Dingemans, Jozef; Poudyal, Bandita
2018-01-01
ABSTRACT The formation of inherently drug-tolerant biofilms by the opportunistic pathogen Pseudomonas aeruginosa requires the sensor-regulator hybrid SagS, with ΔsagS biofilms being unstructured and exhibiting increased antimicrobial susceptibility. Recent findings indicated SagS to function as a switch to control biofilm formation and drug tolerance independently. Moreover, findings suggested the periplasmic sensory HmsP domain of SagS is likely to be the control point in the regulation of biofilm formation and biofilm cells transitioning to a drug-tolerant state. We thus asked whether specific amino acid residues present in the HmsP domain contribute to the switch function of SagS. HmsP domain residues were therefore subjected to alanine replacement mutagenesis to identify substitutions that block the sensory function(s) of SagS, which is apparent by attached cells being unable to develop mature biofilms and/or prevent transition to an antimicrobial-resistant state. Mutant analyses revealed 32 residues that only contribute to blocking one sensory function. Moreover, amino acid residues affecting attachment and subsequent biofilm formation but not biofilm tolerance also impaired histidine kinase signaling via BfiS. In contrast, residues affecting biofilm drug tolerance but not attachment and subsequent biofilm formation negatively impacted BrlR transcription factor levels. Structure prediction suggested the two sets of residues affecting sensory functions are located in distinct areas that were previously described as being involved in ligand binding interactions. Taken together, these studies identify the molecular basis for the dual regulatory function of SagS. IMPORTANCE The membrane-bound sensory protein SagS plays a pivotal role in P. aeruginosa biofilm formation and biofilm cells gaining their heightened resistance to antimicrobial agents, with SagS being the control point at which both pathways diverge. Here, we demonstrate for the first time that the two
A Simple Sag Generator Using SSRs
DEFF Research Database (Denmark)
Senturk, Osman Selcuk; Hava, Ahmet M.
2010-01-01
conditions (critical loads) and this property often may not be accommodated inside the device itself and sag compensating power conditioners have been developed for such purposes. While in practice voltage sags are not wanted, generating sags becomes necessary for the purpose of experimentally verifying...... the performances of the equipment (both the equipment under sag condition and the sag compensating power conditioner) under sag conditions. In this work, a simple and economical, yet highly performing sag generator is developed, its design discussed, and its feasibility demonstrated by experiments. The proposed...... is evaluated and finally the utilization of the sag generator in the test of a series active filter based power quality conditioner is demonstrated. The proposed approach provides an effective solution for voltage sag generation....
The negative temperature coefficient resistivities of Ag2S-Ag core–shell structures
International Nuclear Information System (INIS)
Yu, Mingming; Liu, Dongzhi; Li, Wei; Zhou, Xueqin
2014-01-01
In this paper, the conductivity of silver nanoparticle films protected by 3-mercaptopropionic acid (Ag/MPA) has been investigated. When the nanoparticles were annealed in air at 200 °C, they converted to stable Ag 2 S-Ag core–shell structures. The mechanism for the formation of the Ag 2 S-Ag core–shell structures along with the compositional changes and the microstructural evolution of the Ag/MPA nanoparticles during the annealing process are discussed. It is proposed that the Ag 2 S-Ag core–shell structure was formed through a solid-state reduction reaction, in which the Ag + ions coming from Ag 2 S were reduced by sulfonate species and sulfur ions. The final Ag 2 S-Ag films display an exponentially decreased resistivity with increasing temperature from 25 to 170 °C. The negative temperature coefficient resistivity of Ag 2 S-Ag films can be adjusted by changing the S/Ag molar ratio used for the synthesis of the Ag/MPA nanoparticles, paving the way for the preparation of negative temperature-coefficient thermistors via printing technology for use in the electronics.
Crowdus, Carolyn A; Marsh, Antoinette E; Saville, Willliam J; Lindsay, David S; Dubey, J P; Granstrom, David E; Howe, Daniel K
2008-11-25
Sarcocystis neurona is an obligate intracellular parasite that causes equine protozoal myeloencephalitis (EPM). Previous work has identified a gene family of paralogous surface antigens in S. neurona called SnSAGs. These surface proteins are immunogenic in their host animals, and are therefore candidate molecules for development of diagnostics and vaccines. However, SnSAG diversity exists in strains of S. neurona, including the absence of the major surface antigen gene SnSAG1. Instead, sequence for an alternative SnSAG has been revealed in two of the SnSAG1-deficient strains. Herein, we present data characterizing this new surface protein, which we have designated SnSAG5. The results indicated that the protein encoded by the SnSAG5 sequence is indeed a surface-associated molecule that has characteristics consistent with the other SAGs identified in S. neurona and related parasites. Importantly, Western blot analyses of a collection of S. neurona strains demonstrated that 6 of 13 parasite isolates express SnSAG5 as a dominant surface protein instead of SnSAG1. Conversely, SnSAG5 was not detected in SnSAG1-positive strains. One strain, which was isolated from the brain of a sea otter, did not express either SnSAG1 or SnSAG5. Genetic analysis with SnSAG5-specific primers confirmed the presence of the SnSAG5 gene in Western blot-positive strains, while also suggesting the presence of a novel SnSAG sequence in the SnSAG1-deficient, SnSAG5-deficient otter isolate. The findings provide further indication of S. neurona strain diversity, which has implications for diagnostic testing and development of vaccines against EPM as well as the population biology of Sarcocystis cycling in the opossum definitive host.
An Estimation Method of System Voltage Sag Profile using Recorded Sag Data
Tanaka, Kazuyuki; Sakashita, Tadashi
The influence of voltage sag to electric equipment has become big issues because of wider utilization of voltage sensitive devices. In order to reduce the influence of voltage sag appearing at each customer side, it is necessary to recognize the level of receiving voltage drop due to lightning faults for transmission line. However it is hard to measure directly those sag level at every load node. In this report, a new method of efficiently estimating system voltage sag profile is proposed based on symmetrical coordinate. In the proposed method, limited recorded sag data is used as the estimation condition which is recorded at each substation in power systems. From the point of view that the number of the recorded node is generally far less than those of the transmission route, a fast solution method is developed to calculate only recorder faulted voltage by applying reciprocity theorem for Y matrix. Furthermore, effective screening process is incorporated, in which the limited candidate of faulted transmission line can be chosen. Demonstrative results are presented using the IEEJ East10 standard system and actual 1700 bus system. The results show that estimation accuracy is sufficiently acceptable under less computation labor.
Howe, Daniel K; Gaji, Rajshekhar Y; Mroz-Barrett, Meaghan; Gubbels, Marc-Jan; Striepen, Boris; Stamper, Shelby
2005-02-01
Sarcocystis neurona is a member of the Apicomplexa that causes myelitis and encephalitis in horses but normally cycles between the opossum and small mammals. Analysis of an S. neurona expressed sequence tag (EST) database revealed four paralogous proteins that exhibit clear homology to the family of surface antigens (SAGs) and SAG-related sequences of Toxoplasma gondii. The primary peptide sequences of the S. neurona proteins are consistent with the two-domain structure that has been described for the T. gondii SAGs, and each was predicted to have an amino-terminal signal peptide and a carboxyl-terminal glycolipid anchor addition site, suggesting surface localization. All four proteins were confirmed to be membrane associated and displayed on the surface of S. neurona merozoites. Due to their surface localization and homology to T. gondii surface antigens, these S. neurona proteins were designated SnSAG1, SnSAG2, SnSAG3, and SnSAG4. Consistent with their homology, the SnSAGs elicited a robust immune response in infected and immunized animals, and their conserved structure further suggests that the SnSAGs similarly serve as adhesins for attachment to host cells. Whether the S. neurona SAG family is as extensive as the T. gondii SAG family remains unresolved, but it is probable that additional SnSAGs will be revealed as more S. neurona ESTs are generated. The existence of an SnSAG family in S. neurona indicates that expression of multiple related surface antigens is not unique to the ubiquitous organism T. gondii. Instead, the SAG gene family is a common trait that presumably has an essential, conserved function(s).
Howe, Daniel K.; Gaji, Rajshekhar Y.; Mroz-Barrett, Meaghan; Gubbels, Marc-Jan; Striepen, Boris; Stamper, Shelby
2005-01-01
Sarcocystis neurona is a member of the Apicomplexa that causes myelitis and encephalitis in horses but normally cycles between the opossum and small mammals. Analysis of an S. neurona expressed sequence tag (EST) database revealed four paralogous proteins that exhibit clear homology to the family of surface antigens (SAGs) and SAG-related sequences of Toxoplasma gondii. The primary peptide sequences of the S. neurona proteins are consistent with the two-domain structure that has been described for the T. gondii SAGs, and each was predicted to have an amino-terminal signal peptide and a carboxyl-terminal glycolipid anchor addition site, suggesting surface localization. All four proteins were confirmed to be membrane associated and displayed on the surface of S. neurona merozoites. Due to their surface localization and homology to T. gondii surface antigens, these S. neurona proteins were designated SnSAG1, SnSAG2, SnSAG3, and SnSAG4. Consistent with their homology, the SnSAGs elicited a robust immune response in infected and immunized animals, and their conserved structure further suggests that the SnSAGs similarly serve as adhesins for attachment to host cells. Whether the S. neurona SAG family is as extensive as the T. gondii SAG family remains unresolved, but it is probable that additional SnSAGs will be revealed as more S. neurona ESTs are generated. The existence of an SnSAG family in S. neurona indicates that expression of multiple related surface antigens is not unique to the ubiquitous organism T. gondii. Instead, the SAG gene family is a common trait that presumably has an essential, conserved function(s). PMID:15664946
Gupta, Kajal; Marques, Cláudia N. H.; Petrova, Olga E.
2013-01-01
A hallmark characteristic of biofilms is their extraordinary tolerance to antimicrobial agents. While multiple factors are thought to contribute to the high level of antimicrobial tolerance of biofilms, little is known about the timing of induction of biofilm tolerance. Here, we asked when over the course of their development do biofilms gain their tolerance to antimicrobial agents? We demonstrate that in Pseudomonas aeruginosa, biofilm tolerance is linked to biofilm development, with transition to the irreversible attachment stage regulated by the two-component hybrid SagS, marking the timing when biofilms switch to the high-level tolerance phenotype. Inactivation of sagS rendered biofilms but not planktonic cells more susceptible to tobramycin, norfloxacin, and hydrogen peroxide. Moreover, inactivation of sagS also eliminated the recalcitrance of biofilms to killing by bactericidal antimicrobial agents, a phenotype comparable to that observed upon inactivation of brlR, which encodes a MerR-like transcriptional regulator required for biofilm tolerance. Multicopy expression of brlR in a ΔsagS mutant restored biofilm resistance and recalcitrance to killing by bactericidal antibiotics to wild-type levels. In contrast, expression of sagS did not restore the susceptibility phenotype of ΔbrlR mutant biofilms to wild-type levels, indicating that BrlR functions downstream of SagS. Inactivation of sagS correlated with reduced BrlR levels in biofilms, with the produced BrlR being impaired in binding to the previously described BrlR-activated promoters of the two multidrug efflux pump operons mexAB-oprM and mexEF-oprN. Our findings demonstrate that biofilm tolerance is linked to early biofilm development and SagS, with SagS contributing indirectly to BrlR activation. PMID:23995639
Reed, S M; Howe, D K; Morrow, J K; Graves, A; Yeargan, M R; Johnson, A L; MacKay, R J; Furr, M; Saville, W J A; Williams, N M
2013-01-01
Recent work demonstrated the value of antigen-specific antibody indices (AI and C-value) to detect intrathecal antibody production against Sarcocystis neurona for antemortem diagnosis of equine protozoal myeloencephalitis (EPM). The study was conducted to assess whether the antigen-specific antibody indices can be reduced to a simple serum : cerebrospinal fluid (CSF) titer ratio to achieve accurate EPM diagnosis. Paired serum and CSF samples from 128 horses diagnosed by postmortem examination. The sample set included 44 EPM cases, 35 cervical-vertebral malformation (CVM) cases, 39 neurologic cases other than EPM or CVM, and 10 non-neurologic cases. Antibodies against S. neurona were measured in serum and CSF pairs using the SnSAG2 and SnSAG4/3 (SnSAG2, 4/3) ELISAs, and the ratio of each respective serum titer to CSF titer was determined. Likelihood ratios and diagnostic sensitivity and specificity were calculated based on serum titers, CSF titers, and serum : CSF titer ratios. Excellent diagnostic sensitivity and specificity was obtained from the SnSAG2, 4/3 serum : CSF titer ratio. Sensitivity and specificity of 93.2 and 81.1%, respectively, were achieved using a ratio cutoff of ≤100, whereas sensitivity and specificity were 86.4 and 95.9%, respectively, if a more rigorous cutoff of ≤50 was used. Antibody titers in CSF also provided good diagnostic accuracy. Serum antibody titers alone yielded much lower sensitivity and specificity. The study confirms the value of detecting intrathecal antibody production for antemortem diagnosis of EPM, and they further show that the antigen-specific antibody indices can be reduced in practice to a simple serum : CSF titer ratio. Copyright © 2013 by the American College of Veterinary Internal Medicine.
Traffic Flow at Sags : Theory, Modeling and Control
Goni-Ros, B.
2016-01-01
Sag vertical curves (sags) are roadway sections along which the gradient increases gradually in the direction of traffic. Empirical observations show that, on freeways, traffic congestion often occurs at sags; actually, in some countries (e.g., Japan), sags are one of the most common types of
Installation of the sag compensator for HANARO
International Nuclear Information System (INIS)
Kim, Hyung Kyoo; Jung, Hoan Sung; Lim, In Cheol; Ahn, Guk Hoon
2008-01-01
Electric power is essential for all industrial plants and also for nuclear facilities. HANARO is a research reactor which produces a 30MW thermal power. HANARO is designed to be tripped automatically when interruptions or some extent of sags occur. HANARO has the reactor regulation system(RRs) and reactor protection system(RPS). HANARO is designed so as to be tripped automatically by insertion of control absorber rods(CAR) and shut off rods(SOR). When voltage sag or momentary interruption occurs, the reactor has an unwanted trip by insertion of CARs and SORs even though the process systems are still in operation. HANARO was experienced in a nuisance trip as often as the unexpected voltage sag and/or momentary interruption occurs. We installed the voltage sag compensator voltage sag assessment of the AC coil contactor which is a component of the power supply unit for the SORs. The compensation time is determined to be less than 1 sec in consideration of the reactor safety. This paper is concerned with the impact of the momentary interruption on the reactor and the effect of the voltage sag compensator
Synthesis, morphological control, and antibacterial properties of hollow/solid Ag2S/Ag heterodimers
Pang, Maolin
2010-08-11
Ag2S and Ag are important functional materials that have received considerable research interest in recent years. In this work, we develop a solution-based synthetic method to combine these two materials into hollow/solid Ag2S/Ag heterodimers at room temperature. Starting from monodisperse Cu2O solid spheres, CuS hollow spheres can be converted from Cu2O through a modified Kirkendall process, and the obtained CuS can then be used as a solid precursor for preparation of the Ag2S/Ag heterodimers through ion exchange and photo-assisted reduction. We have found that formation of the Ag2S/Ag heterodimers is instantaneous, and the size of Ag nanocrystals on the hollow spheres of Ag2S can be controlled by changing the concentration and power of reducing agents in the synthesis. The growth of Ag nanoparticles on hollow spheres of Ag2S in the dimers is along the [111] direction of the silver crystal; the light absorption properties have also been investigated. Furthermore, coupling or tripling of Ag2S/Ag heterodimers into dumbbell-like trimers ((Ag 2S)2/Ag, linear) and triangular tetramers ((Ag 2S)3/Ag, coplanar) can also be attained at 60°C by adding the bidentate ligand ethylenediamine as a cross-linking agent. To test the applicability of this highly asymmetric dipolar composite, photocatalytic inactivation of Escherichia coli K-12 in the presence of the as-prepared Ag 2S/Ag heterodimers has been carried out under UV irradiation. The added Ag2S/Ag heterodimers show good chemical stability under prolonged UV irradiation, and no appreciable solid dissolution is found. Possible mechanisms regarding the enhanced antibacterial activity have also been addressed. © 2010 American Chemical Society.
Installation of the sag compensator for HANARO
International Nuclear Information System (INIS)
Kim, Hyungkyoo; Jung, Hoansung; Lim, Incheol; Ahn, Gukhoon
2008-01-01
Electric power is essential for all industrial plants and also for nuclear facilities. HANARO is a research reactor which produces a 30 MW thermal power. HANARO is designed to be tripped automatically when interruptions or some extent of sags occur. HANARO has the reactor regulation system(RRS) and reactor protection system(RPS). HANARO is designed so as to be tripped automatically by insertion of control absorber rods(CAR) and shut-off rods(SOR). When voltage sag or momentary interruption occurs, the reactor has an unwanted trip by insertion of CARs and SORs even though the process systems are still in operation. HANARO was experienced in a nuisance trip as often as the unexpected voltage sag and/or momentary interruption occurs. We installed the voltage sag compensator on the power supply for CARs and SORs so as to prevent an unwanted trip. We undertook voltage sag assessment of the AC coil contactor which is a component of the power supply unit for the SORs. The compensation time is determined to be less than 1 sec in consideration of the reactor safety. This paper is concerned with the impact of the momentary interruption on the reactor and the effect of the voltage sag compensator. (author)
Macroeconomic Assessment of Voltage Sags
Directory of Open Access Journals (Sweden)
Sinan Küfeoğlu
2016-12-01
Full Text Available The electric power sector has changed dramatically since the 1980s. Electricity customers are now demanding uninterrupted and high quality service from both utilities and authorities. By becoming more and more dependent on the voltage sensitive electronic equipment, the industry sector is the one which is affected the most by voltage disturbances. Voltage sags are one of the most crucial problems for these customers. The utilities, on the other hand, conduct cost-benefit analyses before going through new investment projects. At this point, understanding the costs of voltage sags become imperative for planning purposes. The characteristics of electric power consumption and hence the susceptibility against voltage sags differ considerably among different industry subsectors. Therefore, a model that will address the estimation of worth of electric power reliability for a large number of customer groups is necessary. This paper introduces a macroeconomic model to calculate Customer Voltage Sag Costs (CVSCs for the industry sector customers. The proposed model makes use of analytical data such as value added, annual energy consumption, working hours, and average outage durations and provides a straightforward, credible, and easy to follow methodology for the estimation of CVSCs.
A Simple Sag Generator Using SSRs
DEFF Research Database (Denmark)
Senturk, Osman Selcuk; Hava, Ahmet M.
2012-01-01
SSR (solid state relay, a semiconductor power module of triac characteristics) and variable transformer (variac) based sag generator is built for three-phase 10kVA ratings and balanced/imbalanced voltage sags are demonstrated in the laboratory. The performance under resistive and inductive loads...
Model Predictive Control for an Industrial SAG Mill
DEFF Research Database (Denmark)
Ohan, Valeriu; Steinke, Florian; Metzger, Michael
2012-01-01
identication. When applied to MIMO systems we call this controller a MIMO-ARX based MPC. We use an industrial Semi-Autogenous Grinding (SAG) mill to illustrate the performance of this controller. SAG mills are the primary units in a grinding chain and also the most power consuming units. Therefore, improved...... control of SAG mills has the potential to signicantly improve eciency and reduce the specic energy consumption for mineral processes. Grinding circuits involving SAG mills are multivariate processes. Commissioning of a control system based on a classical single-loop controllers with logic is time...
Yeargan, Michelle R; Howe, Daniel K
2011-02-28
Equine protozoal myeloencephalitis (EPM) is a common neurologic disease of horses that is caused by the apicomplexan pathogen Sarcocystis neurona. To help improve serologic diagnosis of S. neurona infection, we have modified existing enzyme-linked immunosorbent assays (ELISAs) based on the immunogenic parasite surface antigens SnSAG2, SnSAG3, and SnSAG4 to make the assays polyvalent, thereby circumventing difficulties associated with parasite antigenic variants and diversity in equine immune responses. Two approaches were utilized to achieve polyvalence: (1) mixtures of the individual recombinant SnSAGs (rSnSAGs) were included in single ELISAs; (2) a collection of unique SnSAG chimeras that fused protein domains from different SnSAG surface antigens into a single recombinant protein were generated for use in the ELISAs. These new assays were assessed using a defined sample set of equine sera and cerebrospinal fluids (CSFs) that had been characterized by Western blot and/or were from confirmed EPM horses. While all of the polyvalent ELISAs performed relatively well, the highest sensitivity and specificity (100%/100%) were achieved with assays containing the rSnSAG4/2 chimera (Domain 1 of SnSAG4 fused to SnSAG2) or using a mixture of rSnSAG3 and rSnSAG4. The rSnSAG4 antigen alone and the rSnSAG4/3 chimera (Domain 1 of SnSAG4 fused to Domain 2 of SnSAG3) exhibited the next best accuracy at 95.2% sensitivity and 100% specificity. Binding ratios and percent positivity (PP) ratios, determined by comparing the mean values for positive versus negative samples, showed that the most advantageous signal to noise ratios were provided by rSnSAG4 and the rSnSAG4/3 chimera. Collectively, our results imply that a polyvalent ELISA based on SnSAG4 and SnSAG3, whether as a cocktail of two proteins or as a single chimeric protein, can give optimal results in serologic testing of serum or CSF for the presence of antibodies against S. neurona. The use of polyvalent SnSAG ELISAs will
Directory of Open Access Journals (Sweden)
Mingjia Tan
2006-12-01
Full Text Available Skp1-cullin-F-box protein (SCF is a multicomponent E3 ubiquitin (Ub ligase that ubiquitinates a number of important biologic molecules such as p27, β-catenin, and lκB for proteasomal degradation, thus regulating cell proliferation and survival. One SCF component, SAG/ROC2/Rbx2/Hrt2, a RING finger protein, was first identified as a redox-inducible protein, which, when overexpressed, inhibited apoptosis both in vitro and in vivo. We report here that sensitive to apoptosis gene (SAG, as well as its family member ROC1/Rbxi, bound to the proinactive form of caspase-3 (pro-caspase-3. Binding was likely mediated through F-box protein, β-transducin repeat-containing protein (β-TrCP, which binds to the first 38 amino acids of pro-caspase-3. Importantly, β-TrCP1 expression significantly shortened the protein half-life of pro-caspase-3, whereas expression of a dominant-negative β-TrCP1 mutant with the F-box domain deleted extended it. An in vitro ubiquitination assay showed that SAG/ROC-SCF -Trcp promoted ubiquitination of pro-caspase-3. Furthermore, endogenous levels of pro-caspase-3 were decreased by overexpression of SAG/ROC-SCFβ-TrCP E3 Ub ligases, but increased on siRNA silencing of SAG, regulator of cullin-1 (ROC1, or β-TrCPs, leading to increased apoptosis by etoposide and TNF-related apoptosis-inducing ligand through increased activation of caspase-3. Thus, pro-caspase-3 appears to be a substrate of SAG/ROC-SCFβ-TrCP E3 Ub ligase, which protects cells from apoptosis through increased apoptosis threshold by reducing the basal level of pro-caspase-3.
Yeargan, Michelle; de Assis Rocha, Izabela; Morrow, Jennifer; Graves, Amy; Reed, Stephen M; Howe, Daniel K
2015-05-01
Enzyme-linked immunosorbent assays (ELISAs) based on the SnSAG surface antigens of Sarcocystis neurona provide reliable detection of infection by the parasite. Moreover, accurate serodiagnosis of equine protozoal myeloencephalitis (EPM) is achieved with the SnSAG ELISAs by measuring antibodies in serum and cerebrospinal fluid (CSF) to reveal active infection in the central nervous system. Two independent ELISAs based on recombinant (r)SnSAG2 or a chimeric fusion of SnSAG3 and SnSAG4 (rSnSAG4/3) are currently used together for EPM serodiagnosis to overcome varied antibody responses in different horses. To achieve reliable antibody detection with a single ELISA instead of 2 separate ELISAs, rSnSAG2 was fused with rSnSAG4/3 into a single trivalent protein, designated rSnSAG2/4/3. Paired serum and CSF from 163 horses were tested with all 3 ELISAs. When the consensus antibody titers obtained with the rSnSAG2 and rSnSAG4/3 ELISAs were compared to the single SAG2/4/3 ELISA titers, Spearman rank correlation coefficients of ρ = 0.74 and ρ = 0.90 were obtained for serum and CSF, respectively, indicating strong agreement between the tests. When the rSnSAG2 and rSnSAG4/3 consensus serum-to-CSF titer ratio was compared to the rSnSAG2/4/3 serum-to-CSF titer ratio, the Spearman correlation coefficient was ρ = 0.87, again signifying strong agreement. Importantly, comparing the diagnostic interpretation of the serum-to-CSF titer ratios yielded a Cohen kappa value of 0.77. These findings suggest that the single ELISA based on the trivalent rSnSAG2/4/3 will provide serologic and diagnostic results that are highly comparable to the consensus of the 2 independent ELISAs based on rSnSAG2 and rSnSAG4/3. © 2015 The Author(s).
Synthesis, morphological control, and antibacterial properties of hollow/solid Ag2S/Ag heterodimers
Pang, Maolin; Hu, Jiangyong; Zeng, Huachun
2010-01-01
of this highly asymmetric dipolar composite, photocatalytic inactivation of Escherichia coli K-12 in the presence of the as-prepared Ag 2S/Ag heterodimers has been carried out under UV irradiation. The added Ag2S/Ag heterodimers show good chemical stability under
Facile synthesis, structure, and properties of Ag{sub 2}S/Ag heteronanostructure
Energy Technology Data Exchange (ETDEWEB)
Sadovnikov, S. I., E-mail: sadovnikov@ihim.uran.ru; Gusev, A. I. [Ural Branch of the Russian Academy of Sciences, Institute of Solid State Chemistry (Russian Federation)
2016-09-15
Ag{sub 2}S/Ag heteronanostructure has been produced by a simple one-stage chemical deposition from aqueous solutions of silver nitrate, sodium sulfide, and sodium citrate with the use of monochromatic light irradiation. For simultaneous synthesis of Ag{sub 2}S and Ag nanoparticles, deposition has been performed from reaction mixtures with reduced sodium sulfide concentration. The size of Ag{sub 2}S and Ag nanoparticles is 45–50 and 15–20 nm, respectively. It is established that in the contact layer between silver sulfide and silver, nonconducting α-Ag{sub 2}S acanthite transforms into superionic β-Ag{sub 2}S argentite under the action of external electric field. The scheme of the operation of a resistive switch based on an Ag{sub 2}S/Ag heteronanostructure is proposed. The UV–Vis optical absorption spectra of colloidal solutions of Ag{sub 2}S/Ag heteronanostructures have been studied.Graphical Abstract.
Installation of the sag compensator for HANARO
International Nuclear Information System (INIS)
Kim, H. K.; Jung, H. S.; Ahn, G. H.; Lim, I. C.
2008-01-01
Electric power is essential for all industrial plants and also for nuclear facilities. HANARO is a research reactor which produces a 30MW thermal power. HANARO is designed to be tripped automatically when interruptions or some extents of sags occur. HANARO has the reactor regulation system (RRS) and reactor protection system (RPS). HANARO is designed so as to tripped automatically by insertion of control absorber rods (CAR) and shut-off rods (SOR). When voltage or momentary interruption occurs, the reactor has an unwanted trip by insertion of CARs and SORs even though the process systems are still in operation. HANARO was experienced in a nuisance trip as often as the unexpected voltage sag and/or momentary interruption occurs. We installed the voltage sag compensator on the power supply for CARs and SORs so as to prevent an unwanted trip. We undertook voltage sag assessment of the AC coil contactor which is a component of the power supply unit for the SORs. The compensation time is determined to be less than 1 sec in consideration of the reactor safety. This paper is concerned with the impact of the momentary interruption on the reactor and the effect of the voltage sag compensator
A new approach to voltage sag detection based on wavelet transform
Energy Technology Data Exchange (ETDEWEB)
Gencer, Oezguer; Oeztuerk, Semra; Erfidan, Tarik [Kocaeli University, Faculty of Engineering, Department of Electrical Engineering, Veziroglu Kampuesue, Eski Goelcuek Yolu, Kocaeli (Turkey)
2010-02-15
In this work, a new voltage sag detection method based on wavelet transform is developed. Voltage sag detection algorithms, so far have proved their efficiency and computational ability. Using several windowing techniques take long computational times for disturbance detection. Also researchers have been working on separating voltage sags from other voltage disturbances for the last decade. Due to increasing power quality standards new high performance disturbance detection algorithms are necessary to obtain high power quality standards. For this purpose, the wavelet technique is used for detecting voltage sag duration and magnitude. The developed voltage sag detection algorithm is implemented with high speed microcontroller. Test results show that, the new approach provides very accurate and satisfactory voltage sag detection. (author)
Voltage sags impact on CAR and SOR of HANARO
International Nuclear Information System (INIS)
Kim, Hyung Kyoo; Jung, Hoan Sung; Wu, Jong Sup
2004-01-01
The combination of the unstable electric power and sensitive equipment may cause the nuisance of reactor trip. The reactor is tripped by the RRS and RPS during the occurrence of the voltage sags or momentary interruptions. We tested the components of RRS and RPS for the immunity from voltage sags and momentary interruptions. The tested components are DC power supply for CAR (control absorbed rod) of RRS and AC coil contactor for SOR (shut off rod) of RPS. We briefly describe the power quality standard for the voltage sags. This paper summarizes the magnitudes and durations of the voltage sags which impact on the CAR and SOR system
Gautam, A; Dubey, J P; Saville, W J; Howe, D K
2011-12-29
Sarcocystis neurona is a two-host coccidian parasite whose complex life cycle progresses through multiple developmental stages differing at morphological and molecular levels. The S. neurona merozoite surface is covered by multiple, related glycosylphosphatidylinositol-linked proteins, which are orthologous to the surface antigen (SAG)/SAG1-related sequence (SRS) gene family of Toxoplasma gondii. Expression of the SAG/SRS proteins in T. gondii and another related parasite Neospora caninum is life-cycle stage specific and seems necessary for parasite transmission and persistence of infection. In the present study, the expression of S. neurona merozoite surface antigens (SnSAGs) was evaluated in the sporozoite and bradyzoite stages. Western blot analysis was used to compare SnSAG expression in merozoites versus sporozoites, while immunocytochemistry was performed to examine expression of the SnSAGs in merozoites versus bradyzoites. These analyses revealed that SnSAG2, SnSAG3 and SnSAG4 are expressed in sporozoites, while SnSAG5 was appeared to be downregulated in this life cycle stage. In S. neurona bradyzoites, it was found that SnSAG2, SnSAG3, SnSAG4 and SnSAG5 were either absent or expression was greatly reduced. As shown for T. gondii, stage-specific expression of the SnSAGs may be important for the parasite to progress through its developmental stages and complete its life cycle successfully. Thus, it is possible that the SAG switching mechanism by these parasites could be exploited as a point of intervention. As well, the alterations in surface antigen expression during different life cycle stages may need to be considered when designing prospective approaches for protective vaccination. Copyright © 2011 Elsevier B.V. All rights reserved.
