphthoylmethyl sulfoxide complex and luminescence mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com; Feng, Shu-Yan; Liu, Yu; Zhang, Jing; Xin, Xiao-Dong; Ao, Bo-Yang; Li, Ying-Jie

    2013-11-15

    A novel ligand, Phenylnaphthoylmethyl sulfoxide, was synthesized by a new method. Its novel binary complex, SmL{sub 5}·(ClO{sub 4}){sub 3}·2H{sub 2}O, and the ternary complex, SmL{sub 4}·L′(ClO{sub 4}){sub 3}·2H{sub 2}O, had been synthesized (using Phenylnaphthoylmethyl sulfoxide as the first ligand L, 1,10-phenanthroline as the second ligand L′). The complexes were characterized by element analysis, coordination titration, molar conductivity, IR, TG-DSC, {sup 1}HNMR and UV spectra. Their fluorescence emission mechanism, fluorescence intensities and phosphorescence spectra of the two ligands were also investigated by comparison. Fluorescent spectra illustrated that the ternary rare-earth complex presented stronger fluorescence intensity than the binary rare-earth complex in such material. The strongest characteristic fluorescence emission intensity of the ternary system was 1.81 times as strong as that of the binary system. By the analysis of fluorescence and phosphorescence spectra, it was found that the Phenylnaphthoylmethyl sulfoxide and phen had the advantage to absorb and transfer energy to Sm (III) ions effectively, and then the complexes emitted the characteristic fluorescence of Sm (III) ions. The phosphorescence spectra and fluorescence lifetime of the complexes were also measured. -- Highlights: • A novel ligand, Phenylnaphthoylmethyl sulfoxide, has been synthesized. • Its novel ternary complex and the binary complex have been synthesized. • The fluorescence emission intensity of ternary rare earth complex exhibit obvious enhancement. • The fluorescence emission mechanism and phosphorescence spectra are also investigated.

  9. Polypropylene oil as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-03-01

    The research focusses on converting polypropylene oil as pyrolysis product of polypropylene plastic into an electricity. The converter was a direct liquid fuel-solid oxide fuel cell (SOFC) with cerium oxide based material as electrolyte. The polypropylene vapor flowed into fuel cell, in the anode side and undergo oxidation reaction, meanwhile, the Oxygen in atmosphere reduced into oxygen ion at cathode. The fuel cell test was conducted at 400 - 600 °C. According to GC-MS analysis, the polypropylene oil consist of C8 to C27 hydrocarbon chain. The XRD analysis result shows that Na2CO3 did not change the crystal structure of SDC even increases the electrical conductivity. The maximum power density is 0.079 mW.cm-2 at 773 K. The open circuite voltage is 0.77 volt. Chemical stability test by analysing the single cell at before and after fuel cell test found that ionic migration occured during fuel cell operation. It is supported by the change of elemental composition in the point position of electrolyte and at the electrolyte-electrode interface

  10. A distribution pattern of cadmium, gadolinium and samarium in Phaseolus vulgaris (L) plants as assessed by dynamic neutron radiography

    Science.gov (United States)

    Kőrösi, Ferenc; Balaskó, Márton; Sváb, Erzsébet

    1999-11-01

    The qualitative and semi-quantitative distributions, presumably apoplast transport patterns for the Gd, Sm and Cd were investigated in the primordial leaf tissues of the bean using dynamic neutron radiography. According to the applied 3D, 2D images and the pixel count distribution histograms of the considered gray levels, peculiar distribution patterns were postulated for the elements. Main and lateral vascular systems for Gd, the cell walls as well as intercellular spaces for Sm and the main leaf vein for Cd assumed to be the apoplast transport spaces and volumes.