Research on uncertainty evaluation measure and method of voltage sag severity
Liu, X. N.; Wei, J.; Ye, S. Y.; Chen, B.; Long, C.
2018-01-01
Voltage sag is an inevitable serious problem of power quality in power system. This paper focuses on a general summarization and reviews on the concepts, indices and evaluation methods about voltage sag severity. Considering the complexity and uncertainty of influencing factors, damage degree, the characteristics and requirements of voltage sag severity in the power source-network-load sides, the measure concepts and their existing conditions, evaluation indices and methods of voltage sag severity have been analyzed. Current evaluation techniques, such as stochastic theory, fuzzy logic, as well as their fusion, are reviewed in detail. An index system about voltage sag severity is provided for comprehensive study. The main aim of this paper is to propose thought and method of severity research based on advanced uncertainty theory and uncertainty measure. This study may be considered as a valuable guide for researchers who are interested in the domain of voltage sag severity.
Voltage sags: Their impact on the utility and industrial customers
International Nuclear Information System (INIS)
Davis, T.; Beam, G.E.; Melhorn, C.J.
1995-01-01
This paper describes the impact of voltage sags on the utility and industrial customers. Several utility measures are presented to minimize the customer's exposure to voltage sags. However, these measures cannot completely eliminate the impact of voltage sags on sensitive equipment. A case study is presented in this paper that includes measurement results that were used to characterize the voltage sags experienced on the utility system and in the industrial facility, simulation results that were used to develop area of vulnerability curves for the industrial facility, mitigation equipment that was employed to improve the sensitive equipment's ride through capability, and the lessons learned from the systems approach analysis
Quantifying the gantry sag on linear accelerators and introducing an MLC-based compensation strategy
Energy Technology Data Exchange (ETDEWEB)
Du Weiliang; Gao Song; Wang Xiaochun; Kudchadker, Rajat J. [Department of Radiation Physics, University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States)
2012-04-15
Purpose: Gantry sag is one of the well-known sources of mechanical imperfections that compromise the spatial accuracy of radiation dose delivery. The objectives of this study were to quantify the gantry sag on multiple linear accelerators (linacs), to investigate a multileaf collimator (MLC)-based strategy to compensate for gantry sag, and to verify the gantry sag and its compensation with film measurements. Methods: The authors used the Winston-Lutz method to measure gantry sag on three Varian linacs. A ball bearing phantom was imaged with megavolt radiation fields at 10 deg. gantry angle intervals. The images recorded with an electronic portal imaging device were analyzed to derive the radiation isocenter and the gantry sag, that is, the superior-inferior wobble of the radiation field center, as a function of the gantry angle. The authors then attempted to compensate for the gantry sag by applying a gantry angle-specific correction to the MLC leaf positions. The gantry sag and its compensation were independently verified using film measurements. Results: Gantry sag was reproducible over a six-month measurement period. The maximum gantry sag was found to vary from 0.7 to 1.0 mm, depending on the linac and the collimator angle. The radiation field center moved inferiorly (i.e., away from the gantry) when the gantry was rotated from 0 deg. to 180 deg. After the MLC leaf position compensation was applied at 90 deg. collimator angle, the maximum gantry sag was reduced to <0.2 mm. The film measurements at gantry angles of 0 deg. and 180 deg. verified the inferior shift of the radiation fields and the effectiveness of MLC compensation. Conclusions: The results indicate that gantry sag on a linac can be quantitatively measured using a simple phantom and an electronic portal imaging device. Reduction of gantry sag is feasible by applying a gantry angle-specific correction to MLC leaf positions at 90 deg. collimator angle.
A rationale for the observed non-linearity in pressure tube creep sag with time in service
International Nuclear Information System (INIS)
Sedran, P.J.
2013-01-01
In 2012, a paper was presented at the CNS SGC Conference which included an explanation for measured non-linear trends in Pressure Tube (PT) creep sag. The section of the 2012 paper covering this topic was revised and is presented as the main subject of this paper. The practical applications for the prediction of long-term Fuel Channel (FC) creep sag include the analysis of Calandria Tube - Liquid Injection Nozzle (CT-LIN) contact, and fuel passage and PT replacement assessments. The current practice for predicting FC creep sag in life cycle management applications is to use a linear model for creep sag versus time in service. However, PT sag measurements from the Point Lepreau Generating Station (PLGS) and Gentilly-2 (G-2) have displayed a non-linear trend with a creep sag rate that is decreasing with time in service. As an example, for PT F06 in PLGS, a 60% reduction in the nominal creep sag rate was observed for measurements taken 18 years apart. Subsequently, it was found that a 56% reduction in the creep sag rate for F06 over 18 years could be attributed to a fundamental geometric property of the PT creep sag profile. In addition, a further 1.6% decrease in the creep sag rate of the CT over the same period could be attributed to bending stress reductions due to the deformation of the CT. The resultant reduction in the PT creep sag rate for F06 was predicted to be 57.6%, closely matching the observed PT creep sag rate reduction of 60%. Therefore, this paper provides a rationale to explain the observed non-linear trends in PT creep sag, the use of which could benefit stations engaging in asset management as a means of FC life extension. This paper presents a summary of the worked performed to correlate the observed reductions in PT creep sag rate to the geometrical properties of the PT creep sag profile and the predicted bending stress reductions in the CT. (author)
Transmission line sag calculations using interval mathematics
Energy Technology Data Exchange (ETDEWEB)
Shaalan, H. [Institute of Electrical and Electronics Engineers, Washington, DC (United States)]|[US Merchant Marine Academy, Kings Point, NY (United States)
2007-07-01
Electric utilities are facing the need for additional generating capacity, new transmission systems and more efficient use of existing resources. As such, there are several uncertainties associated with utility decisions. These uncertainties include future load growth, construction times and costs, and performance of new resources. Regulatory and economic environments also present uncertainties. Uncertainty can be modeled based on a probabilistic approach where probability distributions for all of the uncertainties are assumed. Another approach to modeling uncertainty is referred to as unknown but bounded. In this approach, the upper and lower bounds on the uncertainties are assumed without probability distributions. Interval mathematics is a tool for the practical use and extension of the unknown but bounded concept. In this study, the calculation of transmission line sag was used as an example to demonstrate the use of interval mathematics. The objective was to determine the change in cable length, based on a fixed span and an interval of cable sag values for a range of temperatures. The resulting change in cable length was an interval corresponding to the interval of cable sag values. It was shown that there is a small change in conductor length due to variation in sag based on the temperature ranges used in this study. 8 refs.
Power conditioning using dynamic voltage restorers under different voltage sag types.
Saeed, Ahmed M; Abdel Aleem, Shady H E; Ibrahim, Ahmed M; Balci, Murat E; El-Zahab, Essam E A
2016-01-01
Voltage sags can be symmetrical or unsymmetrical depending on the causes of the sag. At the present time, one of the most common procedures for mitigating voltage sags is by the use of dynamic voltage restorers (DVRs). By definition, a DVR is a controlled voltage source inserted between the network and a sensitive load through a booster transformer injecting voltage into the network in order to correct any disturbance affecting a sensitive load voltage. In this paper, modelling of DVR for voltage correction using MatLab software is presented. The performance of the device under different voltage sag types is described, where the voltage sag types are introduced using the different types of short-circuit faults included in the environment of the MatLab/Simulink package. The robustness of the proposed device is evaluated using the common voltage sag indices, while taking into account voltage and current unbalance percentages, where maintaining the total harmonic distortion percentage of the load voltage within a specified range is desired. Finally, several simulation results are shown in order to highlight that the DVR is capable of effective correction of the voltage sag while minimizing the grid voltage unbalance and distortion, regardless of the fault type.
Responsive demand to mitigate slow recovery voltage sags
DEFF Research Database (Denmark)
Garcia-Valle, Rodrigo; da Silva, Luiz Carlos Pereira; Xu, Zhao
2012-01-01
, and reactive power reserve for peak load management through price responsive methods and also as energy providers through embedded generation technologies. This article introduces a new technology, called demand as voltagecontrolled reserve, which can help mitigation of momentary voltage sags. The technology...... faults. This article presents detailed models, discussion, and simulation tests to demonstrate the technical viability and effectiveness of the demand as voltage-controlled reserve technology for mitigating voltage sags....... can be provided by thermostatically controlled loads as well as other types of load. This technology has proven to be effective in distribution systems with a large composition of induction motors, when voltage sags present slow recovery characteristics because of the deceleration of the motors during...
The sagging rope sign in achondroplasia - different from Perthes' disease
International Nuclear Information System (INIS)
Shingade, Viraj U.; Song, Hae-Ryong; Lee, Seok-Hyun; Suh, Seung-Woo; Oh, Chang-Wug; Hong, Jun-Seok
2006-01-01
The sagging rope sign is a radio-opaque line, seen on radiographs of the hips, with Perthes' disease. The main purpose of this study was to determine the incidence, cause and importance of this sign in achondroplasia, and to reveal how it differs from in Perthes' disease. Serial radiograms, along with 2-dimensional and 3-dimensional CT images were studied in 42 achondroplasic patients. Forty-two achondroplasic patients, reported at our institute (for routine outpatient consultation, spine surgeries, deformity corrections, limb-lengthening procedures) were included in this study. There were 26 males and 16 females. The sign was observed bilaterally, in all patients. Evaluation of CT images revealed spherical heads, with presence of circumferential overhang in all hips. This circumferential overhang, seen on 3-D CT scan, corresponded to the sagging rope sign on radiographs. Presence of the sagging rope sign in bilateral hips is a characteristic feature of achondroplasia. It usually appears before epiphyseal closure. Its cause, incidence, and nature differ from Perthes' disease, and its presence does not carry a bad prognosis in achondroplasia. (orig.)
Voltage Sag due to Pollution Induced Flashover Across Ceramic Insulator Strings
Reddy B, Subba; Goswami, Arup Kumar
2017-11-01
Voltage sag or voltage dips are significant to industrial reliability. There is a necessity to characterize the feeder level power quality (PQ) and the PQ performance among various utility companies. Contamination/pollution induced flashover is the ultimate consequence of the creeping discharges across the insulator strings which induce voltage sag. These have a severe threat on the safe and reliable operation of power systems. In the present work an attempt has been made to experimentally investigate the occurrence of voltage sag/dips during pollution induced flashovers. Results show significant dip/sag in the voltage magnitude during the flashover process.
Effects of balanced and unbalanced voltage sags on DC adjustable-speed drives
Energy Technology Data Exchange (ETDEWEB)
Pedra, Joaquin; Sainz, Luis; Corcoles, Felipe; Bergas, Joan [Department of Electrical Engineering, ETSEIB-UPC, Av. Diagonal, 647, 08028 Barcelona (Spain); de Blas, Alfredo [Department of Electrical Engineering, EUETIB-UPC, C. d' Urgell, 187, 08036 Barcelona (Spain)
2008-06-15
This paper analyzes the sensitivity of DC adjustable-speed drives to balanced and unbalanced voltage sags. The influence of sag type, depth, duration and phase-angle jump on DC drives is studied. The control of the DC drive has been taken into account to understand drive behavior in the presence of voltage sags. Two working modes of the DC motor are considered in the study: as a consumer load and as a regenerative load. When the DC motor works as a consumer load, the study shows that sag type and depth have a significant influence on drive behavior. However, the voltage sag can be ridden through if the rectifier firing angle is set correctly by the control. When the DC motor works as a regenerative load, the study shows the consequences of the three-phase rectifier commutation failure due to the voltage sag. (author)
Compensation for gravitational sag of bent mirror
Energy Technology Data Exchange (ETDEWEB)
Mao, Chengwen; Jiang, Hui; He, Yan; Liang, Dongxu; Lan, Xuying; Yan, Shuai [Shanghai Synchrotron Radiation Facility, Shanghai Institute of Applied Physics, CAS, Shanghai 201800 (China); Shu, De-ming [Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States); Li, Aiguo, E-mail: aiguo.li@sinap.ac.cn [Shanghai Synchrotron Radiation Facility, Shanghai Institute of Applied Physics, CAS, Shanghai 201800 (China)
2017-05-01
The gravitational sag of aspheric bent mirrors with face-up or face-down geometry produces a nonnegligible optical error. As an effective compensation, width optimization is used to match the combined effects of the gravitational and bending moments. This method is described by analytical expressions and two calculation algorithms. The results of theoretical simulations and finite element analysis have proved that this method can reduce the slope error resulting from gravitational sag to the level of nano radians.
Compensation for gravitational sag of bent mirror
International Nuclear Information System (INIS)
Mao, Chengwen; Jiang, Hui; He, Yan; Liang, Dongxu; Lan, Xuying; Yan, Shuai; Shu, De-ming; Li, Aiguo
2017-01-01
The gravitational sag of aspheric bent mirrors with face-up or face-down geometry produces a nonnegligible optical error. As an effective compensation, width optimization is used to match the combined effects of the gravitational and bending moments. This method is described by analytical expressions and two calculation algorithms. The results of theoretical simulations and finite element analysis have proved that this method can reduce the slope error resulting from gravitational sag to the level of nano radians.
Computation and measurement of calandria tube sag in PHWR
International Nuclear Information System (INIS)
Kim, Tae Ryong; Sohn, Seok Man
2003-01-01
Calandria tubes and liquid injection shutdown system (LISS) tubes in a pressurized heavy water reactor (PHWR) is known to sag due to irradiation creep and growth during plant operation. When the sag of calandria tube becomes bigger, the calandria tube possibly comes in contact with LISS tube crossing beneath and calandria tube. The contact subsequently may cause the damage on the calandria tube resulting in unpredicted outage of the plant. It is therefore necessary to check the gap between the two tubes in order to periodically confirm no contact by using a proper measure during the plant life. An ultrasonic gap measuring probe assembly which can be inserted into two viewing ports of the calandria was developed in Korea and utilized to measure the sags of both tubes in the PHWR. It was found that the centerlines of calandria tubes and liquid injection shutdown system tubes can be precisely detected by ultrasonic wave. The gaps between two tubes were easily obtained from the relative distance of the measured centerline elevations of the tubes. Based on the irradiation creep equation and the measurement data, a computer program to calculate the sags was also developed. With the computer program, the sag at the end of plant life was predicted. (author)
Effects of symmetrical voltage sags on squirrel-cage induction motors
Energy Technology Data Exchange (ETDEWEB)
Pedra, Joaquin; Sainz, Luis; Corcoles, Felipe [Department of Electrical Engineering, ETSEIB-UPC, Av. Diagonal, 647, 08028 Barcelona (Spain)
2007-10-15
This paper analyzes the symmetrical voltage sag consequences on the induction motor behavior when single- and double-cage models are considered, namely current and torque peaks, and speed loss. These effects depend on several variables like sag type, duration and depth. Voltage sag effects are studied by using single- and double-cage models for three motors of different rated power. The double-cage model always predicts torque and current peaks higher than those of the single-cage model. The single-cage model predicts that voltage sags can produce motor instability, whereas the double-cage model is always stable. Therefore, the double-cage model must be used for the simulation of the squirrel-cage induction motor, because the single-cage model can give erroneous results in some situations. (author)
The sagging rope sign in achondroplasia - different from Perthes' disease
Energy Technology Data Exchange (ETDEWEB)
Shingade, Viraj U. [Korea University, Department of Paediatric Orthopaedics, College of Medicine, Guro Hospital, Seoul (Korea); Song, Hae-Ryong [Korea University, Department of Paediatric Orthopaedic Surgery, College of Medicine, Guro Hospital, Seoul (Korea); Lee, Seok-Hyun; Suh, Seung-Woo [Korea University, Department of Orthopaedic Surgery, College of Medicine, Guro Hospital, Seoul (Korea); Oh, Chang-Wug [Kyungpook National University Hospital, Department of Orthopaedic Surgery, Daegu (Korea); Hong, Jun-Seok [Ansan Hospital, Department of Orthopaedic Surgery, Korea University, Ansan, Gyeonggi do (Korea)
2006-12-15
The sagging rope sign is a radio-opaque line, seen on radiographs of the hips, with Perthes' disease. The main purpose of this study was to determine the incidence, cause and importance of this sign in achondroplasia, and to reveal how it differs from in Perthes' disease. Serial radiograms, along with 2-dimensional and 3-dimensional CT images were studied in 42 achondroplasic patients. Forty-two achondroplasic patients, reported at our institute (for routine outpatient consultation, spine surgeries, deformity corrections, limb-lengthening procedures) were included in this study. There were 26 males and 16 females. The sign was observed bilaterally, in all patients. Evaluation of CT images revealed spherical heads, with presence of circumferential overhang in all hips. This circumferential overhang, seen on 3-D CT scan, corresponded to the sagging rope sign on radiographs. Presence of the sagging rope sign in bilateral hips is a characteristic feature of achondroplasia. It usually appears before epiphyseal closure. Its cause, incidence, and nature differ from Perthes' disease, and its presence does not carry a bad prognosis in achondroplasia. (orig.)
Voltage Sag Compensator for CAR and SOR of HANARO
International Nuclear Information System (INIS)
Kim, Hyung-Kyoo; Jung, Hoan-Sung; Wu, Jong-Sup
2007-01-01
HANARO is designed so as to be tripped automatically by insertion of control absorber rods(CAR) and shut-off rods(SOR) and the process systems, such as primary cooling system, secondary cooling system and reflector cooling system, etc., stop whenever the off-site power failure occurs, the reactor trips automatically. When voltage sag or momentary interruption occurs, the process systems are in operation but the reactor has an unwanted trip by insertion of CARs and SORs. We installed the voltage sag compensator on the power supply for CARs and SORs so as to prevent a nuisance trip. The compensated time is decided not to exceed 1 sec in consideration of reactor safety. This paper is concerned with the impact of the momentary interruption on the reactor and the effect of the voltage sag compensator
A robust and fast generic voltage sag detection technique
DEFF Research Database (Denmark)
L. Dantas, Joacillo; Lima, Francisco Kleber A.; Branco, Carlos Gustavo C.
2015-01-01
In this paper, a fast and robust voltage sag detection algorithm, named VPS2D, is introduced. Using the DSOGI, the algorithm creates a virtual positive sequence voltage and monitories the fundamental voltage component of each phase. After calculating the aggregate value in the o:;3-reference fram...
SAG2 locus genotyping of Toxoplasma gondii in meat products of ...
African Journals Online (AJOL)
Jane
2011-10-12
Oct 12, 2011 ... restriction fragment length polymorphism (RFLP) analysis of SAG2 locus revealed that all of the samples belonged to genotype I. The detection of the parasite in uncooked meat and commercial meat products, and the high ratio of seropositive slaughtered animals, emphasis that the risk still exists for.
Allocation of Load-Loss Cost Caused by Voltage Sag
Gao, X.
2017-10-01
This paper focuses on the allocation of load-loss cost caused by voltage sag in the environment of electricity market. To compensate the loss of loads due to voltage sags, the load-loss cost is allocated to both sources and power consumers. On the basis of Load Drop Cost (LDC), a quantitative evaluation index of load-loss cost caused by voltage sag is identified. The load-loss cost to be allocated to power consumers themselves is calculated according to load classification. Based on the theory of power component the quantitative relation between sources and loads is established, thereby a quantitative calculation method for load-loss cost allocated to each source is deduced and the quantitative compensation from individual source to load is proposed. A simple five-bus system illustrates the main features of the proposed method.
Jones, G W; Hooley, P; Farrington, S M; Shawcross, S G; Iwanejko, L A; Strike, P
1999-03-01
Mutations within the sagA gene of Aspergillus nidulans cause sensitisation to DNA-damaging chemicals but have no effect upon spontaneous or damage-induced mutation frequency. The sagA gene was cloned on a 19-kb cosmid-derived fragment by functional complementation of a sagA1 sagC3 double mutant; subsequently, a fragment of the gene was also isolated on a 3.9-kb genomic subclone. Initial sequencing of a small section of the 19-kb fragment allowed the design of primers that were subsequently used in RTPCR experiments to show that this DNA is transcribed. A 277-bp fragment derived from the transcribed region was used to screen an A. nidulans cDNA library, resulting in the isolation of a 1.4-kb partial cDNA clone which had sequence overlap with the genomic sagA fragment. This partial cDNA was incomplete but appeared to contain the whole coding region of sagA. The sagA1 mutant was shown to possess two mutations; a G-T transversion and a+ 1 frameshift due to insertion of a T. causing disruption to the C-terminal region of the SagA protein. Translation of the sagA cDNA predicts a protein of 378 amino acids, which has homology to the Saccharomyces cerevisiae End3 protein and also to certain mammalian proteins capable of causing cell transformation.
Howe, Daniel K; Gaji, Rajshekhar Y; Marsh, Antoinette E; Patil, Bhagyashree A; Saville, William J; Lindsay, David S; Dubey, J P; Granstrom, David E
2008-05-01
A gene family of surface antigens is expressed by merozoites of Sarcocystis neurona, the primary cause of equine protozoal myeloencephalitis (EPM). These surface proteins, designated SnSAGs, are immunodominant and therefore excellent candidates for development of EPM diagnostics or vaccines. Prior work had identified an EPM isolate lacking the major surface antigen SnSAG1, thus suggesting there may be some diversity in the SnSAGs expressed by different S. neurona isolates. Therefore, a bioinformatic, molecular and immunological study was conducted to assess conservation of the SnSAGs. Examination of an expressed sequence tag (EST) database revealed several notable SnSAG polymorphisms. In particular, the EST information implied that the EPM strain SN4 lacked the major surface antigen SnSAG1. The absence of this surface antigen from the SN4 strain was confirmed by both Western blot and Southern blot. To evaluate SnSAG polymorphisms in the S. neurona population, 14 strains were examined by Western blots using monospecific polyclonal antibodies against the four described SnSAGs. The results of these analyses demonstrated that SnSAG2, SnSAG3, and SnSAG4 are present in all 14 S. neurona strains tested, although some variance in SnSAG4 was observed. Importantly, SnSAG1 was not detected in seven of the strains, which included isolates from four cases of EPM and a case of fatal meningoencephalitis in a sea otter. Genetic analyses by PCR using gene-specific primers confirmed the absence of the SnSAG1 locus in six of these seven strains. Collectively, the data indicated that there is heterogeneity in the surface antigen composition of different S. neurona isolates, which is an important consideration for development of serological tests and prospective vaccines for EPM. Furthermore, the diversity reported herein likely extends to other phenotypes, such as strain virulence, and may have implications for the phylogeny of the various Sarcocystis spp. that undergo sexual stages
Detection and correction for EPID and gantry sag during arc delivery using cine EPID imaging.
Rowshanfarzad, Pejman; Sabet, Mahsheed; O'Connor, Daryl J; McCowan, Peter M; McCurdy, Boyd M C; Greer, Peter B
2012-02-01
identical for various linear-accelerators. The reproducibility of measurements was within 0.2 mm over a period of 15 months. The direction of gantry rotation and SDD did not affect the results by more than 0.3 mm. Results of independent tests agreed with the algorithm within the accuracy of the measurement tools. When comparing summed images, the percentage of points with Gamma index <1 increased from 85.4% to 94.1% after correcting for the EPID sag, and to 99.3% after correction for gantry + EPID sag. The measurement method and algorithms introduced in this study use cine-images, are highly accurate, simple, fast, and reproducible. It tests all gantry angles and provides a suitable automatic analysis and correction tool to improve EPID dosimetry and perform comprehensive linac QA for arc treatments.
Directory of Open Access Journals (Sweden)
Yock-Ping Chow
Full Text Available At least 19 glycosylphosphatidylinositol (GPI-anchored surface antigens (SAGs are expressed specifically by second-generation merozoites of Eimeria tenella, but the ability of these proteins to stimulate immune responses in the chicken is unknown.Ten SAGs, belonging to two previously defined multigene families (A and B, were expressed as soluble recombinant (r fusion proteins in E. coli. Chicken macrophages were treated with purified rSAGs and changes in macrophage nitrite production, and in mRNA expression profiles of inducible nitric oxide synthase (iNOS and of a panel of cytokines were measured. Treatment with rSAGs 4, 5, and 12 induced high levels of macrophage nitric oxide production and IL-1β mRNA transcription that may contribute to the inflammatory response observed during E. tenella infection. Concomitantly, treatment with rSAGs 4, 5 and 12 suppressed the expression of IL-12 and IFN-γ and elevated that of IL-10, suggesting that during infection these molecules may specifically impair the development of cellular mediated immunity.In summary, some E. tenella SAGs appear to differentially modulate chicken innate and humoral immune responses and those derived from multigene family A (especially rSAG 12 may be more strongly linked with E. tenella pathogenicity associated with the endogenous second generation stages.
Jairo Blanco; Ruben Darío Leal; Jonathan Jacome; Johann F. Petit; Gabriel Ordoñez; Víctor Barrera
2011-01-01
This article presents an analysis of voltage sag propagation. The ATPDraw tool was selected for simulating the IEEE 34 node test feeder. It takes into account both voltage sags caused by electrical fault network, as well as voltage sag propagation characteristics caused by induction motor starting and transformer energising. The analysis was aimed at assessing the influence of transformer winding connections, the impedance of these transformers, lines and cables, summarising the...
CARACTERIZACIÓN DE LUMINARIAS TIPO HALURO METÁLICO ANTE EVENTOS SAG
Directory of Open Access Journals (Sweden)
Bonie Johana Restrepo Cuestas
Full Text Available Este artículo plantea una metodología para la caracterización de luminarias de haluro metálico, ante eventos sag. Inicialmente, se diseñó y construyó un generador de eventos sag. Luego, se planteó un esquema de pruebas, que fue utilizado para analizar el comportamiento de un tipo de luminarias de alta densidad de descarga tipo Metal Halide, ante eventos sag. Finalmente, tomando como referente el estándar SEMI F-47, se realizó la construcción de una curva característica que muestra la región de operación de la luminaria.
Gravity sag view of lateral radiography of the knee
International Nuclear Information System (INIS)
Hidaka, Kuniyuki; Yanagawa, Yasuhiro; Kawamoto, Kiyosumi; Maeda, Daisuke; Komizu, Mitsuru
2007-01-01
The gravity sag view (GSV) is a lateral radiograph taken in the same position when the posterior sag sign is observed. The purpose of this study was to standardize the radiography technique for GSV by adjusting lateral rotation. To confirm the benchmark and correction angle (CA) for the GSV position, we assessed three-dimensional (3D) CT of the GSV position of the knee using normal volunteers. The benchmark is established at the 3-point of the leg and adjusting the CA of the knee is established by estimating from Rosenberg technique radiography. This helped not only to correct external rotation in the initial radiography but also to correct rotation for repeat radiography. Our method is quantitative and highly reproducible, and it increases the success rate in adjusting lateral radiography of the knee. (author)
International Nuclear Information System (INIS)
Horvath, J.
1993-01-01
The relationship between gravity sag of a precision cathode strip chamber and its sandwich panel structural design is explored parametrically. An algorithm for estimating the dominant component of gravity sag is defined. Graphs of normalized gravity sag as a function of gap frame width and material, sandwich core edge filler width and material, panel skin thickness, gap height, and support location are calculated using the gravity sag algorithm. The structural importance of the sandwich-to-sandwich ''gap frame'' connection is explained
An impact analysis of the fault impedance on voltage sags
Energy Technology Data Exchange (ETDEWEB)
Ramos, Alessandro Candido Lopes [CELG - Companhia Energetica de Goias, Goiania, GO (Brazil). Generation and Transmission. System' s Operation Center], E-mail: alessandro.clr@celg.com.br; Batista, Adalberto Jose [Federal University of Goias (UFG), Goiania, GO (Brazil)], E-mail: batista@eee.ufg.br; Leborgne, Roberto Chouhy [Federal University of Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil)], E-mail: rcl@ece.ufrgs.br; Emiliano, Pedro Henrique Mota, E-mail: ph@phph.com.br
2009-07-01
This paper presents an impact analysis of the fault impedance, in terms of its module and angle, on voltage sags caused by faults. Symmetrical and asymmetrical faults are simulated, at transmission and distribution lines, by using a frequency-domain fault simulation software called ANAFAS. Voltage sags are monitored at buses where sensitive end-users are connected. In order to overcome some intrinsic limitations of this software concerning its automatic execution for several cases, a computational tool was developed in Java programming language. This solution allows the automatic simulation of cases including the effect of the fault position, the fault type, and the proper fault impedance. The main conclusion is that the module and angle of the fault impedance can have a significant influence on voltage sag depending on the fault characteristics. (author)
Sun, Yun; Sun, Li; Xing, Ming-qing; Liu, Chun-sheng; Hu, Yong-hua
2013-11-12
Streptococcus iniae is a Gram-positive bacterium and a severe pathogen of a wide range of farmed fish. S. iniae possesses a virulence-associated streptolysin S cluster composed of several components, one of which is SagE. SagE a transmembrane protein with one major extracellular region named ECR. This study aimed to develop a SagE-based DNA candidate vaccine against streptococcosis and examine the immunoprotective mechanism of the vaccine. We constructed a DNA vaccine, pSagE, based on the sagE gene and examined its immunological property in a Japanese flounder (Paralichthys olivaceus) model. The results showed that at 7 days post-vaccination, expression of SagE at transcription and translation levels was detected in the tissues of the vaccinated fish. After challenge with S. iniae at one and two months post-vaccination, pSagE-vaccinated fish exhibited relative percent survival (RPS) of 95% and 88% respectively. Immunological analysis showed that (i) pSagE significantly upregulated the expression of a wide range of immune genes, (ii) pSagE induced the production of specific serum antibodies that bound whole-cell S. iniae, and (iii) treatment of S. iniae with pSagE-induced antibodies blocked bacterial invasion of host cells. To localize the immunoprotective domain of SagE, the ECR-expressing DNA vaccine pSagEECR was constructed. Immunization analysis showed that flounder vaccinated with pSagEECR exhibited a RPS of 68%, and that pSagEECR induced serum antibody production and immune gene expression in a manner similar to, though to lower magnitudes than, those induced by pSagE. We in this study developed a DNA vaccine, pSagE, which induces highly protective immunity against S. iniae. The protective effect of pSagE is probably due to its ability to elicit systemic immune response, in particular that of the humoral branch, which leads to production of specific serum antibodies that impair bacterial infection. These results add insights to the immunoprotective mechanism
Analysis of doubly-fed induction machine operating at motoring mode subjected to voltage sag
Directory of Open Access Journals (Sweden)
Navneet Kumar
2016-09-01
Full Text Available Variable Speed (VS Pumped Storage Plants (PSP equipped with large asynchronous (Doubly-Fed Induction machines are emerging now in hydropower applications. Motoring mode of operation of Doubly-Fed Induction Machine (DFIM is essential and techno-economical in this application due to: (1 its uniqueness in active power controllability, (2 bulk power handing capability with less rated power converters in rotor circuit, and (3 integrating Renewable Energy Sources (RES. This paper investigates the performance of two DFIMs at different power ratings (2.2 kW and 2 MW under voltage sag with different attribute. The test results are analyzed in terms of the peaks in torque, speed, power taken and transient currents in rotor and stator circuits. During sag, stable region for DFIM operation along with speed and stator side reactive power input control is also illustrated. The negative effects of voltage sag are briefly discussed. MATLAB simulation is validated with experimentation. The various observations during simulation and experimental analysis are also supported by the theoretical explanations.
Deriving Sight Distance on a Compound Sag and Circular Curve in a Three Dimensional Space
Directory of Open Access Journals (Sweden)
Chiu Liu, PhD, PE, PTOE
2012-09-01
Full Text Available Insufficient roadway sight distance (SD may become a contribution factor to traffic collisions or other unsafe traffic maneuvers. The sight distance (SD for a two-dimensional (2-d sag or circular curve has been addressed in detail in various traffic engineering literatures. Although three-dimensional (3-d compound sag and circular curves are often found along ramps, connectors, and mountain roads, the sight distances for these compound curves are yet to be analyzed on an exact analytic setting. By considering human-vehicle-roadway interaction, the formulas for computing the SD on a 3-d curve are derived the first time on a unified analytic framework. The 2-d sag curve SD can also be deduced from these derived formulas as special limiting cases. Practitioners can easily program these formulas or equations on a user-friendly Microsoft Excel spread sheet to calculate 3-d SD on most roadways with roadside clearance. This framework can be extended to estimate SD on roadways with obstacles partially blocking vehicle headlight beams. 6.
Directory of Open Access Journals (Sweden)
Mustafa Inci
2018-01-01
Full Text Available Voltage harmonics, sag, and swell are the most harmful disturbances in distribution systems. This paper introduces a novel effective controller method for simultaneous compensation of both voltage sag/swell and voltage harmonics by using multifunctional dynamic voltage restorer. In proposed controller method called FFT with integrated ISRF, ISRF detects the magnitudes of voltage sag/swell quickly and precisely, and FFT extracts the selective components of voltage harmonics very effectively. The proposed method integrates the superior properties of ISRF and FFT methods. FFT integrated ISRF is applied for the first time to provide the compensation of both sag/swell and selective harmonics together. The proposed system has ability to compensate symmetrical/asymmetrical sag/swell and symmetrical/asymmetrical selective harmonics which are 5th, 7th, 11th and 13th. The controlled system is modelled in PSCAD/EMDTC and compared with conventional methods. The performance results verify that the proposed method compensates voltage disturbances effectively in the system.
Antigenic evaluation of a recombinant baculovirus-expressed Sarcocystis neurona SAG1 antigen.
Gupta, G D; Lakritz, J; Saville, W J; Livingston, R S; Dubey, J P; Middleton, J R; Marsh, A E
2004-10-01
Sarcocystis neurona is the primary parasite associated with equine protozoal myeloencephalitis (EPM). This is a commonly diagnosed neurological disorder in the Americas that infects the central nervous system of horses. Current serologic assays utilize culture-derived parasites as antigen. This method requires large numbers of parasites to be grown in culture, which is labor intensive and time consuming. Also, a culture-derived whole-parasite preparation contains conserved antigens that could cross-react with antibodies against other Sarcocystis species and members of Sarcocystidae such as Neospora spp., Hammondia spp., and Toxoplasma gondii. Therefore, there is a need to develop an improved method for the detection of S. neurona-specific antibodies. The sera of infected horses react strongly to surface antigen 1 (SnSAG1), an approximately 29-kDa protein, in immunoblot analysis, suggesting that it is an immunodominant antigen. The SnSAG1 gene of S. neurona was cloned, and recombinant S. neurona SAG1 protein (rSnSAG1-Bac) was expressed with the use of a baculovirus system. By immunoblot analysis, the rSnSAG1-Bac antigen detected antibodies to S. neurona from naturally infected and experimentally inoculated equids, cats, rabbit, mice, and skunk. This is the first report of a baculovirus-expressed recombinant S. neurona antigen being used to detect anti-S. neurona antibodies in a variety of host species.
Salivary agglutinin/DMBT1SAG expression is up-regulated in the presence of salivary gland tumors
DEFF Research Database (Denmark)
Bikker, F J; van der Wal, J E; Ligtenberg, A J M
2004-01-01
Salivary agglutinin (SAG) is encoded by the gene Deleted in Malignant Brain Tumors 1 (DMBT1) and represents the salivary variant of DMBT1 (DMBT1(SAG)). While SAG is a bona fide anti-caries factor, DMBT1 was proposed as a candidate tumor-suppressor for brain, digestive tract, and lung cancer. Thou...
Zhou, Zhichao; Mei, Lianfu; Liu, Jun; Zheng, Jinyun; Chen, Liang; Hao, Shihao
2018-02-01
The rift architecture and deep crustal structure of the distal margin at the mid-northern margin of the South China Sea have been previously investigated by using deep seismic reflection profiles. However, one fundamental recurring problem in the debate is the extensional fault system and rift structure of the hyperextended rift basins (Baiyun Sag and Liwan Sag) within the distal margin because of the limited amount of seismic data. Based on new 3D seismic survey data and 2D seismic reflection profiles, we observe an array of fault blocks in the Baiyun Sag, which were tilted towards the ocean by extensional faulting. The extensional faults consistently dip towards the continent. Beneath the tilted fault blocks and extensional faults, a low-angle, high-amplitude and continuous reflection has been interpreted as the master detachment surface that controls the extension process. During rifting, the continentward-dipping normal faults evolved in a sequence from south to north, generating the asymmetric rift structure of the Baiyun Sag. The Baiyun Sag is separated from the oceanic domain by a series of structural highs that were uplifted by magmatic activity in response to the continental breakup at 33 Ma and a ridge jump to the south at 26-24 Ma. Therefore, we propose that magmatism played a significant role in the continental extension and final breakup in the South China Sea.
Directory of Open Access Journals (Sweden)
Beco Jacques
2008-07-01
Full Text Available Abstract Background Levator plate sagging (LPS, usually called descending perineum syndrome, is one of the main defects encountered in perineology. This defect is classically associated with colo-proctologic functional troubles (dyschesia and anal incontinence but can also induce perineodynia, gynaecological and lower urinary tract symptoms. Methods A retrospective case series of nine female patients (mean age: 44.3 underwent an isolated retro-anal levator plate myorrhaphy (RLPM to treat symptomatic LPS confirmed by rectal examination and/or Perineocaliper®. An anti-sagging test (support of the posterior perineum must significantly improve the symptoms that were resistant to conservative treatment. The effect of the procedure on the symptoms of the 3 axes of the perineum (urological, colo-proctologic and gynecological and on perineodynia was evaluated during a follow up consultation more than 9 months after surgery. The effect of RLPM on the position of the anal margin and on the levator plate angle was studied using rectal examination, Perineocaliper® and retro-anal ultrasound. Results Before surgery, anti-sagging tests were positive for dyschesia, urinary urgency and pain. After a mean follow-up of 16.1 months, RLPM resolved or improved 2/2 cases of stress urinary incontinence, 3/5 of urinary urgency, 3/4 of dysuria, 3/3 of anal incontinence, 7/8 of dyschesia, 3/4 of cystocele, 4/5 of rectocele, 5/8 of dyspareunia and 6/7 of perineodynia. Rectal examination showed a complete suppression of sagging in 4 patients and an improvement in the 5 others. The mean reduction of perineal descent was 1.08 cm (extremes: 0–1.5. Using retro-anal ultrasound of the levator plate, the mean reduction of sagging was 12.67 degrees (extremes: 1 – 21. Conclusion Anti-sagging tests can be used before surgery to simulate the effect of RLPM. This surgical procedure seems to improve stress urinary incontinence, frequency, nocturia, urgency, dysuria, anal
Early Prediction of Transient Voltage Sags caused by Rotor Swings
DEFF Research Database (Denmark)
Weckesser, Johannes Tilman Gabriel; Jóhannsson, Hjörtur; Van Cutsem, Thierry
2014-01-01
The paper investigates various methods to predict voltage sags at load buses caused by large generator rotor swings and following a transient disturbance. Three different prediction methods are proposed, which all use real-time measurements from PMUs. One of the methods uses a slightly extended v...... version of the E-SIME method. The other two methods use Measurements and process them by recursive least square estimation. It is shown that the prediction method employing E-SIME allows the earliest detection of a critical voltage sag with satisfactory accuracy....
Directory of Open Access Journals (Sweden)
Shugen Liu
2017-01-01
Full Text Available The older and deeper hydrocarbon accumulations receive increasing attention across the world, providing more technical and commercial challenges to hydrocarbon exploration. We present a study of an asymmetrical, N-S striking intracratonic sag which developed across the Sichuan basin, south China, from Late Ediacaran to Early Cambrian times. The Mianyang-Changning intracratonic sag is ~50 km wide, with its steepest part in the basin center. In particular the eastern margin shows its greatest steepness. Five episodes in the evolutions of the sag can be recognized. It begins in the Late Ediacaran with an uplift and erosion correlated to Tongwan movement. Initial extension occurred during the Early Cambrian Maidiping period, when more strata of the Maidiping Formation were deposited across the sag. Subsequently, maximum extension occurred during the Early Cambrian Qiongzhusi period that resulted in 450–1700 m thick Maidiping-Canglangpu Formations being deposited in the sag. Then, the sag disappeared at the Longwangmiao period, as it was infilled by the sediments. The intracratonic sag has significant influence on the development of high-quality reservoirs in the Dengying and Longwangmiao Formations and source-rock of the Niutitang Formation. It thus indicates that a high probability for oil/gas accumulation exists along the intracratonic sag, across the central Sichuan basin.
International Nuclear Information System (INIS)
Najafi, E.; Yatim, A.H.M.
2011-01-01
Research highlights: → We proposed a new current control method for STATCOM. → The current control method maintains a fixed switching frequency. → It also produces fewer harmonics compared to conventional hysteresis method. → A new voltage dip (sag) detection method was used in STATCOM. → The control method can mitigate voltage sag in each phase separately. -- Abstract: Static compensator (STATCOM) has been widely proposed for power quality and network stability improvement. It is easily connected in parallel to the electric network and has many advantages for electrical grids. It can improve network stability; power factor, power transfer rating and can avoid some disturbances such as sags and swells. Most of STATCOM controllers are based on voltage controllers that are based on balanced d-q transform. However, they are not thorough solutions for network disturbances since in most cases single-phase disturbances occur in electrical networks that cannot be avoided by the conventional controllers. Voltage mode controllers are also not capable of responding fast enough to the changes expected of a network system. This paper proposes a new current mode controller to overcome the mentioned problem. The approach uses a fixed frequency current controller to maintain voltage levels in voltage sags (dips). This approach is also simple and can be easily implemented by digitally. It has superior performance over conventional methods in terms of harmonic reduction in STATCOM output current. Another important factor for STATCOM effectiveness in sag mitigation is its sag detection method. This paper also introduces a new sag detection method based on Goertzel algorithm which is both effective and simple for practical applications. The simulation results presented illustrate the superiority of the proposed controller and sag detection algorithm to be utilized in the STATCOM.
Measurement and computation for sag of calandria tube due to irradiation creep in PHWR
International Nuclear Information System (INIS)
Son, S. M.; Lee, W. R.; Lee, S. K.; Lee, J. S.; Kim, T. R.; Na, B. K.; Namgung I.
2003-01-01
Calandria tubes and Liquid Injection Shutdown System(LISS) tubes in a Pressurized Heavy Water Reactor(PHWR) are to sag due to irradiation creep and growth during plant operation. When the sag of calandria tube becomes bigger, the calandria tube possibly comes in contact with LISS tube crossing beneath the calandria tube. The contact subsequently may cause the damage on the calandria tube resulting in unpredicted outage of the plant. It is therefore necessary to check the gap between the two tubes in order to periodically confirm no contact by using a proper measure during the plant life. An ultrasonic gap measuring probe assembly which can be inserted into two viewing ports of the calandria was developed in Korea and utilized to measure the sags of both tubes in the PHWR. It was found that the centerlines of calandria tubes and liquid injection shutdown system tubes can be precisely detected by ultrasonic wave. The gaps between two tubes were easily obtained from the relative distance of the measured centerline elevations of the tubes. Based on the irradiation creep equation and the measurement data, a computer program to calculate the sags was also developed. With the computer program, the sag at the end of plant life was predicted
Mitigation of Voltage Sags in CIGRE Low Voltage Distribution Network
DEFF Research Database (Denmark)
Mustafa, Ghullam; Bak-Jensen, Birgitte; Mahat, Pukar
2013-01-01
Any problem in voltage in a power network is undesirable as it aggravates the quality of the power. Power electronic devices such as Voltage Source Converter (VSC) based Static Synchronous Compensator (STATCOM), Dynamic Voltage Restorer (DVR) etc. are commonly used for the mitigation of voltage p....... The compensation of voltage sags in the different parts of CIGRE distribution network is done by using the four STATCOM compensators already existing in the test grid. The simulations are carried out in DIgSILENT power factory software version 15.0.......Any problem in voltage in a power network is undesirable as it aggravates the quality of the power. Power electronic devices such as Voltage Source Converter (VSC) based Static Synchronous Compensator (STATCOM), Dynamic Voltage Restorer (DVR) etc. are commonly used for the mitigation of voltage...... problems in the distribution system. The voltage problems dealt with in this paper are to show how to mitigate voltage sags in the CIGRE Low Voltage (LV) test network and networks like this. The voltage sags, for the tested cases in the CIGRE LV test network are mainly due to three phase faults...
Complete characterization of voltage sags: an alternative to achieve energy quality
International Nuclear Information System (INIS)
Zuniga Medina, Edgar Andres; Vasco Garcia, Carlos Andres
1992-01-01
In this paper, the meaning of the power quality and its negative influence in the automation processes are presented. Voltage sags, the problems they cause and a methodology to characterize the phenomenon are also presented. Once the problems associated with the different sensible loads connected to a power system are identified, the cause of the bad quality of the electrical energy provided those loads is then established; voltage sags are one of the most common phenomenon that requires characterization in order to diminish their negative impact on the industrial processes
The rice OsSAG12-2 gene codes for a functional protease that ...
Indian Academy of Sciences (India)
2016-07-11
Jul 11, 2016 ... Senescence is the final stage of plant development. Although ... Down-regulation of OsSAG12-1 in transgenic rice .... Plants were germinated on soil and grown for 15 days under normal conditions before taking photograph.
Experimental testing of a SAG digital SILT application
International Nuclear Information System (INIS)
Haapanen, P.; Maskuniitty, M.; Heikkinen, J.; Korhonen, J.
1995-10-01
A prototype dynamic testing harness for programmable automation systems has been specified and implemented at the Technical Research Centre of Finland (VTT). In order to get experience on the methodology and equipment for the testing of systems important to the safety of nuclear power plants, where the safety and reliability requirements often are very high, two different pilot systems have been tested. One system was an ABB Master application, which was loaned for testing from ABB Atom by Teollisuuden Voima Oy (TVO). Another system, loaned from Siemens AG(SAG) by IVO International Oy (IVO), was an application realized with SAG's digital SILT technology. The report describes the testing of the SAG application. The purpose of the testing was not to assess the pilot system, but to get experience in the testing methodology and find out the further development needs and potentials of the test methodology and equipment. The experience show that dynamic testing is one feasible way to get more confidence about the safety and reliability of a programmable system that would be hard to achieve by other means. It also shows that more development of the test harness is still needed, especially concerning the comparison of the obtained test response to the expected response provided by the logical model of the system. Also the user interface of the on-line part of the test harness needs development. Methods for generation of the test cases also need further development eg. for achieving statistical significance for the reliability estimates. (10 refs., 90 figs., 9 tabs.)
Directory of Open Access Journals (Sweden)
Rafael Cisneros-Magaña
2018-06-01
Full Text Available This paper proposes a time-domain methodology based on the unscented Kalman filter to estimate voltage sags and their characteristics, such as magnitude and duration in power systems represented by nonlinear models. Partial and noisy measurements from the electrical network with nonlinear loads, used as data, are assumed. The characteristics of voltage sags can be calculated in a discrete form with the unscented Kalman filter to estimate all the busbar voltages; being possible to determine the rms voltage magnitude and the voltage sag starting and ending time, respectively. Voltage sag state estimation results can be used to obtain the power quality indices for monitored and unmonitored busbars in the power grid and to design adequate mitigating techniques. The proposed methodology is successfully validated against the results obtained with the time-domain system simulation for the power system with nonlinear components, being the normalized root mean square error less than 3%.
Effect of voltage sags on digitally controlled line connected switched-mode power supplies
DEFF Research Database (Denmark)
Török, Lajos; Munk-Nielsen, Stig
2012-01-01
Different voltage disorders like voltage fluctuations, sags, frequency variations may occur in the power supply networks due to different fault conditions. These deviations from normal operation affects in different ways the line connected devices. Standards were developed to protect and ensure...... of voltage sags is analyzed. Fault tolerant control algorithm was designed, implemented and is discussed. The fault conditions and their effects were investigated at different power levels....
Doubly-Fed Induction Generator Control Under Voltage Sags
DEFF Research Database (Denmark)
Teodorescu, Remus; Blaabjerg, Frede; Lima, K.
2008-01-01
This paper proposes a new control technique to improve the fault-ride through capability of doubly fed induction generators (DFIG). In such generators the appearance of severe voltage sags at the coupling point make rise to high over currents at the rotor/stator windings, something that makes...
Simulation and experiment of a YBCO SMES prototype in voltage sag compensation
International Nuclear Information System (INIS)
Zhu Jiahui; Yuan Weijia; Coombs, T.A.; Ming, Q.
2011-01-01
Research highlights: → YBCO conductors are used in SMES. → The SMES is successfully used to compensate voltage sag by both simulation and experiment. → A new control strategy for the power converter in the SMES. - Abstract: This paper gives a introduction of a SMES unit using 2G HTS wires. A complete SMES system including both superconducting coils and control circuit has been designed to operate at 77 K. Three single-phase H-bridge converters have been used in the control circuit. A loop control signal is sent out by using 32 fixed point Digital Signal Processor (DSP). The complete circuit has been both modelled in simulation and built experimentally. The results validate that this SMES successfully compensates a voltage sag in a power system.
Simulation and experiment of a YBCO SMES prototype in voltage sag compensation
Energy Technology Data Exchange (ETDEWEB)
Zhu Jiahui, E-mail: zhujiahui@epri.sgcc.com.c [China Electric Power Research Institute, No. 15 Xiaoying Rd(E), Qinghe, Beijing 100192 (China); Yuan Weijia; Coombs, T.A. [Electrical Engineering Division, Engineering Department, University of Cambridge, CB3 0FA (United Kingdom); Ming, Q. [China Electric Power Research Institute, No. 15 Xiaoying Rd(E), Qinghe, Beijing 100192 (China)
2011-03-15
Research highlights: {yields} YBCO conductors are used in SMES. {yields} The SMES is successfully used to compensate voltage sag by both simulation and experiment. {yields} A new control strategy for the power converter in the SMES. - Abstract: This paper gives a introduction of a SMES unit using 2G HTS wires. A complete SMES system including both superconducting coils and control circuit has been designed to operate at 77 K. Three single-phase H-bridge converters have been used in the control circuit. A loop control signal is sent out by using 32 fixed point Digital Signal Processor (DSP). The complete circuit has been both modelled in simulation and built experimentally. The results validate that this SMES successfully compensates a voltage sag in a power system.
Mitigation of voltage sags in the distribution system with dynamic voltage restorer
International Nuclear Information System (INIS)
Viglas, D.; Belan, A.
2012-01-01
Dynamic voltage restorer is a custom power device that is used to improve voltage sags or swells in electrical distribution system. The components of the Dynamic Voltage Restorer consist of injection transformers, voltage source inverter, passive filters and energy storage. The main function of the Dynamic voltage restorer is used to inject three phase voltage in series and in synchronism with the grid voltages in order to compensate voltage disturbances. This article deals with mitigation of voltage sags caused by three-phase short circuit. Dynamic voltage restorer is modelled in MATLAB/Simulink. (Authors)
Modelling voltage sag mitigation using dynamic voltage restorer and analyzing power quality issue
Ismail, Nor Laili; Hidzir, Hizrin Dayana Mohd; Thanakodi, Suresh; Nazar, Nazatul Shiema Moh; Ibrahim, Pungut; Ali, Che Ku Muhammad Sabri Che Ku
2018-02-01
Power quality problem which are arise due to a fault or a pulsed load can have caused an interruption of critical load. The modern power systems are becoming more sensitive to the quality of the power supplied by the utility company. Voltage sags and swells, flicker, interruptions, harmonic distortion and other distortion to the sinusoidal waveform are the examples of the power quality problems. The most affected due to these problems is industrial customers who use a lot of sensitive equipment. There has suffered a huge loss to these problems. Resulting of broken or damage equipment if voltage sag exceeds the sensitive threshold of the equipment. Thus, device such as Static Synchronous Compensator (STATCOM) and Dynamic Voltage Restorer (DVR) has been created to solve this problem among users. DVR is a custom power device that most effective and efficient. This paper intended to report the DVR operations during voltage sag compensation.
Advanced Control of the Dynamic Voltage Restorer for Mitigating Voltage Sags in Power Systems
Directory of Open Access Journals (Sweden)
Dung Vo Tien
2018-01-01
Full Text Available The paper presents a vector control with two cascaded loops to improve the properties of Dynamic Voltage Restorer (DVR to minimize Voltage Sags on the grid. Thereby, a vector controlled structure was built on the rotating dq-coordinate system with the combination of voltage control and the current control. The proposed DVR control method is modelled using MATLAB-Simulink. It is tested using balanced/unbalanced voltage sags as well as fluctuant and distorted voltages. As a result, by using this controlling method, the dynamic characteristics of the system have been improved significantly. The system performed with higher accuracy, faster response and lower distortion in the voltage sags compensation. The paper presents real time experimental results to verify the performance of the proposed method in real environments.
Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1
Wang, Yanhua; Wang, Guangxiang; Zhang, Delin; Yin, Hong; Wang, Meng
2013-01-01
Background The identification of protein epitopes is useful for diagnostic purposes and for the development of peptide vaccines. In this study, the epitopes of Toxoplasma gondii SAG1 were identified using synthetic peptide techniques with the aid of bioinformatics. Findings Eleven peptides derived from T. gondii SAG1 were assessed by ELISA using pig sera from different time points after infection. Four (PS4, PS6, PS10 and PS11), out of the eleven peptides tested were recognized by all sera. T...
Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1.
Wang, Yanhua; Wang, Guangxiang; Zhang, Delin; Yin, Hong; Wang, Meng
2013-04-30
The identification of protein epitopes is useful for diagnostic purposes and for the development of peptide vaccines. In this study, the epitopes of Toxoplasma gondii SAG1 were identified using synthetic peptide techniques with the aid of bioinformatics. Eleven peptides derived from T. gondii SAG1 were assessed by ELISA using pig sera from different time points after infection. Four (PS4, PS6, PS10 and PS11), out of the eleven peptides tested were recognized by all sera. Then, shorter peptides that were derived from PS4, PS6, PS10 and PS11 were predicted using bioinformatics and tested by experimentation. Four out of nine shorter peptides were identified successfully (amino acids 106-120, 166-180, 289-300 and 313-332). We have precisely located the epitopes of T. gondii SAG1 using pig sera collected at different time points after infection. The identified epitopes may be useful for the further study of epitope-based vaccines and diagnostic reagents.
Mendes, Érica Araújo; Fonseca, Flavio G; Casério, Bárbara M; Colina, Janaína P; Gazzinelli, Ricardo Tostes; Caetano, Braulia C
2013-01-01
The use of recombinant viral vectors expressing T. gondii antigens is a safe and efficient approach to induce immune response against the parasite and a valuable tool for vaccine development. We have previously protected mice from toxoplasmosis by immunizing the animals with an adenovirus expressing the protein SAG1 (AdSAG1) of T. gondii. We are now looking for ways to improve the vaccination strategy and enhance protection. One limitation of homologous vaccinations (sequential doses of the same vector) is induction of anti-vector immune response that blocks cell transduction, restricts transgene expression and, consequently, compromises the overall outcome of vaccination. One way to avert the effects of anti-vector response is to use different viruses in prime and boost (heterologous vaccination). Bearing this in mind, we generated a modified Vaccinia Virus Ankara encoding SAG1 (MVASAG1), to be tested as boost agent after prime with AdSAG1. Although minor differences were observed in the magnitude of the anti-SAG1 immune response induced by each vaccination protocol, the heterologous immunization with AdSAG1 followed by MVASAG1 resulted in improved capacity to control brain cyst formation in a model of chronic toxoplasmosis in C57BL/6 mice.
Directory of Open Access Journals (Sweden)
Érica Araújo Mendes
Full Text Available The use of recombinant viral vectors expressing T. gondii antigens is a safe and efficient approach to induce immune response against the parasite and a valuable tool for vaccine development. We have previously protected mice from toxoplasmosis by immunizing the animals with an adenovirus expressing the protein SAG1 (AdSAG1 of T. gondii. We are now looking for ways to improve the vaccination strategy and enhance protection. One limitation of homologous vaccinations (sequential doses of the same vector is induction of anti-vector immune response that blocks cell transduction, restricts transgene expression and, consequently, compromises the overall outcome of vaccination. One way to avert the effects of anti-vector response is to use different viruses in prime and boost (heterologous vaccination. Bearing this in mind, we generated a modified Vaccinia Virus Ankara encoding SAG1 (MVASAG1, to be tested as boost agent after prime with AdSAG1. Although minor differences were observed in the magnitude of the anti-SAG1 immune response induced by each vaccination protocol, the heterologous immunization with AdSAG1 followed by MVASAG1 resulted in improved capacity to control brain cyst formation in a model of chronic toxoplasmosis in C57BL/6 mice.
The influence of motor re-acceleration on voltage sags
Bollen, M.H.J.
1995-01-01
The assumption that a voltage sag is rectangular is not correct in a power system with large induction motor loads. The motors decelerate during the short circuit. After fault-clearing, they will accelerate again, drawing a high reactive current from the supply, causing a prolonged postfault voltage
Haryati, Sri; Agung Prasetyo, Afiono; Sari, Yulia; Dharmawan, Ruben
2018-05-01
Toxoplasma gondii Surface Antigen 1 (SAG1) is often used as a diagnostic tool due to its immunodominant-specific as antigen. However, data of the Toxoplasma gondii SAG1 protein from Indonesian isolate is limited. To study the protein, genomic DNA was isolated from a Javanese acute toxoplasmosis blood samples patient. A complete coding sequence of Toxoplasma gondii SAG1 was cloned and inserted into an Escherichia coli expression plasmid and sequenced. The sequencing results were subjected to bioinformatics analysis. The Toxoplasma gondii SAG1 complete coding sequences were successfully cloned. Physicochemical analysis revealed the 336 aa of SAG1 had 34.7 kDa of weight. The isoelectric point and aliphatic index were 8.4 and 78.4, respectively. The N-terminal methionine half-life in Escherichia coli was more than 10 hours. The antigenicity, secondary structure, and identification of the HLA binding motifs also had been discussed. The results of this study would contribute information about Toxoplasma gondii SAG1 and benefits for further works willing to develop diagnostic and therapeutic strategies against the parasite.
Ellison, Siobhan; Witonsky, Sharon
2009-07-01
Sarcocystis neurona is the principal etiologic agent of equine protozoal myeloencephalitis (EPM). An immunodominant protein of S. neurona, SnSAG-1, is expressed by the majority of S. neurona merozoites isolated from spinal tissues of horses diagnosed with EPM and may be a candidate for diagnostic tests and prophylaxis for EPM. Five horses were vaccinated with adjuvanted recombinant SnSAG1 (rSnSAG1) and 5 control (sham vaccinated) horses were vaccinated with adjuvant only. Serum was evaluated pre- and post-vaccination, prior to challenge, for antibodies against rSnSAG1 and inhibitory effects on the infectivity of S. neurona by an in vitro serum neutralization assay. The effect of vaccination with rSnSAG1 on in vivo infection by S. neurona was evaluated by challenging all the horses with S. neurona merozoites. Blinded daily examinations and 4 blinded neurological examinations were used to evaluate the presence of clinical signs of EPM. The 5 vaccinated horses developed serum and cerebrospinal fluid (CSF) titers of SnSAG1, detected by enzyme-linked immunosorbent assay (ELISA), post-vaccination. Post-vaccination serum from vaccinated horses was found to have an inhibitory effect on merozoites, demonstrated by in vitro bioassay. Following the challenge, the 5 control horses displayed clinical signs of EPM, including ataxia. While 4 of the 5 vaccinated horses did not become ataxic. One rSnSAG-1 vaccinated horse showed paresis in 1 limb with muscle atrophy. All horses showed mild, transient, cranial nerve deficits; however, disease did not progress to ataxia in rSnSAG-1 vaccinated horses. The study showed that vaccination with rSnSAG-1 produced antibodies in horses that neutralized merozoites when tested by in vitro culture and significantly reduced clinical signs demonstrated by in vivo challenge.
Directory of Open Access Journals (Sweden)
Yongchun Yang
2018-04-01
Full Text Available The modular multilevel converter (MMC, as a new type of voltage source converter, is increasingly used because it is a distributed storage system. There are many advantages of using the topological structure of the MMC on a unified power quality controller (UPQC, and voltage sag mitigation is an important use of the MMC energy storage system for the power quality compensation process. In this paper, based on the analysis of the topology of the MMC, the essence of energy conversion in a UPQC of voltage sag compensation is analyzed; then, the energy storage characteristics are calculated and analyzed to determine the performance index of voltage sag compensation; in addition, the simulation method is used to verify the voltage sag compensation characteristics of the UPQC; finally, an industrial prototype of the UPQC based on an MMC for 10 kV of medium voltage distribution network has been developed, and the basic functions of UPQC have been tested.
International Nuclear Information System (INIS)
Watanabe, Takuya; Akutsu, Yasushi; Okazaki, Osamu
1995-01-01
Regional myocardial blood flow (RMBF) associated with exercise-induced ST depression was assessed using 13 NH 3 positron emission tomography (PET) to determine the significance of horizontal and sagging type ST segments. The subjects were 25 patients with angina pectoris, 25 patients with myocardial infarction, and 5 healthy male volunteers. Eleven regions of interests (ROI) were prepared to calculate RMBF. ST segments were unchanged in 27 patients (Group A) and were depressed in 23 patients (Group B). A 10% increase in RMBF was significantly observed in Group A (74.1%) than Group B (34.8%). In Group B, ST depression was divided into horizontal type (8 patients) and sagging type (15 patients). According to the type of ST depression, RMBF was increased by 10% or more in 50% (4/8) for horizontal type and in 26.7% (4/15) for sagging type. These findings suggested that unfavorable increase in RMBF in stenosiss-related coronary vessels may contribute to the development of ST depression induced by exercise. A constant increase in RMBF in all ROIs, including those with unfavorable RMBF increase, may be involved in the occurrence of horizontal type ST depression; sagging type ST depression may, however, occur by an increased difference in blood flow between unfavorable and favorable RMBF. (N.K.)