  11. Ab initio calculation of the migration free energy of oxygen diffusion in pure and samarium-doped ceria

    Science.gov (United States)

    Koettgen, Julius; Schmidt, Peter C.; Bučko, Tomáš; Martin, Manfred

    2018-01-01

    We have studied the free energy migration barriers Δ F‡ for oxygen diffusion in pure ceria and Sm-doped ceria for the temperatures 300, 700, and 1000 K. We used the density functional theory in the generalized gradient approximation and an additional Hubbard U parameter for the Ce 4 f electronic states. We compare the results for the free energy deduced from three different methods. First, a static harmonic approach is applied in which the temperature dependent vibrational contributions to energy and entropy are deduced from the phonon frequencies of supercells with a fixed volume. Second, a static quasiharmonic approach is used in which a part of the anharmonicity effect is introduced via an implicit dependence of the harmonic frequencies on the thermally expanding cell volume. Third, the free energy barriers are calculated using metadynamics and molecular dynamics in which anharmonicity effects are naturally taken into account. The three methods examined in this study lead to distinctly different results. According to the harmonic approximation, the migration free energy difference Δ F‡ increases with increasing temperature due to an increasing entropic contribution. According to the quasiharmonic approximation, the migration free energy is independent of temperature. Finally, molecular dynamics predicts a thermally induced increase in the migration free energy. We conclude that temperature dependent experimental lattice constants cancel out the increasing entropic contribution with increasing temperature in the static quasiharmonic approach. The full consideration of anharmonicity effects in the metadynamics method again leads to a temperature dependent migration free energy.

  12. Studies on the preparation and stability of samarium-153 propylene diamine tetramethylene phosphonate (PDTMP) complex as a bone seeker

    Energy Technology Data Exchange (ETDEWEB)

    Majali, M.A. E-mail: mythili@magnum.barc.ernet.in; Mathakar, A.R.; Shimpi, H.H.; Banerjee, Sharmila; Samuel, Grace

    2000-12-15

    Propylene diamine tetra methylene phosphonate (PDTMP) was synthesised by modifying a method reported for the synthesis of EDTMP. Complexation of the synthesised phosphonate ligand with {sup 153}Sm was carried out by varying the experimental parameters and the complex was radiochemically characterized. Biodistribution studies showed that the uptake by bone in rats was 2% per g of bone, which was retained up to 48 h. The uptake by other organs was insignificant, except by the liver which showed a slightly higher absorption.

  13. Crystal structure of a samarium(III nitrate chain cross-linked by a bis-carbamoylmethylphosphine oxide ligand

    Directory of Open Access Journals (Sweden)

    Julie A. Stoscup

    2014-10-01

    Full Text Available In the title compound poly[aquabis(μ-nitrato-κ4O,O′:O,O′′tetrakis(nitrato-κ2O,O′{μ4-tetraethyl [(ethane-1,2-diylbis(azanediylbis(2-oxoethane-2,1-diyl]diphosphonate-κ2O,O′}disamarium(III], [Sm2(NO36(C14H30N2O8P2(H2O]n, a 12-coordinate SmIII and a nine-coordinate SmIII cation are alternately linked via shared bis-bidentate nitrate anions into a corrugated chain extending parallel to the a axis. The nine-coordinate SmIII atom of this chain is also chelated by a bidentate, yet flexible, carbamoylmethylphoshine oxide (CMPO ligand and bears one water molecule. This water molecule is hydrogen bonded to nitrate groups bonded to the 12-coordinate SmIII cation. The CMPO ligand, which lies about an inversion center, links neighboring chains along the c axis, forming sheets parallel to the ac plane. Hydrogen bonds between the amide NH group and metal-bound nitrate anions are also present in these sheets. The sheets are packed along the b axis through only van der Waals interactions.

  14. Structure, reactivity, electronic configuration and magnetism of samarium atomic layers deposited on Si(0 0 1) by molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Gheorghe, Nicoleta G.; Lungu, George A.; Husanu, Marius A.; Costescu, Ruxandra M.; Macovei, Dan [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania); Teodorescu, Cristian M., E-mail: teodorescu@infim.ro [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania)

    2013-02-15

    The surface structure, interface reactivity, electron configuration and magnetic properties of Sm layers deposited on Si(0 0 1) at various temperatures are investigated by low-energy electron diffraction (LEED), X-ray photoelectron spectroscopy (XPS), X-ray absorption spectroscopy (XAS) and magneto-optical Kerr effect (MOKE). It is found that metal Sm is present on samples prepared at low temperature, with an interface layer containing SmSi{sub 2} and Sm{sub 4}Si{sub 3}. When samples are prepared at high temperature, much less metal Sm is found, with an increasing amount of SmSi{sub 2}. Room temperature ferromagnetism is observed for all prepared layers, with a decrease of the saturation magnetization when samples are prepared at high temperature. It is found that ferromagnetism implies mostly a compound with approximate stoichiometry Sm{sub 4}Si{sub 3}. Also, the decrease in the intensity of the XAS 2p{sub 3/2} → 3d white lines with the corresponding increasing amount of SmSi{sub 2} may be explained by assuming a higher occupancy of Sm 5d orbitals (5d{sup 2} configuration), most probably due to hybridation effects.