SVC or VSC for reduction of voltage sags and flicker. Trends in power electronics
Energy Technology Data Exchange (ETDEWEB)
Haeusler, M; Schnettler, A [ABB Calor Emag Schaltanlagen AG, Mannheim (Germany); Halvarsson, P [ABB Power Systems AB, Vaesteraas (Sweden)
1997-07-01
In the past complaints about insufficient power quality were often caused by flicker observed in the neighbourhood of industrial networks. Voltage sags due to faults in the power system pass, however, mostly unnoticed as not-so-common events. Now electronic controls are penetrating more and more in industry. Electronic controllers on factory machines - particularly those for variable speed motors - are vulnerable to voltage sags. A one-tenth second sag can cause a $200.000 downtime incident in a big factory. Therefore the demands on power quality are rising in industry as well. The costly separation in clean networks for residential areas and dirty networks for industrial grids is no perfect solution to avoid such problems. Static VAr Compensators (SVC) are traditionally one means to control the voltage in industrial networks. Because of the recent development of powerful gate turn-off semiconductor devices another type of converter has gained new interest for mitigation of system disturbances, the voltage-source converter (VSC). The characteristics of both types of power electronics in view of their possibilities for this application are presented. (orig.)
Directory of Open Access Journals (Sweden)
Yu Su
2014-03-01
Full Text Available Camera robots are high-speed redundantly cable-driven parallel manipulators that realize the aerial panoramic photographing. When long-span cables and high maneuverability are involved, the effects of cable sags and inertias on the dynamics must be carefully dealt with. This paper is devoted to the optimal cable tension distribution (OCTD for short of the camera robots. Firstly, each fast varying-length cable is discretized into some nodes for computing the cable inertias. Secondly, the dynamic equation integrated with the cable inertias is set up regarding the large-span cables as catenaries. Thirdly, an iterative optimization algorithm is introduced for the cable tension distribution by using the dynamic equation and sag-to-span ratios as constraint conditions. Finally, numerical examples are presented to demonstrate the effects of cable sags and inertias on determining tensions. The results justify the convergence and effectiveness of the algorithm. In addition, the results show that it is necessary to take the cable sags and inertias into consideration for the large-span manipulators.
Directory of Open Access Journals (Sweden)
Sanchita Das
Full Text Available Sodium antimony gluconate (SAG unresponsiveness of Leishmania donovani (Ld had effectively compromised the chemotherapeutic potential of SAG. 60s ribosomal L23a (60sRL23a, identified as one of the over-expressed protein in different resistant strains of L.donovani as observed with differential proteomics studies indicates towards its possible involvement in SAG resistance in L.donovani. In the present study 60sRL23a has been characterized for its probable association with SAG resistance mechanism.The expression profile of 60s ribosomal L23a (60sRL23a was checked in different SAG resistant as well as sensitive strains of L.donovani clinical isolates by real-time PCR and western blotting and was found to be up-regulated in resistant strains. Ld60sRL23a was cloned, expressed in E.coli system and purified for raising antibody in swiss mice and was observed to have cytosolic localization in L.donovani. 60sRL23a was further over-expressed in sensitive strain of L.donovani to check its sensitivity profile against SAG (Sb V and III and was found to be altered towards the resistant mode.This study reports for the first time that the over expression of 60sRL23a in SAG sensitive parasite decreases the sensitivity of the parasite towards SAG, miltefosine and paramomycin. Growth curve of the tranfectants further indicated the proliferative potential of 60sRL23a assisting the parasite survival and reaffirming the extra ribosomal role of 60sRL23a. The study thus indicates towards the role of the protein in lowering and redistributing the drug pressure by increased proliferation of parasites and warrants further longitudinal study to understand the underlying mechanism.
Optimum distributed generation placement with voltage sag effect minimization
International Nuclear Information System (INIS)
Biswas, Soma; Goswami, Swapan Kumar; Chatterjee, Amitava
2012-01-01
Highlights: ► A new optimal distributed generation placement algorithm is proposed. ► Optimal number, sizes and locations of the DGs are determined. ► Technical factors like loss, voltage sag problem are minimized. ► The percentage savings are optimized. - Abstract: The present paper proposes a new formulation for the optimum distributed generator (DG) placement problem which considers a hybrid combination of technical factors, like minimization of the line loss, reduction in the voltage sag problem, etc., and economical factors, like installation and maintenance cost of the DGs. The new formulation proposed is inspired by the idea that the optimum placement of the DGs can help in reducing and mitigating voltage dips in low voltage distribution networks. The problem is configured as a multi-objective, constrained optimization problem, where the optimal number of DGs, along with their sizes and bus locations, are simultaneously obtained. This problem has been solved using genetic algorithm, a traditionally popular stochastic optimization algorithm. A few benchmark systems radial and networked (like 34-bus radial distribution system, 30 bus loop distribution system and IEEE 14 bus system) are considered as the case study where the effectiveness of the proposed algorithm is aptly demonstrated.
S. S. Deswal; Ratna Dahiya; D. K. Jain
2008-01-01
Process control and energy conservation are the two primary reasons for using an adjustable speed drive. However, voltage sags are the most important power quality problems facing many commercial and industrial customers. The development of boost converters has raised much excitement and speculation throughout the electric industry. Now utilities are looking to these devices for performance improvement and reliability in a variety of areas. Examples of these include sags,...
Fatal Toxoplasma gondii infection in the giant panda
Directory of Open Access Journals (Sweden)
2015-01-01
Full Text Available Toxoplasma gondii can infect nearly all warm-blooded animals. We report an acute fatal T. gondii infection in the endangered giant panda (Ailuropoda melanoleuca in a zoo in China, characterized by acute gastroenteritis and respiratory symptoms. T. gondii infection was confirmed by immunological and molecular methods. Multilocus nested PCR-RFLP revealed clonal type I at the SAG1 and c29-2 loci, clonal type II at the SAG2, BTUB, GRA6, c22-8, and L358 loci, and clonal type III at the alternative SAG2 and SAG3 loci, thus, a potential new genotype of T. gondii in the giant panda. Other possible pathogens were not detected. To our knowledge, this is the first report of clinical toxoplasmosis in a giant panda.
Zou, Zhi; Liu, Jianting; Yang, Lifu; Xie, Guishui
2017-01-01
Arabidopsis thaliana SAG12, a senescence-specific gene encoding a cysteine protease, is widely used as a molecular marker for the study of leaf senescence. To date, its potential orthologues have been isolated from several plant species such as Brassica napus and Nicotiana tabacum. However, little information is available in rubber tree (Hevea brasiliensis), a rubber-producing plant of the Euphorbiaceae family. This study presents the identification of SAG12-like genes from the rubber tree genome. Results showed that an unexpected high number of 17 rubber orthologues with a single intron were found, contrasting the single copy with two introns in Arabidopsis. The gene expansion was also observed in another two Euphorbiaceae plants, castor bean (Ricinus communis) and physic nut (Jatropha curcas), both of which contain 8 orthologues. In accordance with no occurrence of recent whole-genome duplication (WGD) events, most duplicates in castor and physic nut were resulted from tandem duplications. In contrast, the duplicated HbSAG12H genes were derived from tandem duplications as well as the recent WGD. Expression analysis showed that most HbSAG12H genes were lowly expressed in examined tissues except for root and male flower. Furthermore, HbSAG12H1 exhibits a strictly senescence-associated expression pattern in rubber tree leaves, and thus can be used as a marker gene for the study of senescence mechanism in Hevea.
Semwal, Vimal Kumar; Singh, Bhupinder; Khanna-Chopra, Renu
2014-04-01
Reproductive sinks regulate monocarpic senescence in crop plants. Monocarpic senescence was studied in wheat fertile (cv. HW 2041) and its isonuclear cytoplasmic male sterile (CMS) line. CMS plants exhibited slower rate of senescence accompanied by longer green leaf area duration and slower deceleration in chlorophyll, protein content, PN and rubisco content coupled with lower protease activities than fertile (F) plants. CMS plants also exhibited lower ROS levels and less membrane damage than F plants. CMS plants maintained better antioxidant defense, less oxidative damage in chloroplast and higher transcript levels of both rbcL and rbcS genes during senescence than F plants. F plants exhibited early induction and higher expression of SAGs like serine and cysteine proteases, glutamine synthetases GS1 and GS2, WRKY53 transcription factor and decline in transcript levels of CAT1 and CAT2 genes than CMS plants. Hence, using genetically fertile and its CMS line of wheat it is confirmed that delayed senescence in the absence of reproductive sinks is linked with slower protein oxidation, rubisco degradation and delayed activation of SAGs. Better antioxidant defense in chloroplasts at later stages of senescence was able to mitigate the deleterious effects of ROS in CMS plants. We propose that delayed increase in ROS in cytoplasmic male sterile wheat plants resulted in delayed activation of WRKY53, SAGs and the associated biochemical changes than fertile plants.
Down-regulation of OsSAG12-1 results in enhanced senescence ...
Indian Academy of Sciences (India)
2013-07-22
Jul 22, 2013 ... vides staple food nearly half of the world's population and accounts .... Healthy and fresh onion ... served domain comprising approximate 210 aa belongs to the peptidase ..... Lim PO, Kim HJ and Nam HG 2007 Leaf senescence. Annu. Rev. ... Effects of P(SAG12)-IPT gene expression on development and.
Béla, Samantha Ribeiro
2007-01-01
Proteínas recombinantes têm sido utilizadas para o diagnóstico sorológico da infecção por Toxoplasma gondii para diferenciar entre as fases aguda e crônica da toxoplasmose. Neste estudo, foi avaliada a reatividade de anticorpos IgG e IgG1 através de imunoensaios em soros de pacientes com toxoplasmose aguda e crônica dirigidos contra dois antígenos recombinantes clonados e expressos em E. coli, SAG2A (molécula recombinante total) e SAG2A(DELTA) (molécula recombinante deletada do...
DEFF Research Database (Denmark)
Dubey, J.P.; Sundar, N.; Pineda, N.
2006-01-01
chickens with titers of 1:5 or less did not shed oocysts. T. gondii was isolated by bioassay in mice from 47 chickens with MAT titers of 1:20 or higher. All infected mice from six isolates died of toxoplasmosis. Overall, 41 of 170 (24.1%) mice that became infected after inoculation with chicken tissues...... died of toxoplasmosis. Genotyping of these 48 isolates (47 from mice and 1 from pooled tissues) using polymorphisms at the loci SAG1, SAG2, SAG3, BTUB and GRA6 revealed eight genotypes. Six isolates had Type I alleles, three isolate had Type II alleles and six isolates had Type III alleles at all loci...
The effect of pre-storage cooling on 2,3-DPG levels in red cells stored in SAG-M.
Llohn, Abid Hussain; Vetlesen, Annette; Fagerhol, Magne Kristoffer; Kjeldsen-Kragh, Jens
2005-10-01
The concentration of red cell 2,3-DPG (2,3-diphosphoglycerate) rapidly decreases during storage. A favourable effect on red cell 2,3-DPG has been demonstrated by rapid cooling of whole blood prior to storage. In our study we have investigated how different methods of cooling whole blood immediately after donation effect 2,3-DPG levels during storage. Thirty-six whole blood units (in 6 groups) of 450 ml were collected in 63 ml CPD. SAG-M was used as preservative solution for red cell concentrates (RCC). The units in one group were cooled down at ambient temperature, while units in the other groups were cooled down rapidly by different ways immediately after bleeding. Samples from the whole blood units were collected at various days during storage for 2,3-DPG measurements. The decline in 2,3-DPG during the first two weeks of storage was significantly slower in the groups which were cooled down rapidly to 17-18 degrees C within 1h after bleeding (all p
Fatal Toxoplasma gondii infection in the giant panda.
Ma, Hongyu; Wang, Zedong; Wang, Chengdong; Li, Caiwu; Wei, Feng; Liu, Quan
2015-01-01
Toxoplasma gondii can infect nearly all warm-blooded animals. We report an acute fatal T. gondii infection in the endangered giant panda (Ailuropoda melanoleuca) in a zoo in China, characterized by acute gastroenteritis and respiratory symptoms. T. gondii infection was confirmed by immunological and molecular methods. Multilocus nested PCR-RFLP revealed clonal type I at the SAG1 and c29-2 loci, clonal type II at the SAG2, BTUB, GRA6, c22-8, and L358 loci, and clonal type III at the alternative SAG2 and SAG3 loci, thus, a potential new genotype of T. gondii in the giant panda. Other possible pathogens were not detected. To our knowledge, this is the first report of clinical toxoplasmosis in a giant panda. © H. Ma et al., published by EDP Sciences, 2015.
Voltage Sag Mitigation and Load Reactive Power Compensation by UPQC
Ajitha, P; Jananisri, D
2014-01-01
This paper presents Unified Power Quality Conditioner(UPQC) that consist of series inverter and shunt inverter in back to back configuration which simultaneously compensate the power quality(PQ) problems of both voltage sag and load reactive power compensation . In this paper ,Neural network is tool which is considered for solving power quality problems. The simulation results from MATLAB/SIMULINK are discussed to validate the proposed method.
International Nuclear Information System (INIS)
Zhang Zhijie; Yu Xinghe; Zhang Chuanheng; Chen Zhankun
2005-01-01
Damoguaihe Formation, which is mainly of alluvial fan, fan delta and lacustrine depositional systems, is the target horizon for the prospecting of sandstone-type uranium deposit in Kelulun sag, Hailaer basin. According to the depositional environment and sediment characteristics, alluvial fan facies is subdivided into upper fan, middle fan and lower fan subfacies; the fan delta facies is subadivided into upper fan delta plain, lower fan delta plain, fan delta front and fan prodelta subfacies. At the northern edge of the sag occurred one fan delta and one alluvial fan, which can mutually transform one into another. The terrigenous coarse-grained clastic deposits in the study area provide favorable condition for the concentration of uranium and especially the main channels and distributary channels on the fan delta and alluvial fan are the most favorable sites for uranium concentration. (authors)
Tang, Xiaoyin; Yang, Shuchun; Hu, Shengbiao
2017-11-01
The Baiyun Sag, located in the deep-water area of the northern South China Sea, is the largest and deepest subbasin in the Pearl River Mouth Basin and one of the most important hydrocarbon-accumulation depression areas in China. Thermal history is widely thought to be of great importance in oil and gas potential assessment of a basin as it controls the timing of hydrocarbon generation and expulsion from the source rock. In order to unravel the paleo-heat flow of the Baiyun Sag, we first analyzed tectonic subsidence of 55 pseudo-wells constructed based on newly interpreted seismic profiles, along with three drilled wells. We then carried out thermal modeling using the multi-stage finite stretching method and calibrated the results using collected present-day vitrinite reflectance data and temperature data. Results indicate that the first and second heating of the Baiyun Sag after 49 Ma ceased at 33.9 Ma and 23 Ma. Reconstructed average basal paleoheat flow values at the end of the rifting periods are 57.7-86.2 mW/m2 and 66.7-97.3 mW/m2, respectively. Following the last heating period at 23 Ma, the study area has undergone a persistent thermal attenuation phase, and basal heat flow has cooled down to 64.0-79.2 mW/m2 at present.
Control of hybrid fuel cell/energy storage distributed generation system against voltage sag
Energy Technology Data Exchange (ETDEWEB)
Hajizadeh, Amin; Golkar, Masoud Aliakbar [Electrical Engineering Department, K.N. Toosi University of Technology, Seyedkhandan, Dr. Shariati Ave, P.O. Box 16315-1355, Tehran (Iran)
2010-06-15
Fuel cell (FC) and energy storage (ES) based hybrid distributed power generation systems appear to be very promising for satisfying high energy and high power requirements of power quality problems in distributed generation (DG) systems. In this study, design of control strategy for hybrid fuel cell/energy storage distributed power generation system during voltage sag has been presented. The proposed control strategy allows hybrid distributed generation system works properly when a voltage disturbance occurs in distribution system and hybrid system stays connected to the main grid. Hence, modeling, controller design, and simulation study of a hybrid distributed generation system are investigated. The physical model of the fuel cell stack, energy storage and the models of power conditioning units are described. Then the control design methodology for each component of the hybrid system is proposed. Simulation results are given to show the overall system performance including active power control and voltage sag ride-through capability of the hybrid distributed generation system. (author)
Nhu Y, Do
2018-03-01
Vietnam has many advantages of wind power resources. Time by time there are more and more capacity as well as number of wind power project in Vietnam. Corresponding to the increase of wind power emitted into national grid, It is necessary to research and analyze in order to ensure the safety and reliability of win power connection. In national distribution grid, voltage sag occurs regularly, it can strongly influence on the operation of wind power. The most serious consequence is the disconnection. The paper presents the analysis of distribution grid's transient process when voltage is sagged. Base on the analysis, the solutions will be recommended to improve the reliability and effective operation of wind power resources.
DEFF Research Database (Denmark)
Li, Zhongyu; Zhao, Rende; Xin, Zhen
2016-01-01
The Inrush Transient Current (ITC) in the output of the photovoltaic grid-connected inverters is usually generated when grid voltage sag occurs, which can trigger the protection of the grid-connected inverters, and even destroy the semiconductor switches. Then, the grid-connected inverters...
Cytokine Gene Expression in Response to SnSAG1 in Horses with Equine Protozoal Myeloencephalitis
Spencer, Jennifer A.; Deinnocentes, Patricia; Moyana, Edith M.; Guarino, Anthony J.; Ellison, Siobhan E.; Bird, R. Curtis; Blagburn, Byron L.
2005-01-01
Equine protozoal myeloencephalitis (EPM) is a neurologic syndrome seen in horses from the Americas and is mainly caused by Sarcocystis neurona. Recently, a 29-kDa surface antigen from S. neurona merozoites was identified as being highly immunodominant on a Western blot. This antigen has been sequenced and cloned, and the expressed protein has been named SnSAG1. In a previous study, cell-mediated immune responses to SnSAG1 were shown to be statistically significantly reduced in horses with EPM in comparison to EPM-negative control horses. It therefore appears as though the parasite is able to induce immunosuppression towards parasite-derived antigens as parasite-specific responses are decreased. Isolated peripheral blood lymphocytes from 21 EPM (cerebrospinal fluid [CSF] Western blot)-negative horses with no clinical signs and 21 horses with clinical signs of EPM (CSF Western blot positive) were cocultured with SnSAG1 for 48 and 72 h, and the effect on cytokine production was investigated by means of reverse transcriptase PCR. Cytokines assayed include gamma interferon (IFN-γ), tumor necrosis factor alpha, interleukin (IL)-2, IL-4, and IL-6. β-Actin was used as the housekeeping gene. A Wilcoxon signed-rank test of the findings indicated that there was a statistically significant decrease in IFN-γ production after 48 h in culture for samples from horses with clinical disease. There was also a statistically significant increase in IL-4 production after 72 h in culture for samples from horses with EPM. These results further support the notion that this parasite is able to subvert the immune system in horses with clinical disease. PMID:15879026
Imokawa, Genji; Ishida, Koichi
2015-01-01
The repetitive exposure of skin to ultraviolet B (UVB) preferentially elicits wrinkling while ultraviolet A (UVA) predominantly elicits sagging. In chronically UVB or UVA-exposed rat skin there is a similar tortuous deformation of elastic fibers together with decreased skin elasticity, whose magnitudes are greater in UVB-exposed skin than in UVA-exposed skin. Comparison of skin elasticity with the activity of matrix metalloproteinases (MMPs) in the dermis of ovariectomized rats after UVB or UVA irradiation demonstrates that skin elasticity is more significantly decreased in ovariectomized rats than in sham-operated rats, which is accompanied by a reciprocal increase in elastase activity but not in the activities of collagenases I or IV. Clinical studies using animal skin and human facial skin demonstrated that topical treatment with a specific inhibitor or an inhibitory extract of skin fibroblast-derived elastase distinctly attenuates UVB and sunlight-induced formation of wrinkling. Our results strongly indicated that the upregulated activity of skin fibroblast-derived elastase plays a pivotal role in wrinkling and/or sagging of the skin via the impairment of elastic fiber configuration and the subsequent loss of skin elasticity. PMID:25856675
DEFF Research Database (Denmark)
Mustafa, Ghullam; Bak-Jensen, Birgitte; Mahat, Pukar
2013-01-01
Any problem with voltage in a power network is undesirable as it aggravates the quality of the power. Power electronic devices such as Voltage Source Converter (VSC) based Static Synchronous Compensator (STATCOM) etc. can be used to mitigate the voltage problems in the distribution system...... to unbalanced faults. The compensation of unbalanced voltage sags and voltage unbalance in the CIGRE distribution network is done by using the four STATCOM compensators already existing in the test grid. The simulations are carried out in DIgSILENT power factory software version 15.0........ The voltage problems dealt with in this paper are to show how to mitigate unbalanced voltage sags and voltage unbalance in the CIGRE Low Voltage (LV) test network and net-works like this. The voltage unbalances, for the tested cases in the CIGRE LV test network are mainly due to single phase loads and due...
Modelling of V-Hz and vector controlled ASDs in PSCAD/EMTDC for voltage sag studies
Energy Technology Data Exchange (ETDEWEB)
Vegunta, S.C. [TNEI Services Ltd, Manchester M1 2PW (United Kingdom); Milanovic, J.V. [School of Electrical and Electronic Engineering of The University of Manchester, PO Box 88, Manchester M60 1QD (United Kingdom); Djokic, S.Z. [School of Engineering of The University of Edinburgh, The King' s Buildings, Mayfield Road, Edinburgh EH9 3JL (United Kingdom)
2010-01-15
This paper deals with modelling and performance of adjustable speed drives (ASDs) subjected to voltage disturbances in electric supply. The aim of this study was to develop appropriate models of typical ASD and investigate their sensitivity to voltage disturbances under various practical modes of operation and control. Accordingly, scalar controlled open and closed loop volts-hertz (V-Hz) and vector controlled closed loop ASDs are modelled in PSCAD/EMTDC environment, and their performance in the presence of voltage disturbances is investigated under typical operating and loading conditions. The drive sensitivity to three-phase, two-phase and single-phase voltage sags and short interruptions was assessed, and the findings are discussed in the paper. Depending on the type of drive control, type of voltage sag, applied load torque and adjusted speed, various sensitivity curves were established and analyzed. (author)
Rummel, John D; Beaty, David W; Jones, Melissa A; Bakermans, Corien; Barlow, Nadine G; Boston, Penelope J; Chevrier, Vincent F; Clark, Benton C; de Vera, Jean-Pierre P; Gough, Raina V; Hallsworth, John E; Head, James W; Hipkin, Victoria J; Kieft, Thomas L; McEwen, Alfred S; Mellon, Michael T; Mikucki, Jill A; Nicholson, Wayne L; Omelon, Christopher R; Peterson, Ronald; Roden, Eric E; Sherwood Lollar, Barbara; Tanaka, Kenneth L; Viola, Donna; Wray, James J
2014-11-01
A committee of the Mars Exploration Program Analysis Group (MEPAG) has reviewed and updated the description of Special Regions on Mars as places where terrestrial organisms might replicate (per the COSPAR Planetary Protection Policy). This review and update was conducted by an international team (SR-SAG2) drawn from both the biological science and Mars exploration communities, focused on understanding when and where Special Regions could occur. The study applied recently available data about martian environments and about terrestrial organisms, building on a previous analysis of Mars Special Regions (2006) undertaken by a similar team. Since then, a new body of highly relevant information has been generated from the Mars Reconnaissance Orbiter (launched in 2005) and Phoenix (2007) and data from Mars Express and the twin Mars Exploration Rovers (all 2003). Results have also been gleaned from the Mars Science Laboratory (launched in 2011). In addition to Mars data, there is a considerable body of new data regarding the known environmental limits to life on Earth-including the potential for terrestrial microbial life to survive and replicate under martian environmental conditions. The SR-SAG2 analysis has included an examination of new Mars models relevant to natural environmental variation in water activity and temperature; a review and reconsideration of the current parameters used to define Special Regions; and updated maps and descriptions of the martian environments recommended for treatment as "Uncertain" or "Special" as natural features or those potentially formed by the influence of future landed spacecraft. Significant changes in our knowledge of the capabilities of terrestrial organisms and the existence of possibly habitable martian environments have led to a new appreciation of where Mars Special Regions may be identified and protected. The SR-SAG also considered the impact of Special Regions on potential future human missions to Mars, both as locations of
Energy Technology Data Exchange (ETDEWEB)
Ramos, Alessandro Candido Lopes [CELG - Companhia Energetica de Goias, Goiania, GO (Brazil). Generation and Transmission. System' s Operation Center], E-mail: alessandro.clr@celg.com.br; Batista, Adalberto Jose [Universidade Federal de Goias (UFG), Goiania, GO (Brazil)], E-mail: batista@eee.ufg.br; Leborgne, Roberto Chouhy [Universidade Federal do Rio Grande do Sul (UFRS), Porto Alegre, RS (Brazil)], E-mail: rcl@ece.ufrgs.br; Emiliano, Pedro Henrique Mota, E-mail: ph@phph.com.br
2009-07-01
This article presents the impact of distributed generation in studies of voltage sags caused by faults in the electrical system. We simulated short-circuit-to-ground in 62 lines of 230, 138, 69 and 13.8 kV that are part of the electrical system of the city of Goiania, of Goias state . For each fault position was monitored the bus voltage of 380 V in an industrial consumer sensitive to such sags. Were inserted different levels of GD near the consumer. The simulations of a short circuit, with the monitoring bar 380 V, were performed again. A study using stochastic simulation Monte Carlo (SMC) was performed to obtain, at each level of GD, the probability curves and sags of the probability density and its voltage class. With these curves were obtained the average number of sags according to each class, that the consumer bar may be submitted annually. The simulations were performed using the Program Analysis of Simultaneous Faults - ANAFAS. In order to overcome the intrinsic limitations of the methods of simulation of this program and allow data entry via windows, a computational tool was developed in Java language. Data processing was done using the MATLAB software.
A sagging along the eastern Chianti Mts., Italy
Coltorti, M.; Ravani, S.; Cornamusini, G.; Ielpi, A.; Verrazzani, F.
2009-11-01
A deep-seated gravitational slope deformation (DGSD) affects the eastern side of the Chianti Mts. Ridge. It develops in an N-S to NW-SE direction and is > 10 km wide and 3-4 km long. This area corresponds to the eastern side of a main antiform, characterised by east-verging folds and thrusts involving bedrock of the Mesozoic-Paleogene Tuscan Units, particularly sandstones containing interlayered highly fractured and deformed Ligurian rocks (shales and limestones with olistostromes). The foot of the slope is characterised by tilted Plio-Pleistocene deposits unconformably sealing the bedrock structures as folds, thrusts and faults. The most significant morphological features are a main escarpment, trenches, several secondary and counter-slope escarpments that together indicate large-scale gravitational phenomena. The main escarpment is responsible for the headward retreat of the slope, and is deeply segmented by numerous arcuate niches that reveal differential movements of single blocks. The DGSD is also dissected by SW-NE trending streams that often deepen inside the N-S trenches. Minor landslides due to local instability are also present. At the foot of the slope, the older continental Pliocene deposits of the Upper Valdarno Basin crop out. Although tilted by tectonic movements, the deposits have not been severely affected by gravitational deformations. This indicates that the movement is a typical sagging, a large landslide at an embryonic stage, affecting the upper part of the slope but not reaching the valley bottom. The deformations are absorbed in the rock mass which is also partially drained by stream incision that prevents high pore pressure. The occurrence of down-slope and down-movement facing escarpments and up-slope and up-movement facing counter-slope escarpments indicate a sagging characterised by a listric spoon-shaped geometry. The DGSD has a style similar to crustal extensional tectonics such as Morton and Black's crustal attenuation model. Although
DEFF Research Database (Denmark)
Zhou, Q.; Nielsen, Søren R.K.; Qu, W. L.
2006-01-01
Three-dimensional semi-active vibration control of an inclined sag cable with discrete magnetorheological (MR) dampers is investigated in this paper using the finite difference method (FDM). A modified Dahl model is used to describe the dynamic property of MR damper. The nonlinear equations...
Control Method Stretches Suspensions by Measuring the Sag of Strands in Cable-Stayed Bridges
Bętkowski, Piotr
2017-10-01
In the article is described the method that allows on evaluation and validation of measurement correctness of dynamometers (strain gauges, tension meters) used in systems of suspensions. Control of monitoring devices such as dynamometers is recommended in inspections of suspension bridges. Control device (dynamometer) works with an anchor, and the degree of this cooperation could have a decisive impact on the correctness of the results. Method, which determines the stress in the strand (cable), depending on the sag of stayed cable, is described. This method can be used to control the accuracy of measuring devices directly on the bridge. By measuring the strand sag, it is possible to obtain information about the strength (force) which occurred in the suspension cable. Digital camera is used for the measurement of cable sag. Control measurement should be made independently from the controlled parameter but should verify this parameter directly (it is the best situation). In many cases in practice the controlled parameter is not designation by direct measurement, but the calculations, i.e. relation measured others parameters, as in the method described in the article. In such cases occurred the problem of overlapping error of measurement of intermediate parameters (data) and the evaluation of the reliability of the results. Method of control calculations made in relation to installed in the bridge measuring devices is doubtful without procedure of uncertainty estimation. Such an assessment of the accuracy can be performed using the interval numbers. With the interval numbers are possible the analysis of parametric relationship accuracy of the designation of individual parameters and uncertainty of results. Method of measurements, relations and analytical formulas, and numerical example can be found in the text of the article.
Improving Energy Efficiency Via Optimized Charge Motion and Slurry Flow in Plant Scale Sag Mills
Energy Technology Data Exchange (ETDEWEB)
Raj K. Rajamani
2006-07-21
A research team from the University of Utah is working to make inroads into saving energy in these SAG mills. In 2003, Industries of the Future Program of the Department of Energy tasked the University of Utah team to build a partnership between the University and the mining industry for the specific purpose of reducing energy consumption in SAG mills. A partnership was formed with Cortez Gold Mines, Outokumpu Technology, Kennecott Utah Copper Corporation, and Process Engineering Resources Inc. At Cortez Gold Operations the shell and pulp lifters of the semiautogenous grinding mill was redesigned. The redesigned shell lifter has been in operation for over three years and the redesigned pulp lifter has been in operation for over nine months now. This report summarizes the dramatic reductions in energy consumption. Even though the energy reductions are very large, it is safe to say that a 20% minimum reduction would be achieved in any future installations of this technology.
Directory of Open Access Journals (Sweden)
Gang Gao
2015-01-01
Full Text Available To figure out the process and controlling factors of gas reservoir formation in deep-waters, based on an analysis of geological features, source of natural gas and process of reservoir formation in the Liwan 3-1 gas field, physical simulation experiment of the gas reservoir formation process has been performed, consequently, pattern and features of gas reservoir formation in the Baiyun sag has been found out. The results of the experiment show that: ① the formation of the Liwan 3-1 faulted anticline gas field is closely related to the longstanding active large faults, where natural gas is composed of a high proportion of hydrocarbons, a small amount of non-hydrocarbons, and the wet gas generated during highly mature stage shows obvious vertical migration signs; ② liquid hydrocarbons associated with natural gas there are derived from source rock of the Enping & Zhuhai Formation, whereas natural gas comes mainly from source rock of the Enping Formation, and source rock of the Wenchang Formation made a little contribution during the early Eocene period as well; ③ although there was gas migration and accumulation, yet most of the natural gas mainly scattered and dispersed due to the stronger activity of faults in the early period; later as fault activity gradually weakened, gas started to accumulate into reservoirs in the Baiyun sag; ④ there is stronger vertical migration of oil and gas than lateral migration, and the places where fault links effective source rocks with reservoirs are most likely for gas accumulation; ⑤ effective temporal-spatial coupling of source-fault-reservoir in late stage is the key to gas reservoir formation in the Baiyun sag; ⑥ the nearer the distance from a trap to a large-scale fault and hydrocarbon source kitchen, the more likely gas may accumulate in the trap in late stage, therefore gas accumulation efficiency is much lower for the traps which are far away from large-scale faults and hydrocarbon source
Leito, Jelani T. D.; Ligtenberg, Antoon J. M.; van Houdt, Michel; van den Berg, Timo K.; Wouters, Diana
2011-01-01
Salivary agglutinin (SAG), also known as gp-340 and Deleted in Malignant Brain Tumours 1, is a glycoprotein that is present in tears, lung fluid and mucosal surfaces along the gastrointestinal tract. It is encoded by the Deleted in Malignant Brain Tumours 1 gene, a member of the Scavenger Receptor
An Enhanced LVRT Scheme for DFIG-based WECSs under Both Balanced and Unbalanced Grid Voltage Sags
DEFF Research Database (Denmark)
Mohammadi, Jafar; Afsharnia, Saeed; Ebrahimzadeh, Esmaeil
2017-01-01
reactive power into the grid. The passive compensator is based on a three-phase stator damping resistor (SDR) located in series with the stator windings. The proposed scheme decreases the negative effects of grid voltage sags in the DFIG system including the rotor over-currents, electromagnetic torque...
DEFF Research Database (Denmark)
Nielsen, Hans Jørgen; Hammer, J H; Moesgaard, F
1991-01-01
The influence of perioperative whole-blood transfusion and transfusion with erythrocyte suspension (SAG-M blood) on postoperative depression of cell-mediated immunity (CMI) was investigated in 67 patients who underwent elective resection for colorectal cancer. Cell-mediated immunity was assessed...
International Nuclear Information System (INIS)
Wenzel, R.P.; Teates, C.D.; Galapon, Q.; Barczak, R.; Ling, C.M.; Overby, L.R.
1975-01-01
The radioimmunoassay (RIA) and counterimmunoelectrophoretic (CIE) methods were compared in detecting hepatitis B antigen (HB/sub s/Ag) in 407 acute and 336 convalescent sera of adults with viral hepatitis. The CIE method demonstrated that 41 percent of acute and 28 percent of 14- to 17-day serum specimens were HB/sub s/Ag-positive. The RIA method demonstrated seropositivity in 60 percent of acute and 56 percent of convalescent specimens (P less than .001). Eighty-four percent of coded specimens initially positive for HB/sub s/Ag by RIA were found to have subtype antigenic determinants d or y; 92 percent of the HB/sub s/Ag-negative controls were negative for subtype antigens, confirming the specificity of the RIA test. RIA subtyping data corroborated earlier work with immunodiffusion techniques. (U.S.)
Tang, Y.
2009-12-01
Northern South China Sea Margin locates in Eurasian plate,Indian-Australia plate,Pacific Plates.The South China Sea had underwent a complicated tectonic evolution in Cenozoic.During rifting,the continental shelf and slope forms a series of Cenozoic sedimentary basins,including Qiongdongnan basin,Pearl River Mouth basin,Taixinan basin.These basins fill in thick Cenozoic fluviolacustrine facies,transitional facies,marine facies,abyssal facies sediment,recording the evolution history of South China Sea Margin rifting and ocean basin extending.The studies of tectonics and deposition of depression in the Southern Chaonan Sag of lower continental slope in the Norther South China Sea were dealt with,based on the sequence stratigraphy and depositional facies interpretation of seismic profiles acquired by cruises of“China and Germany Joint Study on Marine Geosciences in the South China Sea”and“The formation,evolution and key issues of important resources in China marginal sea",and combining with ODP 1148 cole and LW33-1-1 well.The free-air gravity anomaly of the break up of the continental and ocean appears comparatively low negative anomaly traps which extended in EW,it is the reflection of passive margin gravitational effect.Bouguer gravity anomaly is comparatively low which is gradient zone extended NE-SW.Magnetic anomaly lies in Magnetic Quiet Zone at the Northern Continental Margin of the South China Sea.The Cenozoic sediments of lower continental slope in Southern Chaonan Sag can be divided into five stratum interface:SB5.5,SB10.5,SB16.5,SB23.8 and Hg,their ages are of Pliocene-Quaternary,late Miocene,middle Miocene,early Miocene,paleogene.The tectonic evolution of low continental slope depressions can be divided into rifting,rifting-depression transitional and depression stages,while their depositional environments change from river to shallow marine and abyssa1,which results in different topography in different stages.The topographic evolvement in the study
Melo, R P B; Almeida, J C; Lima, D C V; Pedrosa, C M; Magalhães, F J R; Alcântara, A M; Barros, L D; Vieira, R F C; Garcia, J L; Mota, R A
2016-07-15
Toxoplasma gondii isolates from Brazil have a different phenotypic and genotypic pattern, with predominance of virulent isolates and recombinant genotypes, compared to the North Hemisphere. Considering that a new T. gondii genotype, non-pathogenic to mice, was previously identified from free-range chickens from the Fernando de Noronha Island, Brazil, this study aimed to identify genotypes of this parasite in tissue samples of feral cats (Felis catus) from this Brazilian Island. Anti-T. gondii IgG antibodies were detected in 18/31 (58%) feral cats. Two non-virulent T. gondii isolates were obtained by mouse bioassay. Genotyping was performed by PCR-RFLP using 10 genetic markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, PK1, L358 and Apico) and an atypical strain of T. gondii (ToxoDB #146) was identified. This is the first report of this genotype in feral cats. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Alejandro Castillo Guasca
2013-07-01
Full Text Available Es de gran importancia conocer cuáles son las causas para que se presenten sags en las barrajes de distribución, debido a que la afectación sobre los clientes industriales es de carácter relevante. Por esta razón se planteó una metodología para buscar la correlación existente entre sags y los eventos ambientales u operativos del sistema de distribución. A manera de ejemplo, se aplicó en tres subestaciones, las cuales se encuentran ubicadas en diferentes sectores de la ciudad. Para el desarrollo de esta metodología, se realizó la correlación de los datos mediante la implementación de tablas dinámicas y programación en Access, donde se evidenció qué tipo de eventos son los que tienen un mayor impacto sobre los clientes. De acuerdo a los resultados obtenidos se sugiere algunas recomendaciones para mitigar este tipo de eventos en el sistema de distribución.
de Almeida, Jonatas Campos; de Melo, Renata Pimentel Bandeira; de Morais Pedrosa, Camila; da Silva Santos, Marcelo; de Barros, Luiz Daniel; Garcia, João Luis; Porto, Wagnner José Nascimento; Mota, Rinaldo Aparecido
2017-05-01
Wild animals may play an important role in the transmission and maintenance of Toxoplasma gondii in the environment. The purpose of the present study was to isolate and genotype T. gondii from a free-ranging crab-eating fox (Cerdocyon thous-Linnaeus, 1766). A crab-eating fox in critical health condition was attended in a veterinary hospital in Recife, Pernambuco State, Brazil. The animal died despite emergency treatment. The brain was collected aseptically and destined for mouse bioassay. One isolate of T. gondii was obtained, and Polymerase Chain Reaction - Restriction Fragment Length Polymorphism (PCR-RFLP) was used to assess genetic variability at 11 markers (SAG1, SAG2, altSAG2, SAG3, BTUB, GRA6, c228, c292, L358, PK1 and APICO). A murine model was used to assess the virulence of the isolate. Using the PCR-RFLP, genotype ToxoDB #13 was identified, which is considered an atypical strain. The isolate was classified as avirulent in the murine model. This is the first study to report T. gondii infection in the crab-eating fox. Copyright © 2017 Elsevier B.V. All rights reserved.
Ying, Yuqing; Verma, Shiv K; Kwok, Oliver C H; Alibana, Fatima; Mcleod, Rima; Su, Chunlei; Dubey, Jitender P; Pradhan, Abani K
2017-05-01
Chickens are considered important in the epidemiology of Toxoplasma gondii. Chicken hearts (n = 1185) obtained from grocery stores were tested for T. gondii infection. Antibodies to T. gondii were assayed in fluid removed from the heart cavity using the modified agglutination test (MAT) at 1:5, 1:25, and 1:100 dilutions. MAT antibodies were detected in 222 hearts at 1:5 dilution and 8 hearts at 1:25 dilution, but none were positive at 1:100 dilution. Seropositive (n = 230, 19.4%) chicken hearts were bioassayed in mice and seronegative (n = 157) chickens were bioassayed in cats. Viable T. gondii was not isolated from any hearts by bioassays in mice. The 2 cats fed 60 and 97 hearts did not excrete T. gondii oocysts. The results indicate a low prevalence of viable T. gondii in chickens from grocery stores. Molecular typing of 23 archived T. gondii strains isolated from free-range chickens from Ohio and Massachusetts using the 10 PCR-RFLP markers including SAG1, SAG2 (5'-3'SAG2 and altSAG2), SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico revealed that seven were ToxoDB PCR-RFLP genotype #1, 11 were genotype #2, one was genotype #3, three were genotype #170, and one was mixed genotype. These results indicate that the clonal genotypes #1 (type II), #2 (type III), and #3 (type II variant) are common in free-range chickens.
Mesozoic to Cenozoic tectonic transition process in Zhanhua Sag, Bohai Bay Basin, East China
Cheng, Yanjun; Wu, Zhiping; Lu, Shunan; Li, Xu; Lin, Chengyan; Huang, Zheng; Su, Wen; Jiang, Chao; Wang, Shouye
2018-04-01
The Zhanhua sag is part of the Bohai Bay intracontinental basin system that has developed since the Mesozoic in East China. The timing of this basin system coincides with the final assembly of East Asia and the development of Western Pacific-type plate margin. Here we use 3-D seismic and core log data to investigate the evolution of this basin and discuss its broad tectonic settings. Our new structural study of Zhanhua sag suggests that there are four major tectonic transitions occurred in the Bohai Bay Basin during Mesozoic and Cenozoic: (1) The first tectonic transition was from stable Craton to thrusting during the Triassic, mainly caused by the South China Block's subduction northward beneath the North China Block, which induced the formation of the NW-striking thrust faults. (2) The second tectonic transition was mainly characterized by a change from compression to extension, which can be further divided into two-stages. At the first stage, two episodes of NW-SE shortening occurred in East Asia during Early-Middle Jurassic and Late Jurassic-earliest Cretaceous, respectively. At the second stage, the extension and left-lateral shearing took place during Early Cretaceous while compression occurred during Late Cretaceous. The NW-striking thrust faults changed to normal faults and the NNE-striking left-lateral strike-slip faults started to influence the eastern part of the basin. (3) The third transition occurred when the NW-SE extension and NNE-striking right-lateral shearing started to form during Paleogene, and the peak deformation happen around 40 Ma due to the change of the subduction direction of Pacific Plate relative to Eurasia Plate. The NE-striking normal faults are the main structure, and the pre-existing NNE-striking strike-slip faults changed from left-lateral to right-lateral. (4) The fourth transition saw the regional subsidence during Neogene, which was probably caused by the India-Asia "Hard collision" between 25 and 20 Ma.
Xu, Han; Wang, Xin-Wen; Yan, Dan-Ping; Qiu, Liang
2018-06-01
The Dongpu Sag, located in the Bohai Bay Basin, NE China, is a Cenozoic continental rift basin. The post-rift evolution of the Dongpu Sag is associated with the development of petroleum reservoirs and has implications for Neogene-Quaternary basin evolution along the eastern margin of Eurasia. To determine the nature and origin of post-rift subsidence in the Dongpu Sag, we apply backstripping, modified strain-rate inversion, and revised finite extension modelling techniques, using data from 14 real and synthetic wells that are intersected by three seismic lines. Our results reveal discrepancies by subsidence based on backstripping of well data (the observed subsidence) minus that predicted by modified strain-rate inversion and revised finite extension modelling (the predicted subsidence). During the Miocene, the observed subsidence was smaller than the predicted subsidence, leaving negative discrepancies referred to here as "insufficient subsidence" ranging from -343 to -96 m. In contrast, during the Pliocene-Quaternary the observed subsidence was greater than the predicted subsidence by +123 to +407 m, which left positive discrepancies referred to as "over-sufficient subsidence". Therefore, we infer a transition from insufficient to over-sufficient subsidence during the post-rift stage. Normal faulting that started at ca. 5.3 Ma is estimated to have produced only ∼20% of the over-sufficient subsidence. Therefore, the remaining over-sufficient subsidence, as well as the preceding insufficient subsidence and the transition between the two, were likely controlled by lithosphere processes. We propose a new tectonic model in which variations in the conditions (e.g. rate, direction, and angle) associated with subduction of the Pacific plate resulted in a change of heat flow decreasing from a linear to a curvilinear pattern, leading to a transition from insufficient to over-sufficient subsidence.
Liao, Y.; Wang, H.; Xu, W.
2013-12-01
Normal fault arrays and associated relay ramps between two overlapping en-echelon normal faults are well known to control the deposition and distribution of sediments in alluvial, fluvial and deltaic systems in rift settings. The influence of transfer zones or relay ramps on sediment routes and dispersal patterns in subaqueous (deeper marine/lacustrine), however, is barely studied and hence less clear. Previous experimental studies indicate that subaqueous relay ramps may act as sediment transportation pathways if certain conditions are available. In this study, we integrate detailed structural and stratigraphic analysis with three-dimensional seismic data and limited well log data from the Qikou Sag to examine the tectonic evolution and the syn-rift sediment patterns response to fault growth and linkage in an active rift setting. Qikou Sag is located at the center of Huanghua Depression, Bohaiwan Basin of eastern China. Structurally, it is a typical continental rift basin characterized by a linked system of two NEE-SWW-striking half-grabens and one E-W-striking graben. Qikou sag is filled with Eocene-Oligocene syn-rift sediments and Miocene to Quaternary post-rift sediments. The Eocene-Oligocene rifting stage can be divided into early rifting period (43-36.5 Ma, the third member and second member of Shahejie Formation, Es3 and Es2), stable rifting period (36.5-29Ma, the first member of Shaehejie Formation, Es1) and fault-depressed diversionary period (29-24.6Ma, the Dongying Formation, Ed). This study focus on the early syn-rift, the third and second member of Shehejie Formation, which is mostly dark-grey mudstone interbedded with fine to coarse-grained sandstone deposited by large-scale turbidity currents in deep-lake. In particular, we use a combination of thickness variability and facies distributions, onlap patterns within a high-resolution sequence stratigraphic framework, integrated with structural geometry, fault activity and subsidence history analysis to
DEFF Research Database (Denmark)
Shokri, Yunes; Ebrahimzadeh, Esmaeil; Lesani, Hamid
2014-01-01
under unbalanced grid voltage and small voltage sag conditions without needing additional DC link capacitor or energy storage unlike other methods. The control system includes negative and positive sequence controllers which make the stator voltage balanced and keep it constant at the nominal value...
Ye, Qing; Mei, Lianfu; Shi, Hesheng; Shu, Yu; Camanni, Giovanni; Wu, Jing
2018-04-01
The basement structure of the Cenozoic Enping Sag, within the Pearl River Mouth Basin on the northern margin of South China Sea, is revealed by borehole-constrained high-quality 3D seismic reflection data. Such data suggest that the Enping Sag is bounded in the north by a low-angle normal fault. We interpret this low-angle normal fault to have developed as the result of the reactivation of a pre-existing thrust fault part of a pre-Cenozoic thrust system. This is demonstrated by the selective reactivation of the pre-existing thrust and by diffuse contractional deformation recognized from the accurate analysis of basement reflections. Another significant result of this study is the finding of some residual rift basins within the basement of the Enping Sag. Both the thrust system and the residual basins are interpreted to have developed after the emplacement of continental margin arc-related granitoids (J3-K1) that define the basement within the study area. Furthermore, seismic sections show that the pre-existing residual rift basins are offset by the main thrust fault and they are both truncated by the Tg unconformity. These structural relationships, interpreted in the frame of previous studies, help us to reconstruct a six-event structural evolution model for the Enping Sag from the late Mesozoic to the early Cenozoic. In particular, we interpret the residual rift basins to have formed as the result of back-arc extension due to the slab roll-back of the Paleo-Pacific Plate subduction in the early K2. The thrust system has recorded a compressional event in the late K2 that followed the back-arc extension in the SCS area. The mechanism of this compressional event is still to be clarified, and might be related to continuous subduction of the Paleo-Pacific Plate or to the continent-continent collision between a micro-continental block and the South China margin.
Deng, Peng; Mei, Lianfu; Liu, Jun; Zheng, Jinyun; Liu, Minghui; Cheng, Zijie; Guo, Fengtai
2018-03-01
Considerable post-breakup extensional deformation is recorded in the continental margins of the South China Sea (SCS). To recognize the nature and origin of the significant deformation during the syn-spreading stage (32-15.5 Ma) in the SCS, we comprehensively analyzed the geometry and kinematics of the faults and contemporaneous magmas in the Baiyun sag, northern margin of the SCS, using high-resolution regional three-dimensional seismic data. The kinematic analyses indicate that the faults in the Baiyun sag are recently formed following the onset of seafloor spreading in the SCS. The faults exhibit multiple episodes of growth history, with three active episodes, 32-29, 23.8-21 and 18.5-16.5 Ma, separated by periods of inactivity. Four volcanic groups comprising 98 volcanic mounds have been identified and described, located separately in the northwestern, the central, the southeastern and the northern slope areas. The occurrence of multiple palaeo-seafloors, complemented by the biostratigraphic and K-Ar dating data, reveals multiple extrusive events of the syn-spreading magmas in the Baiyun sag, with three active periods of 23.8-21, 18.5-17.5 and 17.5-16.5 Ma. This study confirms that the normal faulting has a shared genetic origin with the contemporaneous magmatism during the syn-spreading stage in the deep-offshore Baiyun sag, northern margin of the SCS. The episodic fault growth and magmatic extrusive events reveal that the Baiyun sag has undergone at least three episodic tectonic events during the syn-spreading stage, which evolved in response to the multi-stage seafloor spreading of the SCS.
Vitaliano, S N; Soares, H S; Minervino, A H H; Santos, A L Q; Werther, K; Marvulo, M F V; Siqueira, D B; Pena, H F J; Soares, R M; Su, C; Gennari, S M
2014-12-01
This study aimed to isolate and genotype T. gondii from Brazilian wildlife. For this purpose, 226 samples were submitted to mice bioassay and screened by PCR based on 18S rRNA sequences. A total of 15 T. gondii isolates were obtained, including samples from four armadillos (three Dasypus novemcinctus, one Euphractus sexcinctus), three collared anteaters (Tamandua tetradactyla), three whited-lipped peccaries (Tayassu pecari), one spotted paca (Cuniculus paca), one oncilla (Leopardus tigrinus), one hoary fox (Pseudalopex vetulus), one lineated woodpecker (Dryocopus lineatus) and one maned wolf (Chrysocyon brachyurus). DNA from the isolates, originated from mice bioassay, and from the tissues of the wild animal, designated as "primary samples", were genotyped by PCR-restriction fragment length polymorphism (PCR/RFLP), using 12 genetic markers (SAG1, SAG2, alt.SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L258, PK1, CS3 and Apico). A total of 17 genotypes were identified, with 13 identified for the first time and four already reported in published literature. Results herein obtained corroborate previous studies in Brazil, confirming high diversity and revealing unique genotypes in this region. Given most of genotypes here identified are different from previous studies in domestic animals, future studies on T. gondii from wildlife is of interest to understand population genetics and structure of this parasite.
Directory of Open Access Journals (Sweden)
S.N. Vitaliano
2014-12-01
Full Text Available This study aimed to isolate and genotype T. gondii from Brazilian wildlife. For this purpose, 226 samples were submitted to mice bioassay and screened by PCR based on 18S rRNA sequences. A total of 15 T. gondii isolates were obtained, including samples from four armadillos (three Dasypus novemcinctus, one Euphractus sexcinctus, three collared anteaters (Tamandua tetradactyla, three whited-lipped peccaries (Tayassu pecari, one spotted paca (Cuniculus paca, one oncilla (Leopardus tigrinus, one hoary fox (Pseudalopex vetulus, one lineated woodpecker (Dryocopus lineatus and one maned wolf (Chrysocyon brachyurus. DNA from the isolates, originated from mice bioassay, and from the tissues of the wild animal, designated as “primary samples”, were genotyped by PCR–restriction fragment length polymorphism (PCR/RFLP, using 12 genetic markers (SAG1, SAG2, alt.SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L258, PK1, CS3 and Apico. A total of 17 genotypes were identified, with 13 identified for the first time and four already reported in published literature. Results herein obtained corroborate previous studies in Brazil, confirming high diversity and revealing unique genotypes in this region. Given most of genotypes here identified are different from previous studies in domestic animals, future studies on T. gondii from wildlife is of interest to understand population genetics and structure of this parasite.
Directory of Open Access Journals (Sweden)
Mert Döşkaya
Full Text Available Toxoplasma gondii causes congenital toxoplasmosis in newborns resulting with fetal anomalies. Determining the initiation time of infection is very important for pregnant women and current serological assays have drawbacks in distinguishing the recently acute toxoplasmosis. Diagnosis of recently acute infection may be improved by using stage specific antigens in serological assays. In the present study, the diagnostic value of sporozoite specific SporoSAG, bradyzoite specific BAG1 proteins and GRA1 protein expressed by all forms of the parasite have been evaluated ELISA using sera systematically collected from mice administered orally with tissue cyst and oocysts. The anti-SporoSAG IgM antibodies in sera obtained from mice infected with oocysts peaked significantly at days 1, 10, and 15 (P<0.01. The anti-BAG1 IgM antibodies in sera obtained from mice infected with tissue cysts peaked significantly at days 15, 40, and 120 (P<0.05. The anti-GRA1 IgM antibodies in sera obtained from mice infected with oocysts peaked significantly at days 2, 10, and 40 (P<0.01. The anti-GRA1 IgM antibodies in sera obtained from mice infected with tissue cysts peaked significantly only at day 40 (P<0.05. The anti-SporoSAG, anti-BAG1, and anti-GRA1 IgG titers of mice showed significant increases at day 40 (P<0.05 and decrement started for only anti-GRA1 IgG at day 120. The presence of anti-SporoSAG IgM and IgG antibodies can be interpreted as recently acute infection between days 10-40 because IgM decreases at day 40. Similarly, presence of anti-BAG1 IgM and absence of IgG can be evaluated as a recently acute infection that occurred 40 days before because IgG peaks at day 40. A peak in anti-GRA1 antibody level at first testing and reduction in consecutive sample can be considered as an infection approximately around day 40 or prior. Overall, recombinant SporoSAG, BAG1 and GRA1 proteins can be accepted as valuable diagnostic markers of recently acute toxoplasmosis.
Chen, R.; Fan, J.
2015-12-01
The concept of drowning unconformity of lacustrine rift basins was proposed in this paper. This paper utilized 3D seismic data, well-log and the principles methods associated with structural geology, sedimentology and geochemistry, to analyze the drowning unconformity and discuss the origins of drowning unconformity in Dongying Sag in Bohai Bay Basin.Researching on it is not only important for a better understanding of tectonic evolution, palaeogeography and sedimentation of hydrocarbon source rocks, but also a vital guiding significance for the exploration of beach-bar sandstone reservoirs and shale oil.1. The concept of drowning unconformity of lacustrine rift basins is defined. With the consequences of rapid tectonic subsidence in basin, the sharp rise of lake-level and the increased rate of accommodation(A) in basin exceeded the rate of sediment supply(S),namely A>>S, the basin suddenly transformed into deep-water settings from shallow-water settings with sudden change of sediment transport and sediment dispersal patterns. 2.The sequence surface between Sha4 and Sha3 Member of Shahejie Formation is the drowning unconformity(43.5Ma). There are the sedimentary association of the reefs in shallow lacustrine, beach-bar sandstones and glutenite fan bodies under the surface. By contrast, there are the sedimentary association of deep-lake oil shales and shales over the surface. The drowning unconformity in Dongying Sag is a tectonic revolution surface which is changed from extensional tectonics to transtensional tectonics and it is also the surface of discontinuity from shallow lacustrine to deep lacustrine. The responses to sudden changes appeared in the parameters of geophysics, geochemistry and paleontology. 3. With the penetration of India into Asia plate in NNE trending,the subduction zones of Pacific Plate retreated. It caused the rapid downwelling of asthenospheric mantle, followed by the extensive drowning unconformity.
Chikweto, Alfred; Sharma, Ravindra N; Tiwari, Keshaw P; Verma, Shiv K; Calero-Bernal, Rafael; Jiang, Tiantian; Su, Chunlei; Kwok, Oliver C; Dubey, Jitender P
2017-02-01
The objectives of the present cross-sectional study were to isolate and genotype Toxoplasma gondii in free-range chickens from Grenada, West Indies. Using the modified agglutination test, antibodies to T. gondii were found in 39 (26.9%) of 145 free-range chickens with titers of 25 in 7 chickens, 50 in 6 chickens, 100 in 2 chickens, and 200 or higher in 24 chickens. The hearts of the 39 seropositive chickens were bioassayed in mice; viable T. gondii was isolated from 20 and further propagated in cell culture. Genotyping of T. gondii DNA extracted from cell-cultured tachyzoites using the 10 PCR-restriction fragment length polymorphism (RFLP) markers SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico revealed 4 genotypes, including ToxoDB PCR-RFLP no. 2 (Type III), no. 7, no. 13, and no. 259 (new). These results indicated that T. gondii population genetics in free-range chickens seems to be moderately diverse with ToxoDB no. 2 (Type III) as the most frequent (15/20 = 75%) compared to other genotypes in Grenada.
First isolation and genotyping of Toxoplasma gondii from bats (Mammalia: Chiroptera).
Cabral, A D; Gama, A R; Sodré, M M; Savani, E S M M; Galvão-Dias, M A; Jordão, L R; Maeda, M M; Yai, L E O; Gennari, S M; Pena, H F J
2013-03-31
There are currently no reports on the isolation and molecular examination of Toxoplasma gondii from bats. Here, we report the isolation and genotypic characterisation of two T. gondii isolates from bats. A total of 369 bats from different municipalities in São Paulo state, southeastern Brazil, were captured and euthanised, and collected tissues (heart and pectoral muscle) were processed for each bat or in pools of two or three bats and bioassayed in mice (a total of 283 bioassays). Eleven PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism) markers were used to genotype positive samples: SAG1, SAG2 (5'-3'SAG2 and alt. SAG2), SAG3, BTUB, GRA6, L358, c22-8, c29-2, PK1, CS3 and Apico. The parasite was isolated from two bats from São Paulo city: an insectivorous bat, the velvety free-tailed bat Molossus molossus, and a hematophagous bat, the common vampire bat Desmodus rotundus. Isolates were designated TgBatBr1 and TgBatBr2, respectively. The genotype of the isolate from M. molossus (TgBatBr1) has been previously described in an isolate from a capybara from São Paulo state, and the genotype from the D. rotundus isolate (TgBatBr2) has already been identified in isolates from cats, chickens, capybaras, sheep, a rodent and a common rabbit from different Brazilian states, suggesting that this may be a common T. gondii lineage circulating in some Brazilian regions. Isolation of T. gondii from a hematophagous species is striking. This study reveals that bats can share the same isolates that are found in domesticated and wild terrestrial animals. This is the first report of the isolation and genotyping of T. gondii in chiropterans. Copyright © 2012 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Santal, Anita Rani, E-mail: anita.gangotra@gmail.com [Department of Microbiology, Maharshi Dayanand University, Rohtak-124001, Haryana (India); Singh, N.P. [Centre for Biotechnology, Maharshi Dayanand University, Rohtak-124001, Haryana (India); Saharan, Baljeet Singh [Department of Microbiology, Kurukshetra University, Kurukshetra-136119, Haryana (India)
2011-10-15
Highlights: {yields} The Alcaligenes faecalis strain SAG{sub 5} decolorizes 72.6 {+-} 0.56% of melanoidins. {yields} The decolorization was achieved at pH 7.5 and temperature 37 {sup o}C on 5th day. {yields} The distillery effluent after biological treatment is environmentally safe. - Abstract: Distillery effluent retains very dark brown color even after anaerobic treatment due to presence of various water soluble, recalcitrant and coloring compounds mainly melanoidins. In laboratory conditions, melanoidin decolorizing bacteria was isolated and optimized the cultural conditions at various incubation temperatures, pH, carbon sources, nitrogen sources and combined effect of both carbon and nitrogen sources. The optimum decolorization (72.6 {+-} 0.56%) of melanoidins was achieved at pH 7.5 and temperature 37 {sup o}C on 5th day of cultivation. The toxicity evaluation with mung bean (Vigna radiata) revealed that the raw distillery effluent was environmentally highly toxic as compared to biologically treated distillery effluent, which indicated that the effluent after bacterial treatment is environmentally safe. This proves to be novel biological treatment technique for biodegradation and detoxification of melanoidin from distillery effluent using the bacterial strain SAG{sub 5}.
Directory of Open Access Journals (Sweden)
Xiaoyue Gao
2013-11-01
Full Text Available The unconformity surface at the bottom of the Paleogene is one of the most important migration pathways in the Sikeshu Sag of the Junggar Basin, which consists of three layers: upper coarse clastic rock, lower weathering crust and leached zone. The upper coarse clastic rock is characterized by higher density and lower SDT and gamma-ray logging parameters, while the lower weathering crust displays opposite features. The transport coefficient of the unconformity surface is controlled by its position in respect to the basal sandstone; it is higher in the ramp region but lower in the adjacent uplifted and sag areas. The content of saturated hydrocarbons increases with the decrease of the content of non-hydrocarbons and asphaltenes. The content of benzo[c] carbazole decreases as the content of benzo[a] carbazole and [alkyl carbazole]/[alkyl + benzo carbazole] increases. This suggests that the unconformity surface is an efficient medium for the transportation of hydrocarbons.