  15. Calculation and comparison of xenon and samarium reactivities of the HEU, LEU core in the low power research reactor.

    Science.gov (United States)

    Dawahra, S; Khattab, K; Saba, G

    2015-07-01

    Comparative studies for the conversion of the fuel from HEU to LEU in the Miniature Neutron Source Reactor (MNSR) have been performed using the MCNP4C and GETERA codes. The precise calculations of (135)Xe and (149)Sm concentrations and reactivities were carried out and compared during the MNSR operation time and after shutdown for the existing HEU fuel (UAl4-Al, 90% enriched) and the potential LEU fuels (U3Si2-Al, U3Si-Al, U9Mo-Al, 19.75% enriched and UO2, 12.6% enriched) in this paper using the MCNP4C and GETERA codes. It was found that the (135)Xe and (149)Sm reactivities did not reach their equilibrium reactivities during the daily operating time of the reactor. The (149)Sm reactivities could be neglected compared to (135)Xe reactivities during the reactor operating time and after shutdown. The calculations for the UAl4-Al produced the highest (135)Xe reactivity in all the studied fuel group during the reactor operation (0.39 mk) and after the reactor shutdown (0.735 mk), It followed by U3Si-Al (0.34 mk, 0.653 mk), U3Si2-Al (0.33 mk, 0.634 mk), U9Mo-Al (0.3 mk, 0.568 mk) and UO2 (0.24 mk, 0.448 mk) fuels, respectively. Finally, the results showed that the UO2 was the best candidate for fuel conversion to LEU in the MNSR since it gave the lowest (135)Xe reactivity during the reactor operation and after shutdown. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Development of samarium [{sup 32}P] phosphate colloid for radiosynoviorthesis applications: Preparation, biological and preliminary clinical studies experience

    Energy Technology Data Exchange (ETDEWEB)

    Prabhakar, G. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India)], E-mail: gantipk47@rediffmail.com; Sachdev, Satbir S.; Umamaheswari, S.; Sivaprasad, N.; Bhatia, Manohar H. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India); Chaudhari, Pradip R. [Laboratory Nuclear Medicine Services, BARC, Mumbai 400 012 (India); Solav, Srikant V. [Spect Lab, Nuclear Medicine Services, Opposite Dinanath Mangeshkar Hospital, Pune 411004 (India)

    2007-12-15

    A new therapeutic radio colloid for radiosynoviorthesis (RS) applications is reported. The method of preparation involves the reaction of SmCl{sub 3} carrier with carrier added [{sup 32}P]H{sub 3}PO{sub 4} in the presence of gelatin. The pure colloid was recovered by dialysis purification leading to radiochemical yield of around 90%. The radiochemical purity of the pure colloid formulated in isotonic saline was over 98%, for the usage period of 14 days, as assessed by paper chromatography. Ninety percent of colloid particles were in the size of 1-10 {mu}m as evident from the laser diffraction particle size analysis, ideally suitable for the intended end use. Animal studies revealed complete retention of the radio colloid in the rabbit knee joint. The results of clinical trials in humans are satisfactory and encouraging, satisfactory retention of the colloid in the knee joint and negligible leakage into the systemic circulation.

  17. 128 Étude de la dynamique stationnelle des populations des ...

    African Journals Online (AJOL)

    hadji

    La province de Sidi Slimane (Maroc) par son climat et sa position dans la plaine du Gharb en tant qu'une zone .... Le climat de la province de Sidi Slimane est de type méditerranéen avec une influence océanique ..... maximum d'abondance en automne-hiver), soit à la température qui induit un réchauffement des eaux.