Energy Technology Data Exchange (ETDEWEB)
Maia, Reinaldo Moreira [Moinhos Vera Cruz, Santa Luzia, MG (Brazil); Silva, Selenio Rocha [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)
2010-10-15
The sensitiveness increasing of industrial equipment related to the perturbation of electric grid, resulting in losses to the productive chain, turns the energy quality in the subject more discussed by the electrical community. In this study case on the problems caused by voltage sags to equipment of an industrial plant from the food sector, it is presented the identification process and the adopted solutions. (author)
Pappoe, Faustina; Cheng, Weisheng; Wang, Lin; Li, Yuanling; Obiri-Yeboah, Dorcas; Nuvor, Samuel Victor; Ambachew, Henock; Hu, Xiaodong; Luo, Qingli; Chu, Deyong; Xu, Yuanhong; Shen, Jilong
2017-06-01
Toxoplasma gondii is of public health and veterinary importance causing severe diseases in immunocompromised individuals including HIV/AIDS patients and in congenital cases and animals. There is limited information on the epidemiology of T. gondii infection in humans, particularly HIV patients and food animals and the parasite genotypes in Ghana. A total of 394 HIV-infected patients from three hospitals were screened for T. gondii anti-IgG and IgM using ELISA. DNAs from blood samples of seropositve participants and 95 brain tissues of food animals were PCR assayed to detect Toxoplasma gra6. DNA positive samples were genotyped using multilocus nested polymerase chain reaction restriction fragment length polymorphism at 10 loci: sag1, alt.sag2, sag3, btub, gra6, l358, c22-8, c29-2, pk1, and apico. The overall seroprevalence was 74.37% (293/394). Toxoplasma DNAs were detected in 3.07% of the seropositive participants and 9.47% of the animals. Six of the human DNA positive samples were partly typed at sag3: 33.33, 50, and 16.67% isolates had type I, II, and III alleles, respectively. All nine isolates from food animals typed at nine loci except apico were atypical: six isolates were identical to ToxoDB #41 and #145, and one was identical to TgCkBrRj2 all identified in Brazil. The genotype of two isolates has not been reported previously and was named as TgCtGh1. T. gondii seroprevalence is high among the HIV-infected individuals with T. gondii circulating in Ghana being genetically diverse.
Sag compensation system for assembly of MDT-chambers for the ATLAS experiment
International Nuclear Information System (INIS)
Barashkov, A.V.; Glonti, G.L.; Gongadze, A.L.; Evtukhovich, P.G.; Il'yushenko, E.N.; Kotov, S.A.; Kruchonok, V.G.; Tskhadadze, Eh.G.; Chepurnov, V.F.; Shelkov, G.A.
2005-01-01
The description of a system of the devices created for compensation of the gravitational deflection of the drift chamber during its assembly is presented. By means of this system during stage-by-stage gluing of layers of tube drift detectors to the chamber the transversal deflection considerably decreases and by that high accuracy of mutual position of separate tubes is provided. The devices were applied at assembly of 74 MDT-chambers of the ATLAS experiment. Design values of deformation of the chambers as well as the results of measurement of transversal deflections obtained during the assembly with the use of the system of sag compensation are given. Testing of chambers on the X-ray tomograph at CERN has shown that the accuracy of the positions of separate signal wires inside the assembled chambers is within the limits of the required 20 μm
Housley, Daniel; Caine, Abby; Cherubini, Giunio; Taeymans, Olivier
2017-07-01
Sagittal T2-weighted sequences (T2-SAG) are the foundation of spinal protocols when screening for the presence of intervertebral disc extrusion. We often utilize sagittal short-tau inversion recovery sequences (STIR-SAG) as an adjunctive screening series, and experience suggests that this combined approach provides superior detection rates. We hypothesized that STIR-SAG would provide higher sensitivity than T2-SAG in the identification and localization of intervertebral disc extrusion. We further hypothesized that the parallel evaluation of paired T2-SAG and STIR-SAG series would provide a higher sensitivity than could be achieved with either independent sagittal series when viewed in isolation. This retrospective diagnostic accuracy study blindly reviewed T2-SAG and STIR-SAG sequences from dogs (n = 110) with surgically confirmed intervertebral disc extrusion. A consensus between two radiologists found no significant difference in sensitivity between T2-SAG and STIR-SAG during the identification of intervertebral disc extrusion (T2-SAG: 92.7%, STIR-SAG: 94.5%, P = 0.752). Nevertheless, STIR-SAG accurately identified intervertebral disc extrusion in 66.7% of cases where the evaluation of T2-SAG in isolation had provided a false negative diagnosis. Additionally, one radiologist found that the parallel evaluation of paired T2-SAG and STIR-SAG series provided a significantly higher sensitivity than T2-SAG in isolation, during the identification of intervertebral disc extrusion (T2-SAG: 78.2%, paired T2-SAG, and STIR-SAG: 90.9%, P = 0.017). A similar nonsignificant trend was observed when the consensus of both radiologists was taken into consideration (T2-SAG: 92.7%, paired T2-SAG, and STIR-SAG = 97.3%, P = 0.392). We therefore conclude that STIR-SAG is capable of identifying intervertebral disc extrusion that is inconspicuous in T2-SAG, and that STIR-SAG should be considered a useful adjunctive sequence during preliminary sagittal screening for intervertebral disc
Drapała, Dorota; Holec-Gąsior, Lucyna; Kur, Józef; Ferra, Bartłomiej; Hiszczyńska-Sawicka, Elżbieta; Lautenbach, Dariusz
2014-07-01
The preliminary diagnostic utility of two mixtures of Toxoplasma gondii recombinant antigens (rROP1+rSAG2 and rROP1+rGRA6) in IgG ELISA and IgG avidity test has been evaluated. A total of 173 serum samples from patients with toxoplasmosis and seronegative people were examined. The sensitivity of IgG ELISA for rROP1+rSAG2 and rROP1+rGRA6 was 91.1% and 76.7%, respectively, while the reactivity for sera from patients where acute toxoplasmosis was suspected was higher, at 100% and 95.4%, respectively, than for people with chronic infection, at 88.2% and 70.6%. In this study a different trend in avidity maturation of IgG antibodies for two mixtures of proteins in comparison with native antigen was observed. The results suggest that a new IgG avidity test using the mixtures of recombinant antigens may be useful for the diagnosis of difficult-to-identify phases of toxoplasmosis. For this reason, selected mixtures after the additional tests on groups of sera with well-defined dates of infection could be used as a better alternative to the native antigens of the parasite in the serodiagnosis of human T. gondii infection. Copyright © 2014 Elsevier Inc. All rights reserved.
Genetic diversity of Toxoplasma gondii isolates in Egyptian feral cats reveals new genotypes.
Al-Kappany, Y M; Rajendran, C; Abu-Elwafa, S A; Hilali, M; Su, C; Dubey, J P
2010-12-01
Cats are important in the epidemiology of Toxoplasma gondii because they are the only hosts that excrete environmentally resistant oocysts in feces. In the present study, 115 viable T. gondii isolates from tissues of cats from Egypt were genotyped using 10 PCR-restriction fragment length polymorphism markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico) and DNA from tachyzoites. Seven genotypes were recognized including the clonal Type II, Type III (2 genotypes), and 4 atypical genotypes. Ninety percent (103 of 115) of isolates were clonal, i.e., Type II (n = 61) and Type III (n = 42) strains. Of the 61 Type II strains, all had the Type II alleles at all loci, except for 2 strains that had allele I at Apico. Eight isolates were divided into 4 atypical genotypes. One of these genotypes (with 4 isolates) was previously reported in dogs from Sri Lanka and in sand cats from the United Arab Emirates. Four isolates had mixed infections. These results revealed a strong clonal population structure with the dominance of clonal Type II and III lineages of T. gondii in feral cats from Egypt.
DEFF Research Database (Denmark)
Zhao, Xin; Meng, Lexuan; Dragicevic, Tomislav
2015-01-01
it can make the MG a contributor in smooth ride through the faults. In this paper, a reactive power support strategy using droop controlled converters is proposed to aid MG riding through three phase symmetrical voltage sags. In such a case, the MGs should inject reactive power to the grid to boost...... the voltage in all phases at AC common bus. However, since the line admittances from each converter to point of common coupling (PCC) are not identical, the injected reactive power may not be equally shared. In order to achieve low voltage ride through (LVRT) capability along with a good power sharing...
Potential need for re-definition of the highest priority recovery action in the Krsko SAG-1
International Nuclear Information System (INIS)
Bilic Zabric, T.; Basic, I.
2005-01-01
Replacement of old SG (Steam Generators) [7] and the characteristic of new ones throws the question of proper accident management strategy, which leans on philosophy that repair and recovery actions have first priority. In the current NPP Krsko SAMGs (Severe Accident Management Guidelines), water supply to the SG has priority over re-injection water into the core. NPP Krsko reconsidered the highest priority of SAG-1 (inject water to the SG), against the WOG (Westinghouse Owners Group) generic approach (inject water into the core) and potential revision of Severe Accident Phenomenology Evaluations using MAAP (Modular accident Analysis Program) 4.0.5 code. (author)
International Nuclear Information System (INIS)
Gutierrez, Juan David; Riss Wolfgang; Ospina Rodolfo
2002-01-01
An application of the Sagging-type fuzzy logic to calculate biological water quality in Bogota, Colombia is presented 28 sites corresponding to 9 watersheds in the Bogota area were used. The organisms selected were: Leptoceridae and Hidrobiosidae as indicators of clean waters, Planariidae and Amphipoda as indicators of polluted waters and Psychodida and Syrphidae as indicators of highly polluted waters Chironomids were also included. In order to prove the degree of reliability of Sugeno-type fuzzy logic, the results obtained were compared with values for the Cfq index, and a highly significant correlation was obtained
Mitigation of voltage sag, swell and power factor correction using solid-state transformer b
Directory of Open Access Journals (Sweden)
M.R. Banaei
2014-09-01
Full Text Available This paper presents a novel topology of solid-state transformer (SST. In the design process, the AC/DC, DC/AC and AC/AC converters have been integrated to achieve higher efficiency. To obtain higher efficiency from other SST with DC-link topologies, the AC/DC and DC/AC converters have been integrated in one matrix converter. The proposed SST performs typical functions and has advantages such as power factor correction, voltage sag and swell elimination, voltage flicker reduction and protection capability in fault situations. In addition, it has other benefits such as light weight, low volume and elimination of hazardous liquid dielectrics because it uses medium frequency transformer. The operation and some performances of the proposed SST have been verified by the simulation results.
Dubey, J P; Moura, L; Majumdar, D; Sundar, N; Velmurugan, G V; Kwok, O C H; Kelly, P; Krecek, R C; Su, C
2009-05-01
Cats are essential in the epidemiology of Toxoplasma gondii because they are the only hosts that can excrete the environmentally resistant oocysts in nature. Samples of serum, feces, and tissues from feral cats from St Kitts, West Indies were examined for T. gondii infection. Antibodies to T. gondii were assayed by the modified agglutination test, and found in 71 of 96 (73.9%) of cats with titres of 1:10 in six, 1: 20 in six,1:40 in seven,1: 80 in three, 1: 160 in 10, 1:320 in 13, 1:640 in nine, and 1:1,280 or higher in 17. Tissues of 10 cats were bio-assayed in mice. Toxoplasma gondii was isolated from tissues of 7 cats; from hearts of 6, from tongue of 5, and brains of 3 cats. All 7 isolates were avirulent for mice. Toxoplasma gondii oocysts were not found in the feces of 51 cats. Genotyping of these 7 T. gondii isolates by 10 multi-locus PCR-RFLP markers, including SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and an apicoplast marker, Apico, revealed 4 genotypes, including clonal Type II, Type III and 2 unique genotypes. Five of the 7 cats had infection with 2 genotypes, indicating high frequency of mixed infection in the cat population on the St Kitts island.
Dubey, J P; Brown, J; Verma, S K; Cerqueira-Cézar, C K; Banfield, J; Kwok, O C H; Ying, Y; Murata, F H A; Pradhan, A K; Su, C
2017-08-30
Toxoplasmosis is a worldwide zoonosis. The ingestion of uncooked/undercooked meat and consumption of water contaminated with Toxoplasma gondii oocysts excreted by felids are the main modes of transmission of this parasite. T. gondii has been reported in multiple cervid species; however, little is known of the parasite in North American elk (Cervus canadensis). In the present study, antibodies to T. gondii were detected in serum of wild elk from Pennsylvania collected during 2013-2016 by the modified agglutination test (MAT, cut-off 1:25); 221 of 317 (69.7%) had MAT titers of 1:25 in 19, 1:50 in 28, 1:100 in 34, and 1:200 or higher in 140. Thus most (44.1%) elk had relatively high titers. Seroprevalence was slightly higher in males (76.9%) than females (67.5%, not statistically significant, Chi-square tests, P<0.0001) and was higher in adults (76.5%) than yearlings (46.4%, Odds ratio 3.82; 95% CL 1.72-8.47; P=0.001) or calves (21.7%, Odds ratio 12.58; 95% CL 4.51-35.10; P<0.0001). Annual seroprevalence was relatively stable throughout the period tested and ranged from 66.6% to 72.2%. Of the 101 elk harvested in 2016, hearts were bioassayed from 20 elk and tongues were bioassayed from 56; all tongue samples were negative. Viable T. gondii was isolated from hearts of two female elk, one of these was a seronegative adult and the other was a calf with no serum available for testing. Both T. gondii isolates were cultivated in cell culture and DNA derived from tachyzoites was characterized using the PCR-RFLP markers including SAG1, SAG2 (5'- 3'SAG2 and altSAG2), SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico. One isolate belongs to ToxoDB PCR-RFLP genotype #2 and the other is genotype #5. Both genotypes are frequently identified in animals in North America. Copyright © 2017. Published by Elsevier B.V.
Genetic diversity of Toxoplasma gondii isolates from Ethiopian feral cats.
Dubey, J P; Choudhary, S; Tilahun, G; Tiao, N; Gebreyes, W A; Zou, X; Su, C
2013-09-01
Recent studies indicate greater genetic variability among isolates of Toxoplasma gondii worldwide than previously thought. However, there is no information on genetic diversity of T. gondii from any host in Ethiopia. In the present study, genotyping was performed on viable T. gondii isolates by bioassays in mice from tissues and feces of 27 cats from Ethiopia. Viable T. gondii was isolated from hearts of 26 cats, feces alone of 1 cat, and feces and tissues of 6 cats; in total there were 33 isolates. Genotyping was performed on DNA from cell-cultured derived T. gondii tachyzoites and by using 10 PCR-restriction fragment length polymorphism markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico). Four genotypes were recognized, including ToxoDB #1 (Type II clonal, nine isolates), ToxoDB #2 (Type III, five isolates), Toxo DB #3 (Type II variant, ten isolates), and ToxoDB #20 (nine isolates). Of interest is the isolation of different genotypes from tissues and feces of two cats, suggesting re-infection or mixed strain T. gondii infection. These findings are of epidemiological significance with respect to shedding of oocysts by cats. This is the first report of genotyping of T. gondii from any host in Ethiopia. Published by Elsevier B.V.
Vieira, Fernando Emmanuel Gonçalves; Sasse, João Pedro; Minutti, Ana Flávia; Miura, Ana Carolina; de Barros, Luiz Daniel; Cardim, Sergio Tosi; Martins, Thais Agostinho; de Seixas, Mércia; Yamamura, Milton Issashi; Su, Chunlei; Garcia, João Luis
2018-03-01
Toxoplasma gondii is an intracellular parasite that can infect all warm-blooded animals including humans. Recent studies showed that T. gondii strains from South America are genetically diverse. The present work aimed to determine T. gondii prevalence in free-ranging chicken in northwest Parana state in Brazil by two serological tests, to isolate the parasites from seropositive chickens and to genotype the isolates. Antibodies to T. gondii in 386 serum samples from 24 farms were investigated by immunofluorescence antibody assay (IFA) and modified agglutination test (MAT). Samples having titers ≥ 16 were considered positive for both tests. Among the 386 serum samples, 102 (26.4%) were positive for IFA, 64 (16.6%) were positive for MAT, 47 (12.2%) were positive in both tests, and 119 (30.8%) were positive in at least one of the two tests. Brain and pool of heart, lung, and liver from the 119 seropositive chickens were used for mouse bioassay to isolate the parasites. Thirty eight (31.9%) of these seropositive chickens were considered positives in mouse bioassay and 18 isolates were obtained. The isolates were characterized by 10 PCR-RFLP genetic markers including SAG1, SAG2 (5'-3'SAG2, alt.SAG2), SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico. Results of genotyping were compared with the genotypes in ToxoDB database. It revealed ten genotypes, including ToxoDB PCR-RFLP genotypes #6 (n = 2), #19 (n = 1), #21 (n = 2), #111 (n = 2), #152 (n = 1), and #175 (n = 1) and four new types not described before. Our results confirmed a high genetic diversity of this parasite in southern Brazil and also showed that the use of two serological tests in combination can improve the chance of T. gondii isolation. More studies should be taken to determine the zoonotic potential of chickens in the transmission of T. gondii.
DEFF Research Database (Denmark)
Pietkiewicz, H; Hiszczyńska-Sawicka, E; Kur, J
2007-01-01
The precise diagnosis of an acute and recent Toxoplasma infection in pregnant women and the newborn child is important before treatment. This study describes a new Toxoplasma gondii IgG avidity test based on a combination of recombinant GRA1, GRA7 and SAG1 antigens and shows that this test is use...
The role of fluid migration system in hydrocarbon accumulation in Maichen Sag, Beibuwan Basin
Liu, Hongyu; Yang, Jinxiu; Wu, Feng; Chen, Wei; Liu, Qianqian
2018-02-01
Fluid migration system is of great significance for hydrocarbon accumulation, including the primary migration and secondary migration. In this paper, the fluid migration system is analysed in Maichen Sag using seismic, well logging and core data. Results show that many factors control the hydrocarbon migration process, including hydrocarbon generation and expulsion period from source rocks, microfractures developed in the source rocks, the connected permeable sand bodies, the vertical faults cutting into/through the source rocks and related fault activity period. The spatial and temporal combination of these factors formed an effective network for hydrocarbon expulsion and accumulation, leading to the hydrocarbon reservoir distribution at present. Generally, a better understanding of the hydrocarbon migration system can explain the present status of hydrocarbon distribution, and help select future target zones for oil and gas exploration.
Voltage sag influence on fatigue life of the drivetrain of fixed speed wind turbines
DEFF Research Database (Denmark)
Veluri, Badrinath; Santos-Martin, David; Jensen, Henrik Myhre
2011-01-01
Occurrence of voltage sags due to electrical grid faults and other network disturbances generate transients of the generator electromagnetic torque which result in significant high stresses and noticeable vibrations for the wind turbine mechanical system and may also have a detrimental effect...... on the fatigue life of important drivetrain components. The high penetration of wind energy in the electrical grids demands new requirements for the operation of wind energy conversion systems. Although fixed speed wind turbine technology is nowadays replaced by variable speed wind turbines. In some countries...... by the stator flux oscillations which cause high transients of the generator electromagnetic torque. This paper focuses in estimating the resulting significant stresses transients due to the electromagnetic torque transients, which transmits to the wind turbine mechanical system that may have a detrimental...
Precipitation formation in recrystallized nickel-plated non-sag tungsten wire
International Nuclear Information System (INIS)
Lai, Z.H.
1994-01-01
It is well established that some metals, such as palladium and nickel, can easily penetrate into tungsten by fast diffusion via crystal defects such as grain boundaries and dislocations. As a result of the fast penetration of these so called activators the recrystallization temperature of heavily drawn non-sag tungsten wire can be lower from about 2,000 C to about 1,000 C, thus the application of the tungsten wire, serving as reinforcement material in metal matrix composites used at high temperatures, is limited. An interesting question is in which form these activators exist in the recrystallized tungsten wire. It is generally believed that W-Ni intermediate compounds could form in the recrystallized material, presumably at grain boundaries. The free energy difference between the pure tungsten fibbers and the precipitating W(Ni) solid solution was suggested as the chemical driving force which governed the recrystallization process. The presence of nickel in small particles had also been observed in recrystallized grains of nickel plated tungsten wires using scanning electron microscopy (SEM) and secondary ion mass spectroscopy. These particles were considered to be nickel rich precipitates. However, a detailed investigation of the precipitation process has not been reported. In the present work an investigation of the structure, composition and distribution of nickel rich particles precipitated in recrystallized grains of nickel plated heavily drawn non-sage tungsten wires was carried out using analytical electron microscopy (AEM)
Lopes, C S; Franco, P S; Silva, N M; Silva, D A O; Ferro, E A V; Pena, H F J; Soares, R M; Gennari, S M; Mineo, J R
2016-07-01
The aim of this study was to determine the seroprevalence of Toxoplasma gondii infection in free-range chickens from Uberlândia, Minas Gerais state, Brazil, and characterize the genotypic and phenotypic features of two isolates of this parasite, considering the importance of these hosts in the epidemiology of toxoplasmosis. Serum samples from 108 free-range chickens were obtained from ten different districts, and submitted to the modified agglutination test (MAT) for the presence of anti-T. gondii antibodies, and brain and heart tissue samples from infected chickens were processed for mouse bioassay. An overall seroprevalence of 71·3% was found and antibody titres ranged from 16 to 4096. After confirmation of seropositivity by mouse bioassay, the determination of the T. gondii genotypes of two isolates was performed by PCR-RFLP, using primers for the following markers: SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, new SAG2, Apico and CS3. These T. gondii isolates, designated TgChBrUD1and TgChBrUD2, were obtained from heart samples of free-range chickens. The TgChBrUD1 isolate belonged to ToxoDB PCR-RFLP genotype 11 and the TgChBrUD2 isolate belonged to ToxoDB PCR-RFLP genotype 6. Both isolates demonstrated high virulence in a rodent model, with the TgChBrUD1 isolate able to induce brain cysts, in accord with its pattern of multiplication rates in human fibroblast culture. Taken together, these results reveal high prevalence of T. gondii infection in free-range chickens throughout Uberlândia, indicating an important degree of oocyst environmental contamination and the existence of considerable risk for T. gondii transmission to humans by consumption of free-range chicken as a food source.
Yu, Haijie; Huang, Bin; Zhuo, Xunhui; Chen, Xueqiu; Du, Aifang
2013-11-08
Real-time PCR-based detection of Toxoplasma gondii is very sensitive and convenient for diagnosing toxoplasmosis. However, the performance of the PCR assays could be influenced by the target gene chosen. Here we evaluate a real-time PCR assay using double-stranded DNA dyes (SYBR(®) Green I assay) with a new set of primers targeting the SAG1 gene for the fast and specific detection of T. gondii. The assay showed higher sensitivity than conventional PCR protocols using T. gondii DNA as template. The detection limit of the developed real-time PCR assay was in the order of 1 tachyzoite. The assay was also assessed by experimentally infected mice and showed positive results for blood (25%), spleen (50%) and lung (50%) as early as 1 dpi. The specificity of the assay was confirmed by using DNA from Neospora caninum, Escherichia coli, Babesia bovis, Trypanosoma brucei, Cryptosporidium parvum, and Toxocara canis. Assay applicability was successfully tested in blood samples collected from slaughtered pigs. These results indicate that, based on SYBR(®) green I, the quantitative SAG1 assay may also be useful in the study of the pathogenicity, immunoprophylaxis, and treatment of T. gondii. Copyright © 2013 Elsevier B.V. All rights reserved.
Kreikemeyer, Bernd; Nakata, Masanobu; Köller, Thomas; Hildisch, Hendrikje; Kourakos, Vassilios; Standar, Kerstin; Kawabata, Shigetada; Glocker, Michael O; Podbielski, Andreas
2007-12-01
Many Streptococcus pyogenes (group A streptococcus [GAS]) virulence factor- and transcriptional regulator-encoding genes cluster together in discrete genomic regions. Nra is a central regulator of the FCT region. Previous studies exclusively described Nra as a transcriptional repressor of adhesin and toxin genes. Here transcriptome and proteome analysis of a serotype M49 GAS strain and an isogenic Nra mutant of this strain revealed the complete Nra regulon profile. Nra is active in all growth phases tested, with the largest regulon in the transition phase. Almost exclusively, virulence factor-encoding genes are repressed by Nra; these genes include the GAS pilus operon, the capsule synthesis operon, the cytolysin-mediated translocation system genes, all Mga region core virulence genes, and genes encoding other regulators, like the Ihk/Irr system, Rgg, and two additional RofA-like protein family regulators. Surprisingly, our experiments revealed that Nra additionally acts as a positive regulator, mostly for genes encoding proteins and enzymes with metabolic functions. Epidemiological investigations revealed strong genetic linkage of one particular Nra-repressed regulator, Ralp3 (SPy0735), with a gene encoding Epf (extracellular protein factor from Streptococcus suis). In a serotype-specific fashion, this ralp3 epf gene block is integrated, most likely via transposition, into the eno sagA virulence gene block, which is present in all GAS serotypes. In GAS serotypes M1, M4, M12, M28, and M49 this novel discrete genetic region is therefore designated the eno ralp3 epf sagA (ERES) pathogenicity region. Functional experiments showed that Epf is a novel GAS plasminogen-binding protein and revealed that Ralp3 activity counteracts Nra and MsmR regulatory activity. In addition to the Mga and FCT regions, the ERES region is the third discrete chromosomal pathogenicity region. All of these regions are transcriptionally linked, adding another level of complexity to the known
Basu, Malabika; Das, S. P.; Dubey, Gopal
2008-01-01
The unified power quality conditioner (UPQC) is one of the major custom power solutions, which is capable of mitigating the effect of supply voltage sag at the load end or at the point of common coupling (PCC) in a distributed network. It also prevents the propagation of the load current harmonics to the utility and improves the input power factor of the load. The control of series compensator (SERC) of the UPQC is such that it injects voltage in quadrature advance to the supply current. Thus...
Directory of Open Access Journals (Sweden)
Sérgio Neto Vitaliano
2015-06-01
Full Text Available INTRODUCTION: Toxoplasma gondii infection is widely prevalent in humans and other animals worldwide. Information on the prevalence of T. gondii infection is scarce in some regions of Brazil, including riverside communities along the Amazon River basin. M METHODS: The prevalence of T. gondii in 231 people, aged 1-85 years, who were living in four riverside communities along the Purus River, Lábrea, State of Amazonas, Brazil, was determined. Antibodies against T. gondii were assayed using a commercial enzyme-linked immunosorbent assay (ELISA kit. The hearts and brains of 50 chickens, which were raised free-range in the communities, were pooled according to the community of origin and bioassayed in mice. The isolates were genotyped using polymorphisms at 12 nuclear markers (SAG1, 5' and 3'-SAG2, alt.SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, Apico and CS3. RESULTS: The overall seroprevalence of T. gondii was 56.7% (131/231. IgG antibodies were presented by 117 (89.3% and IgM by 14 (10.7% of the 131 positive individuals. No association between age group and gender with prevalence was observed (chi-square test, p > 0.05; however, the comparison between localities showed that the seroprevalence of T. gondii was significantly lower among the individuals living in the Boca do Ituxi (p < 0.05 community. Five isolates of T. gondii were obtained in the mouse bioassay, and genotyping revealed two complete genotypes that had not been described previously and three mixed isolates. CONCLUSIONS: These results support previous findings that T. gondii population genetics are highly diverse in Brazil and that T. gondii infection is active in these riverside communities.
Current source converter based D-STATCOM for voltage sag mitigation
Directory of Open Access Journals (Sweden)
Singh Moirangthem Deben
2015-01-01
Full Text Available This paper presents a novel method of realizing one of the custom power controllers, the distribution static synchronous compensator (D-STATCOM using current source converter (CSC topology. Almost all the custom power controllers such as dynamic voltage restorer (DVR, unified power quality conditioner (UPQC including D-STATCOM are generally designed and implemented by using voltage source converters (VSC and not much research publications with CSC based approach has been reported over the last one decade. Since the D-STATCOM is a current injection device, its performance can be improved when realized by a current-source converter which can generate a controllable current directly at its output terminals and offers many advantageous features. In this paper, an attempt has been made to study the performance of a CSC based D-STATCOM suitable for use in the power distribution system in order to mitigate voltage sag and improve power quality. The proposed model uses a three leg CSC whose switching strategy is based on sinusoidal pulse width modulation (SPWM. The model has been simulated in the Matlab/Simulink environment. The results of the simulation runs under steady state and dynamic load perturbation provide excellent voltage and current waveforms that support the justification of the proposed model.
Dubey, J P; Newell, T K; Verma, S K; Calero-Bernal, R; Stevens, E L
2014-06-01
Clinical toxoplasmosis has been reported in many species of warm-blooded animals but is rare in camelids. Here we report acute fatal systemic toxoplasmosis involving heart, thyroid gland, stomach, intestine, diaphragm, kidneys, adrenal glands, and liver of a 13-mo-old llama (Llama glama). Many Toxoplasma gondii tachyzoites were associated with tissue necrosis in multiple organs. Death was attributed to severe myocarditis. Ulcers associated with numerous tachyzoites were present in the C3 compartment of the stomach. Tissue cyst development was followed using bradyzoite-specific T. gondii antibodies. Individual intracellular, and groups of 2 or more, bradyzoites were identified in hepatocytes, biliary epithelium, myocardiocytes, lung, diaphragm, thyroid gland, spleen, and stomach. Lesions in the brain were a few microglial nodules and very early tissue cysts containing 1-3 bradyzoites. These observations suggest that the animal had acquired toxoplasmosis recently. Diagnosis was confirmed immunohistochemically by reaction with T. gondii -specific polyclonal rabbit serum but not with antibodies to the related protozoan Neospora caninum . Genetic typing using the DNA extracted from paraffin-embedded myocardium of llama and 10 PCR-restriction fragment length polymorphism (RFLP) markers revealed a type II allele at the SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, PK1 L358, and Apico loci; therefore, this isolate belongs to the ToxoDB PCR-RFLP genotype #1, which is most common in North America and Europe.
Kreikemeyer, Bernd; Nakata, Masanobu; Köller, Thomas; Hildisch, Hendrikje; Kourakos, Vassilios; Standar, Kerstin; Kawabata, Shigetada; Glocker, Michael O.; Podbielski, Andreas
2007-01-01
Many Streptococcus pyogenes (group A streptococcus [GAS]) virulence factor- and transcriptional regulator-encoding genes cluster together in discrete genomic regions. Nra is a central regulator of the FCT region. Previous studies exclusively described Nra as a transcriptional repressor of adhesin and toxin genes. Here transcriptome and proteome analysis of a serotype M49 GAS strain and an isogenic Nra mutant of this strain revealed the complete Nra regulon profile. Nra is active in all growth phases tested, with the largest regulon in the transition phase. Almost exclusively, virulence factor-encoding genes are repressed by Nra; these genes include the GAS pilus operon, the capsule synthesis operon, the cytolysin-mediated translocation system genes, all Mga region core virulence genes, and genes encoding other regulators, like the Ihk/Irr system, Rgg, and two additional RofA-like protein family regulators. Surprisingly, our experiments revealed that Nra additionally acts as a positive regulator, mostly for genes encoding proteins and enzymes with metabolic functions. Epidemiological investigations revealed strong genetic linkage of one particular Nra-repressed regulator, Ralp3 (SPy0735), with a gene encoding Epf (extracellular protein factor from Streptococcus suis). In a serotype-specific fashion, this ralp3 epf gene block is integrated, most likely via transposition, into the eno sagA virulence gene block, which is present in all GAS serotypes. In GAS serotypes M1, M4, M12, M28, and M49 this novel discrete genetic region is therefore designated the eno ralp3 epf sagA (ERES) pathogenicity region. Functional experiments showed that Epf is a novel GAS plasminogen-binding protein and revealed that Ralp3 activity counteracts Nra and MsmR regulatory activity. In addition to the Mga and FCT regions, the ERES region is the third discrete chromosomal pathogenicity region. All of these regions are transcriptionally linked, adding another level of complexity to the known
Design of a MEMS Capacitive Comb-drive Micro-accelerometer with Sag Optimization
Directory of Open Access Journals (Sweden)
B. D. PANT
2009-10-01
Full Text Available The current paper presents an optimization study for the designing of a highly sensitive inertial grade capacitive accelerometer based on comb-drive actuation and sensing. The proof mass, suspension system (beams or tethers, stators and rotors have to be realized through an HAR (high aspect ratio DRIE (deep reactive ion etching process for which process optimization has already been done at our laboratory. As the proof mass is a bulk micro-machined structure having a mass in milligram range, the optimum positioning of the tethers on the proof mass is important to have minimum sag, necessary to reduce the off-axis sensitivity. The optimization for the positioning of the tethers has been carried out using a commercial software tool ANSYSTM Multiphysics. The accelerometer has been modeled analytically to predict its characteristics. The dependency of sensitivity on the dimensions of the suspension beams (tethers has also been verified using the above FEM software tool. The present device has been designed to deliver a high sensitivity of 13.6 mV/g/V for low-g applications.
Directory of Open Access Journals (Sweden)
M.G Macri
2012-04-01
Full Text Available Este documento presenta los resultados del estudio realizado de la descomposición wavelet multinivel 1D de las señales perturbadas del par electromagnético y de la velocidad del eje del motor trifásico de inducción, cuando este es sometido a diferentes tipologías de huecos de tensión según la caracterización ABC, Bollen (2000. Los huecos de tensión trifásicos (3 variables son analizados indirectamente en el efecto producido en una variable perturbada (el par electromagnético o la velocidad del eje que contiene indirectamente información del tipo de hueco de tensión trifásico producido en el estator. El estudio analiza el efecto de los siete diferentes tipos de huecos de tensión, considerando también la influencia de la duración y tensión retenida. Para cada caso se obtiene un vector cuyos elementos son los niveles de energía wavelet en los distintos niveles de descomposición de la variable analizada, mostrando que la forma en que se distribuye la energía de la señal 1D en los distintos niveles de descomposición establece una firma única para cada caso. Esta forma de descripción de los huecos de tensión producidos en el estator, basada en la descomposición multinivel de una variable perturbada, reduce la cantidad de variables a analizar y permite posteriormente la clasificación de las perturbaciones empleando técnicas de inteligencia artificial; es ventajosa pues el almacenamiento de los vectores de niveles de energía de aproximación en las bases de datos emplea menor cantidad de espacio que la necesaria para una señal temporal, y empleando una DWT reversible es posible, además, reconstruir la variable de estado temporal.This document presents the study results of the wavelet 1D multi-level decomposition of perturbed electromagnetic torque and shaft speed signals, of the three-phase induction motor, when it is subjected to different types of voltage sags, as characterization ABC, Bollen (2000. The three
Extension of the Accurate Voltage-Sag Fault Location Method in Electrical Power Distribution Systems
Directory of Open Access Journals (Sweden)
Youssef Menchafou
2016-03-01
Full Text Available Accurate Fault location in an Electric Power Distribution System (EPDS is important in maintaining system reliability. Several methods have been proposed in the past. However, the performances of these methods either show to be inefficient or are a function of the fault type (Fault Classification, because they require the use of an appropriate algorithm for each fault type. In contrast to traditional approaches, an accurate impedance-based Fault Location (FL method is presented in this paper. It is based on the voltage-sag calculation between two measurement points chosen carefully from the available strategic measurement points of the line, network topology and current measurements at substation. The effectiveness and the accuracy of the proposed technique are demonstrated for different fault types using a radial power flow system. The test results are achieved from the numerical simulation using the data of a distribution line recognized in the literature.
Prevalence and genetic characterization of Toxoplasma gondii in donkeys in northeastern China.
Zhang, Xiao-Xuan; Shi, Wei; Zhang, Nian-Zhang; Shi, Kun; Li, Jian-Ming; Xu, Peng; Zhao, Quan; Du, Rui
2017-10-01
Toxolasma gondii is one of the most important obligate intracellular protozoan parasites. Recently, toxoplasmosis is of increasing concerns because T. gondii not only has a worldwide distribution but also can infect virtually all warm-blooded hosts including donkeys. However, limited information is available concerning the genetic characterization of T. gondii in donkeys in northeastern China. In this study, a total of 302 brain tissue samples collected from donkeys from Jilin (n=108) and Liaoning (n=194) provinces, northeastern China, were examined for T. gondii infection by semi-nested PCR of B1 gene. The positive samples were genotyped at 11 loci (i.e., SAG1, alternative SAG2, 5'-and 3'-SAG2, SAG3, L358, BTUB, c22-8, GRA6, c29-2, PK1 and Apico) using polymerase chain reaction-restriction fragment length polymorphism technology. Of 302 brain tissue samples, 19 (6.29%) were PCR-positive for T. gondii. The prevalence rates of T. gondii were 6.48% (7/108) and 6.19% (12/194) in Jilin Province and Liaoning Province, respectively. The prevalence of T. gondii in different season groups varied from 5.56% to 7.41%. The prevalence of T. gondii in "Cage-free" donkeys was higher than that in "Captive" donkeys. Of the 19 positive samples, only two isolates were successfully genotyped at all loci, three were genotyped at 9 loci. In total, four samples belong to ToxoDB genotype #9, one belong to ToxoDB genotype #10. This is firstly characterized the T. gondii isolates from donkeys in northeastern China. The results of the present study will improve the information of the distribution of T. gondii genotypes in China. Copyright © 2017. Published by Elsevier B.V.
Mirzadeh, Abolfazl; Saadatnia, Geita; Golkar, Majid; Babaie, Jalal; Noordin, Rahmah
2017-05-01
SAG1-related sequence 3 (SRS3) is one of the major Toxoplasma gondii tachyzoite surface antigens and has been shown to be potentially useful for the detection of toxoplasmosis. This protein is highly conformational due to the presence of six disulfide bonds. To achieve solubility and antigenicity, SRS3 depends on proper disulfide bond formation. The aim of this study was to over-express the SRS3 protein with correct folding for use in serodiagnosis of the disease. To achieve this, a truncated SRS3 fusion protein (rtSRS3) was produced, containing six histidyl residues at both terminals and purified by immobilized metal affinity chromatography. The refolding process was performed through three methods, namely dialysis in the presence of chemical additives along with reduced/oxidized glutathione and drop-wise dilution methods with reduced/oxidized glutathione or reduced DTT/oxidized glutathione. Ellman's assay and ELISA showed that the protein folding obtained by the dialysis method was the most favorable, probably due to the correct folding. Subsequently, serum samples from individuals with chronic infection (n = 76), probable acute infection (n = 14), and healthy controls (n = 81) were used to determine the usefulness of the refolded rtSRS3 for Toxoplasma serodiagnosis. The results of the developed IgG-ELISA showed a diagnostic specificity of 91% and a sensitivity of 82.89% and 100% for chronic and acute serum samples, respectively. In conclusion, correctly folded rtSRS3 has the potential to be used as a soluble antigen for the detection of human toxoplasmosis. Copyright © 2017 Elsevier Inc. All rights reserved.
A Force Method Model for Dynamic Analysis of Flat-Sag Cable Structures
Directory of Open Access Journals (Sweden)
Xing Ma
2009-01-01
Full Text Available A new force method is proposed for analysing the dynamic behaviour of oscillating cables with small sags. The accepted dynamic model of such cables reduces to a partial differential equation (the equation of motion and an integral equation (the compatibility equation. In the paper, D’Alembert’s travelling wave solution is applied to the partial differential equation (PDE. Substituting the solution into the compatibility and boundary conditions, the governing equation is obtained in terms of the dynamic tension increment. This equation has been named the force method dynamic equation (FMDE. In this way the infinite-degree-of-freedom dynamic system is effectively simplified to a system with only one unknown. Explicit solutions for both single-span and multi-span cable systems are derived. The natural frequencies obtained from the FMDE are shown to be identical to those deduced using the conventional displacement method (DM. Nonlinear governing equations are developed by considering the effect of quadratic and cubic displacement terms. Finally, two examples are presented to illustrate the accuracy of the proposed force method for single and multi-span cable systems subjected to harmonic forces.
Directory of Open Access Journals (Sweden)
Juan Patiño-Martinez
2010-09-01
Full Text Available La emergencia de las crías de tortuga laúd eclosionadas en los nidos profundos desde la arena hasta la superficie de la playa ocurre sin ayuda parental y es el primer gran desafío de supervivencia en su ciclo de vida. Este estudio, desarrollado en la costa Caribe colombiana, describe el comportamiento social de emergencia de neonatos y evalúa el efecto de la traslocación de los nidos en los patrones temporales de emergencia. Se propone por primera vez que el espacio liberado por la deshidratación de falsos huevos (SAGs en la nidada, representa una ventaja reproductiva al facilitar el agrupamiento de los neonatos en un espacio muy limitado y favorecer la sincronía de la emergencia. El tiempo medio registrado para la emergencia en grupo fue de 3.3 días, variando entre uno y seis días. La traslocación de los nidos no afectó el patrón temporal de emergencia que fue predominantemente nocturno (77.77% en nidos naturales y 81.65% en trasladados. Los picos máximos de emergencias a la superficie coincidieron con los periodos de menor temperatura ambiental exterior (22:00h-06:00h. La ventaja selectiva de este patrón temporal y de la emergencia sincrónica está probablemente relacionada con las mayores tasas de depredación y mortalidad por hipertermia observadas durante el día.False eggs (SAGs facilitate social post-hatching emergence behaviour in Leatherback turtles Dermochelys coriacea (Testudines: Dermochelyidae nests. Hatchling emergence to the beach surface from deep sand nests occurs without parental care. Social behaviour among siblings is crucial to overcome this first challenge in sea turtles life. This study, carried out at the Caribbean coast of Colombia, describes the emergence social behaviour of hatchlings from eight nests, and assess the nests translocation effects on temporal patterns of emergence. For the first time, we propose that space released by dehydration of shelled albumen globes (SAGs at the top of the clutch
Isolation and Genotyping of Toxoplasma gondii in Brazilian Dogs.
da Silva, Jamille Rodrigues; Maciel, Bianca Mendes; de Santana Souza Santos, Luana Karla Nogueira; Carvalho, Fábio Santos; de Santana Rocha, Daniele; Lopes, Carlos Wilson Gomes; Albuquerque, George Rêgo
2017-06-01
Strains of Toxoplasma gondii in Brazil are highly genetically diverse compared to strains from North America and Europe. Dogs are epidemiologically important because they act as sentinels for T. gondii infections in humans and are good indicators of environmental contamination. The aim of this study was to isolate and genetically characterize T. gondii strains from tissues of naturally infected Brazilian dogs. For this study, 21 blood samples were collected from dogs at the Zoonosis Control Centers of Ilhéus and Itabuna cities, Bahia, Brazil. The sera were examined for T. gondii antibodies using the indirect hemagglutination test. Brains and hearts of seropositive dogs were bioassayed in mice to isolate and characterize T. gondii parasites by PCR-RFLP using 10 genetic markers (SAG1, newSAG2, SAG3, BTUB, c22-8, c29-2, GRA6, PK1, APICO, and L358). However, T. gondii was isolated from only 4 (57.1%) dogs, designated TgDgBr6, 13, 17, and 21. All strains were virulent, causing clinical changes (rough hair coat, lethargy, and abdominal distention) and the death of all mice within 8-20 days after inoculation. Genetic analysis of these 4 T. gondii isolates revealed 4 distinct genotypes with different clonal lineage combinations (types I, II, and III) and 2 atypical alleles. Using PCR-RFLP with several markers, this study contributes to evaluations of the genetic diversity of strains circulating in Brazil.
Directory of Open Access Journals (Sweden)
Suslov V.M.
2005-12-01
Full Text Available The opportunity approached is shown, but more exact as it is usually accepted, the account of sagging of wires at definition of specific potential factors air High-Voltage Power Transmission Lines. The technique of reception of analytical expressions is resulted. For an opportunity of comparison traditional expressions for specific potential factors are resulted also. Communication of the offered and traditional analytical expressions is shown. Offered analytical expressions are not difficult for programming on a personal computer of any class and besides they allow to make an estimation of an error of traditional expressions by means of parallel definition of specific potential factors by both ways.
Directory of Open Access Journals (Sweden)
Hao Liu
2018-01-01
Full Text Available The Huanghekou Sag is located at the southeast part of the Bohai Bay Basin, northern China. Large-scale shallow lake delta developed in the Neogene provided suitable geological conditions for the formation of a subtle oil-gas reservoir in this area. The key for analyzing sandstone reservoir and sedimentary facies is by using seismic attributes (amplitude to establish the relationship between lithology combination and seismic attributes. The lower unit of Late Miocene Minghuazhen Formation at the BZ34 block in the Huanghekou Sag was subdivided into 10 parasequence sets (PSS. Thicker sandstones mainly occurred in PSS1 and PSS10, whereas thin sandstones are mostly observed within other parasequence sets. This study presents statistics and analyses of lithology, i.e., statistics of root-mean-square (RMS amplitude and lithology of well locations in different parasequence sets of the study area, as well as 1-D forward seismic models of 7 types of lithology combinations, the establishment of a spatial distribution of 2-D sandbody, forward seismic models etc. Our study indicates that high amplitude peaks correspond to thicker sandbodies, while low amplitude indicates non-development of sandbodies (generally less than 2 m, and medium amplitude agrees well with large sets of mudstones interbedded with medium and thinner sandstones. Different sand–mudstone combinations genetically reflect a combination of multiple micro-facies, therefore, amplitude features can predict sandbodies as well as facies characteristics.
DEFF Research Database (Denmark)
Yang, Tian; Cao, Yingchang; Friis, Henrik
2018-01-01
The lacustrine deep-water gravity-flow sandstone reservoirs in the third member of the Shahejie Formation are the main exploration target for hydrocarbons in the Dongying Sag, Eastern China. Carbonate cementation is responsible for much of the porosity and permeability reduction in the lacustrine...
Prevalence of Toxoplasma gondii infection in wild birds in Durango, Mexico.
Alvarado-Esquivel, C; Rajendran, C; Ferreira, L R; Kwok, O C H; Choudhary, S; Alvarado-Esquivel, D; Rodríguez-Peña, S; Villena, I; Dubey, J P
2011-10-01
There is a lack of information concerning the prevalence of Toxoplasma gondii infection in wild birds in Mexico. In the present study, serum samples and tissues from 653 birds from Durango State, Mexico, were evaluated for T. gondii infection. Antibodies to T. gondii (modified agglutination test, titer 1∶25 or higher) were found in 17 (2.6%) of the 653 birds, including 1 of 2 curve-billed thrashers (Toxostoma curvirostre), 2 (1 Anas platyrhynchos, 1 Anas diazi) of 4 ducks, 1 of 2 eagles (Aquila sp.), 5 (27.8%) of 18 great-tailed grackles (Quiscalus mexicanus), 7 (1.3%) of 521 rock pigeons (Columba livia), and 1 (14.3%) of 7 quail (Coturnix coturnix). The seroprevalence of T. gondii infection in birds captured in a park outside the city zoo (11.6%, 8/69) was significantly higher than that found in birds from other regions (1.5%, 9/584, OR = 8.38; 95% CI: 2.82-24.77; P = 0.0001). Brains and hearts of 23 birds (17 seropositive, 6 seronegative) were bioassayed in mice for the isolation of T. gondii . Viable T. gondii was isolated from 1 of 7 seropositive pigeons. The DNA obtained from the T. gondii isolate from the pigeon was genotyped using the PCR-RFLP typing using 11 markers (B1, SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and Apico) and revealed an atypical genotype. This is the first report of T. gondii infection in great-tailed grackles, the Mexican duck, and curved-billed thrashers and the first survey of wild birds in Mexico.
Directory of Open Access Journals (Sweden)
Genji Imokawa
2015-04-01
Full Text Available Our previous studies strongly indicated that the up-regulated activity of skin fibroblast-derived elastase plays a pivotal role in wrinkling and/or sagging of the skin via the impairment of elastic fiber configuration and the subsequent loss of skin elasticity. Fortunately, we succeeded in identifying human skin fibroblast-derived elastase as a previously known enzyme, neprilysin or neutral endopeptidase (NEP. We have also characterized epithelial-mesenchymal paracrine cytokine interactions between UVB-exposed-keratinocytes and dermal fibroblasts and found that interleukin-1α and granulocyte macrophage colony stimulatory factor (GM-CSF are intrinsic cytokines secreted by UVB-exposed keratinocytes that stimulate the expression of neprilysin by fibroblasts. On the other hand, direct UVA exposure of human fibroblasts significantly stimulates the secretion of IL-6 and also elicits a significant increase in the gene expression of matrix metallo-protease(MMP-1 as well as neprilysin (to a lesser extent, which is followed by distinct increases in their protein and enzymatic activity levels. Direct UVA exposure of human keratinocytes also stimulates the secretion of IL-6, IL-8 and GM-CSF but not of IL-1 and endothelin-1. These findings suggest that GM-CSF secreted by UVA-exposed keratinocytes as well as IL-6 secreted by UVA-exposed dermal fibroblasts play important and additional roles in UVA-induced sagging and wrinkling by up-regulation of neprilysin and MMP-1, respectively, in dermal fibroblasts.
Ichikawa-Seki, Madoka; Guswanto, Azirwan; Allamanda, Puttik; Mariamah, Euis Siti; Wibowo, Putut Eko; Nishikawa, Yoshifumi
2016-01-01
Neospora caninum can cause fetal abortion and neonatal mortality in cattle, and is a cause of economic concern worldwide. This study aimed to determine the prevalence of Neospora caninum-specific antibodies in cattle from Western Java, Indonesia. Serum samples from 991 cattle from 21 locations were tested for antibodies to N. caninum by using an enzyme-linked immunosorbent assay (ELISA) on the basis of recombinant NcSAG1. The overall seroprevalence was 16.6%, ranging from 0 to 87.5% in the sampled locations. The results of this study indicate latent infection rates of sampled animals were different in each location. Further studies are necessary to elucidate the relationship between N. caninum infection and abortion in cattle, and to identify risk factors for infection in high-prevalence environments.
DG Allocation Based on Reliability, Losses and Voltage Sag Considerations: an expert system approach
Directory of Open Access Journals (Sweden)
Sahar Abdel Moneim Moussa
2017-03-01
Full Text Available Expert System (ES as a branch of Artificial Intelligence (AI methodology can potentially help in solving complicated power system problems. This may be more appropriate methodology than conventional optimization techniques when contradiction between objectives appears in reaching the optimum solution. When this contradiction is the hindrance in reaching the required system operation through the application of traditional methods ES can give a hand in such case. In this paper, the knowledge- based ES technique is proposed to reach near-optimum solution which is further directed to the optimum solution through particle swarm optimization (PSO technique. This idea is known as Hybrid-Expert-System (HES. The proposed idea is used in getting the optimum allocation of a number of distributed generation (DG units on Distribution System (DS busbars taking into consideration three issues; reliability, voltage sag, and line losses. Optimality is assessed on the economic basis by calculating money benefits (or losses resulting from DG addition considering the three aforementioned issues. The effectiveness of the proposed technique is ascertained through example.
Zheng, Lijing; Jiang, Zaixing; Liu, Hui; Kong, Xiangxin; Li, Haipeng; Jiang, Xiaolong
2015-10-01
The Shulu Sag, located in the southwestern corner of the Jizhong Depression, Bohai Bay Basin of east China, is a NE-SW trending, elongate Cenozoic half-graben basin. The lowermost part of the third member of the Shahejie Formation in this basin is characterized by continental rudstone and calcilutite to calcisiltite facies. Based on core observation and regional geologic analysis, seismites are recognized in these lacustrine deposits, which include soft-sediment deformation structures (sedimentary dikes, hydraulic shattering, diapir structures, convolute lamination, load-flame structures, ball-and-pillow structures, loop bedding, and subsidence structures), synsedimentary faults, and seismoturbidites. In addition, mixed-source rudstones, consisting of the Paleozoic carbonate clasts and in situ calcilutite clasts in the lowermost submember of Shahejie 3, appear in the seismites, suggesting an earthquake origin. A complete representative vertical sequence in the lowermost part of the third member found in well ST1H located in the central part of the Shulu Sag shows, from the base to the top: underlying undeformed layers, synsedimentary faults, liquefied carbonate rocks, allogenetic seismoturbidites, and overlying undeformed layers. Seismites are widely distributed around this well and there are multiple sets of stacked seismites separated by undeformed sediment. The nearby NW-trending Taijiazhuang fault whose fault growth index is from 1.1 to 1.8 and the NNE-trending Xinhe fault with a fault growth index of 1.3-1.9 may be the source of the instability to create the seismites. These deformed sedimentary layers are favorable for the accumulation of oil and gas; for example, sedimentary dikes can cut through many layers and serve as conduits for fluid migration. Sedimentary faults and fractures induced by earthquakes can act as oil and gas migration channels or store petroleum products as well. Seismoturbidites and mixed-source rudstones are excellent reservoirs due to
Mouse-virulent Toxoplasma gondii isolated from feral cats on Mona Island, Puerto Rico.
Dubey, J P; López-Torres, H Y; Sundar, N; Velmurugan, G V; Ajzenberg, D; Kwok, O C H; Hill, R; Dardé, M L; Su, C
2007-12-01
Cats are essential in the life cycle of Toxoplasma gondii because they are the only hosts that can excrete the environmentally resistant oocysts. Samples of serum, feces, and tissues from cats from Mona, a remote island off the coast of Puerto Rico, were examined for T. gondii infection. Antibodies to T. gondii were assayed by the modified agglutination test and found in 16 of 19 (84.2%) of cats, with titers of 1:10 in 2, 1:80 in 1, 1:160 in 4, 1:320 in 3, and 1:1,280 or higher in 6. Tissues of 19 of the 20 cats were bioassayed in mice for T. gondii infection. Toxoplasma gondii was isolated from tissues of 12 cats: from the hearts of 9, skeletal muscle of 10, and brain of 1 cat. All infected mice from 10 of 12 isolates died of acute toxoplasmosis during primary infection. Genotyping of these 12 T. gondii isolates (designated (TgCatPr 1-12) by 10 multilocus PCR-RFLP markers, i.e., SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1, and an apicoplast marker Apico, and the 6 multilocus microsatellite markers TUB2, W35, TgM-A, B18, B17, and M33, revealed 7 genotypes; 5 isolates had Type I alleles at all loci except at 1 microsatellite locus, and the remainder were atypical. The latter isolates of T. gondii were different biologically and phenotypically from the feline isolates from the rest of the Americas. One isolate (TgCatPr 12) was a mixed infection with 2 genotypes.
Zakizadeh, Hedayat; Lütken, Henrik; Sriskandarajah, Sridevy; Serek, Margrethe; Müller, Renate
2013-02-01
KEY MESSAGE : The P ( SAG12 ) -ipt gene was transferred to miniature rose, as the first woody species, resulting in increased ethylene resistance due to specific up-regulation of the ipt gene under senescence promoting conditions. Transgenic plants of Rosa hybrida 'Linda' were obtained via transformation with Agrobacterium tumefaciens strain harboring the binary vector pSG529(+) containing the P( SAG12 )-ipt construct. A. tumefaciens strains AGL1, GV3850 and LBA4404 (containing P(35S)-INTGUS gene) were used for transformation of embryogenic callus, but transgenic shoots were obtained only when AGL1 was applied. The highest transformation frequency was 10 % and it was achieved when half MS medium was used for the dilution of overnight culture of Agrobacterium. Southern blot confirmed integration of 1-6 copies of the nptII gene into the rose genome in the tested lines. Four transgenic lines were obtained which were morphologically true-to-type and indistinguishable from Wt shoots while they were in in vitro cultures. Adventitious root induction was more difficult in transgenic shoots compared to the Wt shoots, however, one of the transgenic lines (line 6) was rooted and subsequently analyzed phenotypically. The ipt expression levels were determined in this line after exposure to exogenous ethylene (3.5 μl l(-1)) and/or darkness. Darkness resulted in twofold up-regulation of ipt expression, whereas darkness combined with ethylene caused eightfold up-regulation in line 6 compared to Wt plants. The transgenic line had significantly higher content of chlorophyll at the end of the treatment period compared to Wt plants.
Wet routes of high purity BaTiO3 nanopowders
International Nuclear Information System (INIS)
Wang Liqiu; Liu Liang; Xue Dongfeng; Kang Hongmin; Liu Changhou
2007-01-01
High purity BaTiO 3 nanopowders were prepared in wet routes through stearic acid gel (SAG) and acetic acid gel (AAG) techniques, respectively. BaTiO 3 samples were characterized by X-ray diffraction, transmission electron microscope, Fourier transform infrared spectrometry, X-ray fluorescence spectrometry, and thermal gravimetric analysis. The present results indicate that both methods have a similar reaction process during calcination, while BaTiO 3 crystallites were initially formed at 550 deg. C by SAG and 800 deg. C by AAG. Both methods could produce BaTiO 3 powders with a cubic perovskite structure, while they had different grain size distributions within 25-50 nm for SAG and 50-80 nm for AAG. BaTiO 3 samples prepared by SAG had a lower agglomeration than those by AAG. SAG has shown many distinctive advantages in the preparation of high purity BaTiO 3 nanopowders, without Ba and Ti losses and hazardous wastes
Four-stranded mini microtubules formed by Prosthecobacter BtubAB show dynamic instability.
Deng, Xian; Fink, Gero; Bharat, Tanmay A M; He, Shaoda; Kureisaite-Ciziene, Danguole; Löwe, Jan
2017-07-18
Microtubules, the dynamic, yet stiff hollow tubes built from αβ-tubulin protein heterodimers, are thought to be present only in eukaryotic cells. Here, we report a 3.6-Å helical reconstruction electron cryomicroscopy structure of four-stranded mini microtubules formed by bacterial tubulin-like Prosthecobacter dejongeii BtubAB proteins. Despite their much smaller diameter, mini microtubules share many key structural features with eukaryotic microtubules, such as an M-loop, alternating subunits, and a seam that breaks overall helical symmetry. Using in vitro total internal reflection fluorescence microscopy, we show that bacterial mini microtubules treadmill and display dynamic instability, another hallmark of eukaryotic microtubules. The third protein in the btub gene cluster, BtubC, previously known as "bacterial kinesin light chain," binds along protofilaments every 8 nm, inhibits BtubAB mini microtubule catastrophe, and increases rescue. Our work reveals that some bacteria contain regulated and dynamic cytomotive microtubule systems that were once thought to be only useful in much larger and sophisticated eukaryotic cells.
Energy Technology Data Exchange (ETDEWEB)
Martin, Nancy, E-mail: nancy@ualberta.ca [Department of Civil and Environmental Engineering, University of Alberta, Edmonton, AB, Canada T6G 2W2 (Canada); McEachern, Preston [Tervita Corporation, AB (Canada); Yu, Tong; Zhu, David Z. [Department of Civil and Environmental Engineering, University of Alberta, Edmonton, AB, Canada T6G 2W2 (Canada)
2013-01-15
Northern rivers exposed to high biochemical oxygen demand (BOD) loads are prone to dissolved oxygen (DO) sags in winter due to re-aeration occurring within limited open water leads. Additionally, photosynthesis is reduced by decreased daylight hours, inability of solar radiation to pass through ice, and slower algal growth in winter. The low volumetric flow decreases point-source dilution while their travel time increases. The Athabasca River in Alberta, Canada, has experienced these sags which may affect the aquatic ecosystem. A water quality model for an 800 km reach of this river was customized, calibrated, and validated specifically for DO and the factors that determine its concentration. After validation, the model was used to assess the assimilative capacity of the river and mitigation measures that could be deployed. The model reproduced the surface elevation and water temperature for the seven years simulated with mean absolute errors of < 15 cm and < 0.9 °C respectively. The ice cover was adequately predicted for all seven winters, and the simulation of nutrients and phytoplankton primary productivity were satisfactory. The DO concentration was very sensitive to the sediment oxygen demand (SOD), which represented about 50% of the DO sink in winter. The DO calibration was improved by implementing an annual SOD based on the BOD load. The model was used to estimate the capacity of the river to assimilate BOD loads in order to maintain a DO concentration of 7 mg/L, which represents the chronic provincial guideline plus a buffer of 0.5 mg/L. The results revealed the maximum assimilative BOD load of 8.9 ton/day at average flow conditions, which is lower than the maximum permitted load. In addition, the model predicted a minimum assimilative flow of about 52 m{sup 3}/s at average BOD load. Climate change scenarios could increase the frequency of this low flow. A three-level warning-system is proposed to manage the BOD load proactively at different river
2010-03-01
This report documents the work of the Mid-Range Rover Science Analysis Group (MRR-SAG), which was assigned to formulate a concept for a potential rover mission that could be launched to Mars in 2018. Based on programmatic and engineering considerations as of April 2009, our deliberations assumed that the potential mission would use the Mars Science Laboratory (MSL) sky-crane landing system and include a single solar-powered rover. The mission would also have a targeting accuracy of approximately 7 km (semimajor axis landing ellipse), a mobility range of at least 10 km, and a lifetime on the martian surface of at least 1 Earth year. An additional key consideration, given recently declining budgets and cost growth issues with MSL, is that the proposed rover must have lower cost and cost risk than those of MSL--this is an essential consideration for the Mars Exploration Program Analysis Group (MEPAG). The MRR-SAG was asked to formulate a mission concept that would address two general objectives: (1) conduct high priority in situ science and (2) make concrete steps toward the potential return of samples to Earth. The proposed means of achieving these two goals while balancing the trade-offs between them are described here in detail. We propose the name Mars Astrobiology Explorer-Cacher(MAX-C) to reflect the dual purpose of this potential 2018 rover mission.
Valadas, Samantha Y O B; da Silva, Juliana I G; Lopes, Estela Gallucci; Keid, Lara B; Zwarg, Ticiana; de Oliveira, Alice S; Sanches, Thaís C; Joppert, Adriana M; Pena, Hilda F J; Oliveira, Tricia M F S; Ferreira, Helena L; Soares, Rodrigo M
2016-05-01
Although few species of Sarcocystis are known to use marsupials of the genus Didelphis as definitive host, an extensive diversity of alleles of surface antigen genes (sag2, sag3, and sag4) has been described in samples of didelphid opossums in Brazil. In this work, we studied 25 samples of Sarcocystis derived from gastrointestinal tract of opossums of the genus Didelphis by accessing the variability of sag2, sag3, sag4, gene encoding cytochrome b (cytB) and first internal transcribed spacer (ITS1). Reference samples of Sarcocystis neurona (SN138) and Sarcocystis falcatula (SF1) maintained in cell culture were also analyzed. We found four allele variants of cytB, seven allele variants of ITS1, 10 allele variants of sag2, 13 allele variants of sag3, and 6 allele variants of sag4. None of the sporocyst-derived sequences obtained from Brazilian opossums revealed 100% identity to SN138 at cytB gene, nor to SN138 or SF1 at ITS1 locus. In addition, none of the sag alleles were found identical to either SF1 or SN138 homologous sequences, and a high number of new sag allele types were found other than those previously described in Brazil. Out of ten sag2 alleles, four are novel, while eight out of 13 sag3 alleles are novel and one out of six sag4 alleles is novel. Further studies are needed to clarify if such a vast repertoire of allele variants of Sarcocystis is the consequence of re-assortments driven by sexual exchange, in order to form individuals with highly diverse characteristics, such as pathogenicity, host spectrum, among others or if it only represents allele variants of different species with different biological traits. Copyright © 2016 Elsevier Inc. All rights reserved.