  18. Sud du Sahara | Page 128 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 mai 2016 ... Selon les statistiques, 20 % des Ougandais présentent un handicap physique. Malgré tout, peu de recherches ont été menées dans le but de jeter un éclairage sur le vécu des personnes handicapées. Cette absence d'études officielles et de données concrètes fait en sorte les organismes de défense des ...

  19. Percipitopia (http://slurl.com/secondlife/Bifrost/89/128/33)

    DEFF Research Database (Denmark)

    Grund, Cynthia M.; Pilegaard, Jesper

    2008-01-01

    Percipitopia takes as its point of departure a "virtual Whitehall" in which visitors will be introduced to the Irish philosopher George Berkeley's thoughts, and from which further examination of philosophical issues and the history of philosophy is facilitated. The actual Whitehall was George Ber...

  20. 41 CFR 128-1.5004 - Basis for delegations of authority and assignment of responsibilities.

    Science.gov (United States)

    2010-07-01

    ... property management actions at the lowest organizational unit practical. Accordingly, specific... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Basis for delegations of... Management Federal Property Management Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1...

  1. Oral History Interview Transcripts Tombigbee Historic Townsites Project. Volume 5 (Interview Numbers 123-128).

    Science.gov (United States)

    1981-01-01

    had one, or two, or three of them in it. M: Did it have a moon cut in the door? D% Didn’t have that, no. M: You don’t remember the kind of hinges they...covered with wild plums, yellow plums and red plums. They’d make the best plum jelly . I don’t know what has happened to all of the plums. There’s a few

  2. Western Abenaki Dictionary. Volume 1: Abenaki-English. Mercury Series, Canadian Ethnology Service, Paper 128.

    Science.gov (United States)

    Day, Gordon M.

    This is a dictionary of Western Abenaki as it is spoken in the last half of the 20th century. A member of the Algonquin family of languages, Western Abenaki is so named to distinguish it from Penobscot and the extinct Eastern Abenaki dialects of what is now the state of Maine. The Western Abenakis, whose homes are Odanak, Quebec, and the Missiquoi…

  3. 32 CFR 701.128 - Exemptions for specific Navy record systems.

    Science.gov (United States)

    2010-07-01

    ... subject of the record. (k) System identifier and name: (1) N05354-1, Equal Opportunity Information Management System. (2) Exemptions: (i) Information specifically authorized to be classified under E.O. 12,958... revealed to the subject of the record. (t) System identifier and name: (1) N12930-1, Human Resources Group...

  4. 40 CFR 49.128 - Rule for limiting particulate matter emissions from wood products industry sources.

    Science.gov (United States)

    2010-07-01

    ... square feet of hardboard produced (1/8 inch basis), one-hour average. (4) Tempering ovens at hardboard manufacturing operations. A person must not operate any hardboard tempering oven unless all gases and vapors are collected and treated in a fume incinerator capable of raising the temperature of the gases and vapors to at...

  5. Page 1 128 Constructive criticism by Dr. I Fitzsimons and Dr. S ...

    Indian Academy of Sciences (India)

    and refinement of the opx-gt thermometer and the opx-gt- plag-qtz barometer; J. Petrol. 32.629–656. Bohlen S R and Essene E J 1977 Feldspar and oxide thermometry in the Adirondack Highlands; Contrib. Mineral. Petrol. 62 153–169. Carrington D P and Harley S L 1995 The stability of osumi- lite in metapelitic granulites; ...

  6. SU-F-J-128: Dosimetric Impact of Esophagus Motion in Spine Stereotactic Body Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Yang, J; Wang, X; Zhao, Z; Yang, J; Zhang, Y; Court, L; Li, J; Brown, P; Ghia, A [MD Anderson Cancer Center, Houston, TX (United States)

    2016-06-15

    Purpose: Acute esophageal toxicity is a common side effect in spine stereotactic body radiotherapy (SBRT). The respiratory motion may alter esophageal position from the planning scan resulting in excessive esophageal dose. Here we assessed the dosimetric impact resulting from the esophageal motion using 4DCT. Methods: Nine patients treated to their thoracic spines in one fraction of 24 Gy were identified for this study. The original plan on a free breathing CT was copied to each phase image of a 4DCT scan, recalculated, scaled, and accumulated to the free breathing CT using deformable image registration. A segment of esophagus was contoured in the vicinity of treatment target. Esophagus dose volume histogram (DVH) was generated for both the original planned dose and the accumulated 4D dose for comparison. In parallel, we performed a chained deformable registration of 4DCT phase images to estimate the motion magnitude of the esophagus in a breathing cycle. We examined the correlation between the motion magnitude and the dosimetric deviation. Results: The esophageal motion mostly exhibited in the superior-inferior direction. The cross-sectional motion was small. Esophagus motion at T1 vertebra level (0.7 mm) is much smaller than that at T11 vertebra level (6.5 mm). The difference of Dmax between the original and 4D dose distributions ranged from 9.1 cGy (esophagus motion: 5.6 mm) to 231.1 cGy (esophagus motion: 3.1 mm). The difference of D(5cc) ranged from 5 cGy (esophagus motion: 3.1 mm) to 85 cGy (esophagus motion: 3.3 mm). There was no correlation between the dosimetric deviation and the motion magnitude. The V(11.9Gy)<5cc constraint was met for each patient when examining the DVH calculated from the 4D dose. Conclusion: Respiratory motion did not result in substantial dose increase to esophagus in spine SBRT. 4DCT simulation may not be necessary with regards to esophageal dose assessment.

  7. College Success and the Black Male. San Jose City College, San Jose, California. Research Report #128.

    Science.gov (United States)

    Carr, Percy; And Others

    In 1992, a study was conducted at San Jose City College (SJCC) and Evergreen Valley College (EVC), California, to examine the fourth semester persistence rates of black male students and to investigate the effect of SJCC athletic and athlete academic support programs on persistence. Study findings included the following: (1) new full-time (NFT)…

  8. Yeast Interacting Proteins Database: YER128W, YPR173C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available (MVB) protein sorting, ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane...(MVB) protein sorting, ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane

  9. 128 Gothicism/Ghost Stories in Nigerian Literature: Facts or Fiction ...

    African Journals Online (AJOL)

    Ike Odimegwu

    gloomy subterranean passages, people this castle with the usual middle-aged, brutish, arrogant and domineering feudal lord, along with nervous and talkative but faithful servants and the lovely, highly sensitive maiden, and the setting is as complete as it is unmistakably “gothic”. (31). In The Castle of Otranto, a gigantic ...

  10. FCJ-128 A Programmable Platform? Drupal, Modularity, and the Future of the Web

    Directory of Open Access Journals (Sweden)

    Fenwick McKelvey

    2011-10-01

    Full Text Available Sent as a walking advertisement of Canada’s technology sector, I arrived in Argentina to help a women’s rights organization develop a new website. I began using the Drupal content management platform to construct the site. Its interface brought me into the rarified world of web programming. My experience provides a way of entry into the Drupal platform – a platform I believe is re-programmable. The paper introduces the concept of re-programmability as a processes by which users and code interact to alter software’s running code, and works out this concept through the case of Drupal and how its modular code can be re-programmed by its users. The paper utilizes the theory of transduction to flip the critique of web2.0 platforms on its head – focusing on the processes of becoming a platform, rather than the platform as a final state. This offers a new line of critique for web2.0 platforms, namely how they enact their re-programming.

  11. Page 1 Revue Africaine de Sociologie 3(2) 1999, pp.99-128 ...

    African Journals Online (AJOL)

    une mise en délibérée du passé » pour en assurer une conjugaison au présent. La généalogie c'est la recherche des origines et des ancêtres, la reconstitution de la filiation en articulant vides et chaînons attestés, mélangeant faits et con- jectures, empruntant méthodes et techniques aux sciences naturelles et aux théories ...

  12. 128 Gothicism/Ghost Stories in Nigerian Literature: Facts or Fiction ...

    African Journals Online (AJOL)

    Ike Odimegwu

    Abstract. The English and African novels have different traditions which include Gothicism and ghost lore. These sub-genres of. Literature are attracting less attention from scholars due to their peculiarity in delving into such areas like the supernatural, the deserted and haunted buildings, the haunting shadows, the fanciful, ...

  13. Budgeting and Accounting in OECD Education Systems: A Literature Review. OECD Education Working Papers, No. 128

    Science.gov (United States)

    Fakharzadeh, Tala

    2016-01-01

    Recent demographic, economic and political trends have drawn attention to the issue of effectiveness and efficiency in the use of resources in the education sector. In the context of the renewed interest for the optimisation of resource use, this paper attempts to review the literature on budgeting and accounting in OECD education systems. The…

  14. PP128. Placental Caspase-3 gene polymorphisms is associated with preeclampsia.

    Science.gov (United States)

    Hsu, C-D; Polavarapu, S; Parton, L

    2012-07-01

    Increased placental trophoblastic apoptosis (programmed cell death) was previously reported in pregnancies complicated by preeclampsia. Caspase-3 is one of the key executioners of apoptosis. Caspase are expressed in many tissues including human placental trophoblast and other tissues. Variations in the promoter area of the Caspase genes may modulate apoptotic signaling, contributing to an increased risk of preeclampsia To determine if gene polymorphisms of Caspase 3 proteins differ between patient with and without preeclampsia. Forty-three singleton placentas were studied. Twenty-two placentas were with preeclampsia and 21 were normotensive controls. DNA was extracted from placentas using QIAAmp DNA Minikit. Genotyping of Caspase 3 +567 was determined by real-time PCR using the Applied Biosystems Prism 7900 HT SDS machine. Chi-square and Fisher's exact tests were used for statistical analysis. There were no significant differences in maternal age, parity or race between the two groups. Preeclamptic placentas had higher frequency of wild type TT of Caspase-3 SNP (+567) as compared with normotensive controls (59% versus 28.5%). Preeclamptic placentas expressed significantly more genotype of TT of Caspase-3 SNP (+567) than normotensive patients when compared to CC (p=0.02). The alle frequencies of the Caspase SNP (+567) in preeclampstic placentas were 0.77 and 0.23 for T and C, respectively, as compared to 0.52 and 0.48, respectively, in placentas from normotensive pregnancies. Immune intolerance of maternal and placental interaction plays an important role in the pathogenesis of preeclampsia. Increased of placental apoptosis was reported in pregnancy complicated with preeclamsia. Our findings indicate placental Caspase 3 (+567) gene polymorphisms is associated with preeclampsia. Altered placental alle frequencies and caspase-3 SNP (+567) in preeclampsia further suggests preeclampsia is a trophoblastic disorder. Copyright © 2012. Published by Elsevier B.V.

  15. Title list of documents made publicly available: February 1--28, 1995. Volume 17, Number 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-01

    This monthly publication contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR).

  16. Title list of documents made publicly available, February 1-28, 1998

    Energy Technology Data Exchange (ETDEWEB)

    Morris, E.B.

    1998-04-01

    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979.

  17. Yeast Interacting Proteins Database: YDR271C, YOR128C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available n Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative...YDR271C - Dubious open reading frame unlikely to encode a protein, based on available experimental and compa...rative sequence data; partially overlaps the verified ORF CCC2/YDR270W Rows with th

  18. 31 CFR 1.28 - Training, rules of conduct, penalties for non-compliance.

    Science.gov (United States)

    2010-07-01

    ... and within the scope of an authorized investigation, adjudication or correctional activity; (vi... Government officers or employees as follows: Any officer or employee of an agency (which term includes the...

  19. Applying the EBU R128 Loudness Standard in live streaming sound installations

    DEFF Research Database (Denmark)

    Riis, M.; Kirkegaard, Jonas Rasmussen; Højlund, M. K.

    2017-01-01

    This paper describes the development of a loudness-based compressor for live audio streams. The need for this device arose while developing the public sound art project The Overheard, which involves mixing together several live audio streams through a web based mixing interface. In order...... Data implementation and the necessary compromises enforced by the live streaming condition. Lastly observations regarding design challenges, related application areas and future goals are presented....

  20. 128 Étude de la dynamique stationnelle des populations des ...

    African Journals Online (AJOL)

    hadji

    Parasitologie comparée : Applications médicales et vétérinaires, Projet PARS BIO. BP 133, Faculté des. Sciences, Université Ibn Tofaïl, 14000 Kénitra, Maroc ..... Lutte Antipaludique, Manuel du personnel du secteur, Ministère de la sante, Royaume du Maroc, (1996), 78 pages. [2] - Louah A., Ramdani M., Saoud Y. et ...