Richini-Pereira, Virgínia Bodelão; Marson, Pâmela Merlo; Silva, Rodrigo Costa da; Langoni, Helio
2016-01-01
Road-killed wild animals host zoonotic pathogens such as Toxoplasma gondii, offering a new opportunity for the epidemiological study of these infectious organisms. This investigation aimed to determine the presence of T. gondii and other apicomplexan parasites in tissue samples of 64 road-killed wild animals, using polymerase chain reaction (PCR). Positive samples were then typed by PCR-restriction fragment length polymorphism (RFLP) using 7 markers: SAG1, 5'-3'SAG2, SAG3, BTUB, c29-6, PK1, and Apico. PCR-RFLP targeting 18S ribosomal RNA (rRNA) genes was also performed on all samples to detect other apicomplexan parasites. T. gondii DNA was detected in 16 tissue samples from 8 individual animals, as follows: 1 Cerdocyon thous (crab-eating fox), 1 Didelphis albiventris (white-eared opossum), 1 Lutreolina crassicaudata (lutrine opossum), 2 Myrmecophaga tridactyla (giant anteater), 1 Procyon cancrivorus (crab-eating raccoon), and 2 Sphiggurus spinosus (Paraguay hairy dwarf porcupine). Seven different T. gondii genotypes were identified, 6 of which were novel. Typing by 18S rRNA verified these 16 T. gondii-infected samples, and identified 1 Sarcocystis spp.-infected animal [Dasypus novemcinctus (nine-banded armadillo)]. The amplified T. gondii (GenBank accession No. L37415.1) and Sarcocystis spp. 18S rRNA products were confirmed by sequencing. Our results indicate that T. gondii is commonly present in wild mammals, which act as sources of infection for humans and animals, including other wild species. The approach employed herein proved useful for detecting T. gondii and Sarcocystis spp. in the environment and identifying their natural reservoirs, contributing to our understanding of host-parasite interactions.
Directory of Open Access Journals (Sweden)
Virgínia Bodelão Richini-Pereira
Full Text Available Abstract INTRODUCTION: Road-killed wild animals host zoonotic pathogens such as Toxoplasma gondii, offering a new opportunity for the epidemiological study of these infectious organisms. METHODS This investigation aimed to determine the presence of T. gondii and other apicomplexan parasites in tissue samples of 64 road-killed wild animals, using polymerase chain reaction (PCR. Positive samples were then typed by PCR-restriction fragment length polymorphism (RFLP using 7 markers: SAG1, 5′-3′SAG2, SAG3, BTUB, c29-6, PK1, and Apico. PCR-RFLP targeting 18S ribosomal RNA (rRNA genes was also performed on all samples to detect other apicomplexan parasites. RESULTS T. gondii DNA was detected in 16 tissue samples from 8 individual animals, as follows: 1 Cerdocyon thous (crab-eating fox, 1 Didelphis albiventris (white-eared opossum, 1 Lutreolina crassicaudata (lutrine opossum, 2 Myrmecophaga tridactyla (giant anteater, 1 Procyon cancrivorus (crab-eating raccoon, and 2 Sphiggurus spinosus (Paraguay hairy dwarf porcupine. Seven different T. gondii genotypes were identified, 6 of which were novel. Typing by 18S rRNA verified these 16 T. gondii-infected samples, and identified 1 Sarcocystis spp.-infected animal [Dasypus novemcinctus (nine-banded armadillo]. The amplified T. gondii (GenBank accession No. L37415.1 and Sarcocystis spp. 18S rRNA products were confirmed by sequencing. CONCLUSIONS Our results indicate that T. gondii is commonly present in wild mammals, which act as sources of infection for humans and animals, including other wild species. The approach employed herein proved useful for detecting T. gondii and Sarcocystis spp. in the environment and identifying their natural reservoirs, contributing to our understanding of host-parasite interactions.
Murillo Sánchez, Oscar Javier
2012-01-01
Se muestra el desarrollo y los resultados de una metodología propuesta para la determinación de la correlación entre descargas eléctricas atmosféricas detectadas y registradas en una zona y los hundimientos de tensión (sags) registrados en el sistema de distribución asociado. Como ejemplo de aplicación se usa información del sistema de localización de rayos WWLLN (wwlln.net), el Sistema de información de Descarga SID (propiedad de ISA. S.A. E.S.P.) y las mediciones de calidad de potencia de C...
International Nuclear Information System (INIS)
Samajdar, I.; Watte, P.; Mertens, F.
1999-01-01
Non-Sag tungsten (W) wire is indispensable for the lighting industry. For the necessary creep resistance, large elongated grains are considered as the desired microstructure. These large grains are obtained by primary and secondary recrystallization. In the present study an effort has been made to characterize and to understand the origin of such large elongated grains. In secondary recrystallization, often called abnormal grain growth, a few of the grains grow massive. The mechanisms of normal and abnormal grain growth are essentially the same, involving high angle boundary migration and driven by the reduction of surface energy. The abnormal grain growth can be visualized as a growth advantage for a few of the grains or growth disadvantage for the majority. Such an advantage/disadvantage may be caused by (1) differences in grain size and/or (2) differences in grain boundary character distribution (GBCD). In other words, a grain may grow massive if it has large size and/or possibilities of more favorable (i.e., of higher mobility) grain boundaries with the matrix grains
Dong, Tian; He, Sheng; Wang, Dexi; Hou, Yuguang
2014-08-01
The Upper Cretaceous Qingshankou Formation acts as both the source and reservoir sequence in the Changling Sag, situated in the southern end of the Songliao Basin, northeast China. An integrated approach involving determination of hydrocarbon charging history, oil source correlation and hydrocarbon generation dynamic modeling was used to investigate hydrocarbon migration processes and further predict the favorable targets of hydrocarbon accumulations in the Qingshankou Formation. The hydrocarbon generation and charge history was investigated using fluid inclusion analysis, in combination with stratigraphic burial and thermal modeling. The source rocks began to generate hydrocarbons at around 82 Ma and the hydrocarbon charge event occurred from approximately 78 Ma to the end of Cretaceous (65.5 Ma) when a large tectonic uplift took place. Correlation of stable carbon isotopes of oils and extracts of source rocks indicates that oil was generated mainly from the first member of Qingshankou Formation (K2qn1), suggesting that hydrocarbon may have migrated vertically. Three dimensional (3D) petroleum system modeling was used to evaluate the processes of secondary hydrocarbon migration in the Qingshankou Formation since the latest Cretaceous. During the Late Cretaceous, hydrocarbon, mainly originated from the Qianan depression, migrated laterally to adjacent structural highs. Subsequent tectonic inversion, defined as the late Yanshan Orogeny, significantly changed hydrocarbon migration patterns, probably causing redistribution of primary hydrocarbon reservoirs. In the Tertiary, the Heidimiao depression was buried much deeper than the Qianan depression and became the main source kitchen. Hydrocarbon migration was primarily controlled by fluid potential and generally migrated from relatively high potential areas to low potential areas. Structural highs and lithologic transitions are potential traps for current oil and gas exploration. Finally, several preferred hydrocarbon
Dubey, J P; Ness, S L; Kwok, O C H; Choudhary, S; Mittel, L D; Divers, T J
2014-01-17
Donkeys (Equus asinus) are used as both companion and working animals throughout the world and in some countries, their meat and milk are used for human consumption. Here we report the first serological survey of Toxoplasma gondii in donkeys in the United States. Serum samples from 373 donkeys from eight farms in five states were tested for T. gondii antibodies by the modified agglutination test (MAT). Twenty-four of 373 (6.4%) of donkeys were seropositive, with MAT titers ranging from 25 to ≥ 200. All seropositive donkeys were Miniature breed. Seropositivity prevalence was 7.0% in female donkeys (20/282) and 4.1% in male donkeys (4/91). No donkeys less than 24 months of age (129) were seropositive, suggesting postnatal transmission of infection. Domestic cats were present on six of the eight farms. Three cats from one farm had MAT titers of 200. Viable T. gondii was isolated from the hearts of two cats, but not from brain tissues. Genotyping of isolate DNA extracted from culture-derived tachyzoites using 10 PCR-restriction fragment length polymorphism (RFLP) markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, PK1, L358 and Apico loci) revealed that both isolates were clonal Type II (ToxoDB PCR-RFLP genotype #1). This is the first serological survey for T. gondii in donkeys in the United States, and suggests that donkey milk and meat should be considered as a potential source for human infection. The role of barn cats in the transmission of T. gondii to donkeys on farms warrents further investigation. Copyright © 2013 Elsevier B.V. All rights reserved.
Liu, Jie; Lv, Yue-Wei; Shi, Jin-Li; Ma, Xiao-Jie; Chen, Yi; Zheng, Zhi-Quan; Wang, Sheng-Nan; Guo, Jian-You
2017-08-11
Albizzia julibrissin Durazz, a Chinese Medicine, is commonly used for its anti-anxiety effects. (-)-syringaresnol-4- O -β-d-apiofuranosyl-(1→2)-β-d-glucopyranoside (SAG) is the main ingredient of Albizzia julibrissin Durazz. The present study investigated the anxiolytic effect and potential mechanisms on the HPA axis and monoaminergic systems of SAG on acute restraint-stressed rats. The anxiolytic effect of SAG was examined through an open field test and an elevated plus maze test. The concentration of CRF, ACTH, and CORT in plasma was examined by an enzyme-linked immune sorbent assay (ELISA) kit while neurotransmitters in the cerebral cortex and hippocampus of the brain were examined by High Performance Liquid Chromatography (HPLC). We show that repeated treatment with SAG (3.6 mg/kg, p.o.) significantly increased the number and time spent on the central entries in the open-field test when compared to the vehicle/stressed group. In the elevated plus maze test, 3.6 mg/kg SAG could increase the percentage of entries into and time spent on the open arms of the elevated plus maze. In addition, the concentration of CRF, ACTH, and CORT in plasma and neurotransmitters (NE, 5-HT, DA and their metabolites 5-HIAA, DOPAC, and HVA) in the cerebral cortex and hippocampus of the brain were decreased after SAG treatment, as compared to the repeated acute restraint-stressed rats. These results suggest that SAG is a potential anti-anxiety drug candidate.
DEFF Research Database (Denmark)
Tafti, Hossein Dehghani; Maswood, Ali Iftekhar; Pou, Josep
2016-01-01
strings should be reduced during voltage sags. In this paper, an algorithm is proposed for determining the reference voltage of the PV string which results in a reduction of the output power to a certain amount. The proposed algorithm calculates the reference voltage for the dc/dc converter controller......, based on the characteristics of the power-voltage curve of the PV string and therefore, no modification is required in the the controller of the dc/dc converter. Simulation results on a 50-kW PV string verified the effectiveness of the proposed algorithm in reducing the power from PV strings under......Due to the high penetration of the installed distributed generation units in the power system, the injection of reactive power is required for the medium-scale and large-scale grid-connected photovoltaic power plants (PVPPs). Because of the current limitation of the grid-connected inverter...
Comprehensive Reactive Power Support of DFIG Adapted to Different Depth of Voltage Sags
Directory of Open Access Journals (Sweden)
Yangwu Shen
2017-06-01
Full Text Available The low voltage ride-through (LVRT capability of the doubly-fed induction generator (DFIG significantly impacts upon the integration of wind power into the power grid. This paper develops a novel comprehensive control strategy to enhance the LVRT and reactive power support capacities of the DFIG by installing the energy storage system (ESS. The ESS is connected to the DC-link capacitor of the DFIG and used to regulate the DC-link voltage during normal or fault operations. The unbalanced power between the captured wind power and the power injected to the grid during the transient process is absorbed or compensated by the ESS. The rotor-side converter (RSC is used to control the maximum power production and the grid-side converter (GSC is used to control the reactive power before participating in the voltage support. When the supply voltage continues to drop, the rotor speed is increased by controlling the RSC to realize the LVRT capability and help the GSC further enhance the reactive power support capability. The capacity of the GSC is dedicated to injecting the reactive power to the grid. An auxiliary transient pitch angle controller is proposed to protect the generator’s over speed. Both RSC and GSC act as reactive power sources to further enhance the voltage support capability with serious voltage sags. Simulations based on a single-machine infinite-bus power system verify the effectiveness of the developed comprehensive control strategy.
International Nuclear Information System (INIS)
Seixas, M.; Melício, R.; Mendes, V.M.F.
2014-01-01
Highlights: • Impact on wind turbines due to fifth harmonic and sag content. • Converter topologies considered are two-level and three-level ones. • Controllers are based on PI and fractional-order methods. • New control strategy for the selection of output voltage vectors. • Balancing voltages in the DC-link capacitors. - Abstract: This paper deals with the computing simulation of the impact on permanent magnet synchronous generator wind turbines due to fifth harmonic content and grid voltage decrease. Power converter topologies considered in the simulations are the two-level and the three-level ones. The three-level converters are limited by unbalance voltages in the DC-link capacitors. In order to lessen this limitation, a new control strategy for the selection of the output voltage vectors is proposed. Controller strategies considered in the simulation are respectively based on proportional integral and fractional-order controllers. Finally, a comparison between the results of the simulations with the two controller strategies is presented in order to show the main advantage of the proposed strategy
Energy Technology Data Exchange (ETDEWEB)
Mavroidis, P [University of Texas Health Science Center, UTHSCSA, San Antonio, TX (United States); Lavdas, E; Kostopoulos, S; Ninos, C; Strikou, A; Glotsos, D; Vlachopoulou, A; Oikonomou, G [Technological Education Institute of Athens, Athens, Athens (Greece); Economopoulos, N [General University Hospital ATTIKON, Athens, Athens (Greece); Roka, V [Health Center of Farkadona, Trikala (Greece); Sakkas, G [Center for Research and Technology of Thessaly, Trikala (Greece); Tsagkalis, A; Batsikas, G [IASO Thessalias Hospital, Larissa (Greece); Statkahis, S [Cancer Therapy and Research Center, San Antonio, TX (United States); Papanikolaou, N [University of Texas HSC SA, San Antonio, TX (United States)
2014-06-01
Purpose: To assess the efficacy of the BLADE technique to eliminate motion, truncation, flow and other artifacts in Cervical Spine MRI compared to the conventional technique. To study the ability of the examined sequences to reduce the indetention and wrap artifacts, which have been reported in BLADE sagittal sequences. Methods: Forty consecutive subjects, who had been routinely scanned for cervical spine examination using four different image acquisition techniques, were analyzed. More specifically, the following pairs of sequences were compared: a) T2 TSE SAG vs. T2 TSE SAG BLADE and b) T2 TIRM SAG vs. T2 TIRM SAG BLADE. A quantitative analysis was performed using the signal-to-noise ratio (SNR), contrast-to-noise ratio (CNR) and relative contrast (ReCon) measures. A qualitative analysis was also performed by two radiologists, who graded seven image characteristics on a 5-point scale (0:non-visualization; 1:poor; 2:average; 3:good; 4:excellent). The observers also evaluated the presence of image artifacts (motion, truncation, flow, indentation). Results: Based on the findings of the quantitative analysis, the ReCON values of the CSF (cerebrospinal fluid)/SC (spinal cord) between TIRM SAG and TIRM SAG BLADE were found to present statistical significant differences (p<0.001). Regarding motion and truncation artifacts, the T2 TSE SAG BLADE was superior compared to the T2 TSE SAG and the T2 TIRM SAG BLADE was superior compared to the T2 TIRM SAG. Regarding flow artifacts, T2 TIRM SAG BLADE eliminated more artifacts compared to the T2 TIRM SAG. Conclusion: The use of BLADE sequences in cervical spine MR examinations appears to be capable of potentially eliminating motion, pulsatile flow and trancation artifacts. Furthermore, BLADE sequences are proposed to be used in the standard examination protocols based on the fact that a significantly improved image quality could be achieved.
International Nuclear Information System (INIS)
Mavroidis, P; Lavdas, E; Kostopoulos, S; Ninos, C; Strikou, A; Glotsos, D; Vlachopoulou, A; Oikonomou, G; Economopoulos, N; Roka, V; Sakkas, G; Tsagkalis, A; Batsikas, G; Statkahis, S; Papanikolaou, N
2014-01-01
Purpose: To assess the efficacy of the BLADE technique to eliminate motion, truncation, flow and other artifacts in Cervical Spine MRI compared to the conventional technique. To study the ability of the examined sequences to reduce the indetention and wrap artifacts, which have been reported in BLADE sagittal sequences. Methods: Forty consecutive subjects, who had been routinely scanned for cervical spine examination using four different image acquisition techniques, were analyzed. More specifically, the following pairs of sequences were compared: a) T2 TSE SAG vs. T2 TSE SAG BLADE and b) T2 TIRM SAG vs. T2 TIRM SAG BLADE. A quantitative analysis was performed using the signal-to-noise ratio (SNR), contrast-to-noise ratio (CNR) and relative contrast (ReCon) measures. A qualitative analysis was also performed by two radiologists, who graded seven image characteristics on a 5-point scale (0:non-visualization; 1:poor; 2:average; 3:good; 4:excellent). The observers also evaluated the presence of image artifacts (motion, truncation, flow, indentation). Results: Based on the findings of the quantitative analysis, the ReCON values of the CSF (cerebrospinal fluid)/SC (spinal cord) between TIRM SAG and TIRM SAG BLADE were found to present statistical significant differences (p<0.001). Regarding motion and truncation artifacts, the T2 TSE SAG BLADE was superior compared to the T2 TSE SAG and the T2 TIRM SAG BLADE was superior compared to the T2 TIRM SAG. Regarding flow artifacts, T2 TIRM SAG BLADE eliminated more artifacts compared to the T2 TIRM SAG. Conclusion: The use of BLADE sequences in cervical spine MR examinations appears to be capable of potentially eliminating motion, pulsatile flow and trancation artifacts. Furthermore, BLADE sequences are proposed to be used in the standard examination protocols based on the fact that a significantly improved image quality could be achieved
Cheng, Yong; Zhang, Yu; Wen, Yiming
2018-02-01
The microscopic pore structure is the key of the shale reservoir study; however, traditional Scanning Electron Microscopy (SEM) methods cannot identify the irregular morphology caused by mechanical polishing. In this work, Scanning Electron Microscopy combined argon ion polishing technology was taken to study the characteristics of shale reservoir pores of Member 1 of Shahejie Formation (E3s1) located in JX1-1 area of Liaozhong Sag. The results show that pores between clay platelets, intraplatelet pores within clay aggregates and organic-matter pores are very rich in the area and with good pore connectivity, so these types of pores are of great significance for oil-gas exporation. Pores between clay platelets are formed by directional or semi-directional contact between edge and surface, edge and edge or surface and surface of laminated clay minerals, whose shapes are linear, mesh, and irregular with the size of 500 nm to 5 μm. The intraplatelet pores within clay aggregates are formed in the process of the transformation and compaction of clay minerals, whose shapes are usually linear with the width of 30 to 500 nm and the length of 2 to 50 μm. The organic-matter pores are from the process of the conversion from organic matters to the hydrocarbon under thermal evolution, whose shapes are gneissic, irregular, pitted and elliptical with the size of 100 nm to 2 μm. This study is of certain guiding significance to selecting target zones, evaluating resource potential and exploring & developing of shale gas in this region.
Directory of Open Access Journals (Sweden)
Stephanie S. L. Cheung
2017-01-01
Full Text Available A 78-year-old woman complained of gradual, painless onset of horizontal binocular diplopia associated with progressive axial weakness. Physical examination revealed esotropia that was greater at distance than at near vision, bilateral levator dehiscence, and normal abducting saccadic speeds. Given the age of the patient and compatible clinical findings, the diagnosis of Sagging Eye Syndrome (SES was made. However, further work-up with a muscle biopsy suggested Sporadic Late-Onset Nemaline Myopathy (SLONM as the cause of her progressive muscle weakness. Although rare, external ophthalmoplegia has been described in the literature as a presenting symptom in SLONM. To elucidate the pathological mechanism for the patient’s diplopia, an MRI of the orbits was performed, which revealed findings consistent with SES. This case aims to highlight the importance of integrating clinical findings during the diagnostic process and serves as a reminder that diplopia can be a common symptom for an uncommon diagnosis.
Dubey, J P; Prowell, M
2013-02-01
Toxoplasma gondii infections are common in humans and other animals, but clinical disease is relatively rare. It is unknown whether the severity of toxoplasmosis in immunocompetent hosts is due to the parasite strain, host variability, or to other factors. Recently, attention has been focused on the genetic variability among T. gondii isolates from apparently healthy and sick hosts. Whether T. gondii genetic makeup plays a part in the pathogenesis of clinical feline toxoplasmosis is uncertain because little is known of genetic typing of strains associated with clinical feline toxoplasmosis. A 6-mo-old domestic male cat was hospitalized because of lethargy, anorexia, fever, and diarrhea. Numerous (6 million in 1 sample) T. gondii oocysts were found in feces of the cat and antibodies to T. gondii (titer 1:800) were found in its serum by the modified agglutination test. The cat was medicated orally with Clindamycin for 10 days; it became asymptomatic after 10 days and was discharged from the hospital. Viable T. gondii (designated TgCatUs9) was isolated from feces (oocysts) by bioassays in mice. Genetic typing using the DNA extracted from the brains of infected mice and 10 PCR-restriction fragment length polymorphism (RFLP) markers revealed Type II allele at the SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, and PK1 loci and Type I at the L358 and Apico loci; therefore, this isolate belongs to the ToxoDB PCR-RFLP genotype no. 4, which is grouped into the Type 12 lineage that is dominant in wildlife from North America. To our knowledge, this is the first T. gondii isolate characterized genetically from a sick cat in the USA.
Energy Technology Data Exchange (ETDEWEB)
Negi, Sujay, E-mail: negi.sujay@gmail.com [Indian Institute of Technology, Roorkee 247667 (India); Kumar, Ravi, E-mail: ravikfme@gmail.com [Indian Institute of Technology, Roorkee 247667 (India); Majumdar, P., E-mail: pmajum@barc.gov.in [Bhabha Atomic Research Centre, Mumbai 400085 (India); Mukopadhyay, D., E-mail: dmukho@barc.gov.in [Bhabha Atomic Research Centre, Mumbai 400085 (India)
2017-03-15
Highlights: • At 16 kW/m input, thermal stability was attained at 595 °C, without PT-CT contact. • At 20 kW/m step input, PT-CT contact occurred at 637 °C near bottom-center of the tube. • PT integrity was maintained throughout the experiment. - Abstract: An experimental investigation was conducted to simulate the sagging behavior of a full length Pressure Tube of a channel of 220 MWe Indian PHWR. The investigation aimed to recreate a condition resembling Loss of Coolant Accident (LOCA) with Emergency Core Cooling System (ECCS) failure in a nuclear power plant. A full length channel assembly immersed in moderator was subjected to electrical resistance heating of Pressure Tube (PT) to simulate the residual heat after shutting down of reactor. The temperature of PT started rising and the contact between PT and CT was established at the center of the tube where average bottom temperature was 637 °C. The integrity of PT was maintained throughout the experiment and the PT heat up was arrested on contact with the CT due to transfer of heat to the moderator.
Directory of Open Access Journals (Sweden)
Yu-Rong Yang
2017-07-01
Full Text Available The felids are the only definitive hosts of Toxoplasma gondii, which could excrete oocysts into the environment and provide an infection source for toxoplasmosis in various warm-blooded animal species, particularly the captive felids that live close to human communities. The infection rate of the captive felids is a perfect standard in detecting the presence of Toxoplasma gondii oocysts in the environment. In this study, sera or tissue samples from zoo (1 young tiger, 2 adult tigers, 6 young lions, farm (10 masked palm civets, and pet hospital (28 cats from Henan Province (China were collected. The sera (n = 47 were tested for immunoglobulin G (IgG antibodies against T. gondii by using modified agglutination test (MAT, whereas the hearts tissue (n = 40 were bioassayed in mice to isolate T. gondii strains. The genotype was distinguished by using PCR-RFLP of 10 loci (SAG1, SAG2, SAG3, GRA6, BTUB, L358, c22-8, PK1, c29-2, and Apico. The detection rate for the T. gondii antibody in captive felids was 21.3% (10/47. One viable T. gondii strain (TgCatCHn4 was obtained from a cat heart tissue, and its genotype was ToxoDB#9. The oocysts of ToxoDB#9 were collected from a T. gondii-free cat. The virulence of TgCatCHn4 was low and no cysts were detected in the brain of mice at 60 days post-inoculation. The finding of the present study suggested a widespread exposure of T. gondii for felids in Henan Province of central China, particularly those from the zoological gardens and homes. ToxoDB#9 was the predominant strain in China. Preventive measures against T. gondii oocyst contamination of various components of the environment should thus be implemented, including providing pre-frozen meat, well-cooked cat food, cleaned fruits and vegetables, monitoring birds and rodents, inactive T. gondii oocysts in felids feces, and proper hygiene.
Directory of Open Access Journals (Sweden)
Zhongheng Sun
2017-01-01
Full Text Available Volcanic activities exert a significant influence on pore fluid property and related diagenetic processes that substantially controlled reservoirs quality. Analysis of Paleogene medium-deep sandstones on the Huanghekou Sag provides insight into relating the diagenetic processes to pore fluid property evolution influenced by volcanic activities. Three distinct types of pore fluids were identified on the basis of an integrated and systematic analysis including core and thin section observation, XRD, SEM, CL, and trace element. Alkaline aqueous medium environment occurred in E2s1+2 where volcanic activities have insignificant influence on pore fluids, evidenced by typical alkaline diagenetic events such as K-feldspar albitization, quartz dissolution, feldspar dissolution, and carbonate cementation. During the deposition of E3d3, influx of terrestrial freshwater and alteration of ferromagnesian-rich pore water result in the formation of mixing aqueous medium environment through volcanic eruption dormancy causing zeolite dissolution, clay mineral transformation, and K-feldspar albitization. Ferromagnesian-rich aqueous medium environment developed resulting from the intensive hydrolysis of the unstable ferromagnesian minerals formed due to intense volcanic activities during E3d1+2 and corresponding predominant diagenetic processes were characterized by the precipitation and dissolution of low-silica zeolites. Therefore, the differential properties of pore fluids caused various diagenetic processes controlling reservoir quality.
Hesheng, Shi; Junzhang, Zhu; Huaning, Qiu; yu, Shu; Jianyao, Wu; Zulie, Long
Timing of oil or gas emplacements is a new subject in isotopic geochronology and petroleum geology. Hamilton et al. expounded the principle of the illite K-Ar age: Illite is often the last or one of the latest mineral cements to form prior to hydrocarbon accumulation. Since the displacement of formation water by hydrocarbons will cause silicate diagenesis to cease, K-Ar ages for illite will constrain the timing of this event, and also constrain the maximum age of formation of the trap structure. In this study, the possibility of authigenic illites 40Ar- 39Ar dating has been investigated. The illite samples were separated from the Tertiary sandstones in three rich oil reservoir belts within the Huizhou sag by cleaning, fracturing by cycled cooling-heating, soxhlet-extraction with solvents of benzene and methanol and separating with centrifugal machine. If oil is present in the separated samples, ionized organic fragments with m/e ratios of 36 to 40 covering the argon isotopes will be yielded by the ion source of a mass spectrometer, resulting in wrong argon isotopic analyses and wrong 40Ar- 39Ar ages. The preliminary experiments of illite by heating did show the presence of ionized organic fragments with m/e ratios of 36 to 44. In order to clean up the organic gases completely and obtain reliable analysis results, a special purification apparatus has been established by Qiu et al. and proved valid by the sequent illite analyses. All the illite samples by 40Ar- 39Ar IR-laser stepwise heating yield stair-up age spectra in lower laser steps and plateaux in higher laser steps. The youngest apparent ages corresponding to the beginning steps are reasonable to be interpreted for the hydrocarbon accumulation ages. The weighted mean ages of the illites from the Zhuhai and Zhujiang Formations are (12.1 ± 1.1) Ma and (9.9 ± 1.2) Ma, respectively. Therefore, the critical emplacement of petroleum accumulation in Zhujiang Formation in Huizhou sag took place in ca 10 Ma. Late
Pindell, J. L.; Graham, R.; Horn, B.
2013-05-01
Thick (up to 5 km), rapid (depression where basement had already subsided tectonically, and thus could receive up to 5 km of salt, roughly the isostatic maximum on exhumed mantle, hyper-thinned continent, or new ocean crust. ION-GXT and other seismic data along W Florida and NW Yucatán show that (1) mother salt was only 1 km thick in these areas, (2) that these areas were depositionally connected to areas of thicker deposition, and (3) the top of all salt was at global sea level, and hence the sub-salt unconformity along Florida and Yucatán was only 1 km deep by end of salt deposition. These observations fit the air-filled chasm hypothesis; however, two further observations make that mechanism highly improbable: (1) basinward limits of sub-salt unconformities along Florida/Yucatán are deeper than top of adjacent ocean crust emplaced at ~2.7 km subsea (shown by backstripping), and (2) deepest abyssal sediments over ocean crust onlap the top of distal salt, demonstrating that the salt itself was rapidly drowned after deposition. Study of global ION datasets demonstrates the process of "rapid outer marginal collapse" at most margins, which we believe is achieved by low-angle detachment on deep, landward-dipping, Moho-equivalent surfaces such that outer rifted margins are hanging walls of crustal scale half-grabens over mantle. The tectonic accommodation space produced (up to 3 km, < 3 Ma) can be filled by ~5 km of sag/salt sequences with little apparent hanging wall rifting. When salt (or other) deposition lags behind, or ends during, outer marginal collapse, deep-water settings result. We suggest that this newly identified, "outer marginal detachment phase", normally separates the traditional "rift" from "drift" stages during continental margin creation. Importantly, this 2-3 km of subsidence presently is neither treated as tectonic nor as thermal in traditional subsidence analysis; thus, Beta estimates may be excessive at many outer margins. Outer marginal
Cabrera, Gabriel; Burzyn, Dalia; Mundiñano, Juliana; Courreges, M. Cecilia; Camicia, Gabriela; Lorenzo, Daniela; Costa, Héctor; Ross, Susan R.; Nepomnaschy, Irene; Piazzon, Isabel
2008-01-01
Mouse mammary tumor virus (MMTV) is a milk-borne betaretrovirus that has developed strategies to exploit and subvert the host immune system. Here, we show in a natural model of MMTV infection that the virus causes early and progressive increases in superantigen (SAg)-specific Foxp3+ regulatory T cells (Treg) in Peyer's patches (PP). These increases were shown to be dependent on the presence of dendritic cells. CD4+ CD25+ T cells from the PP of infected mice preferentially suppress the proliferative response of T cells to SAg-expressing antigen-presenting cells ex vivo. We investigated the influence of the depletion of CD25+ cells at different stages of the infection. When CD25+ cells were depleted before MMTV infection, an increase in the number of PP SAg-cognate Foxp3− T cells was found at day 6 of infection. Since the SAg response is associated with viral amplification, the possibility exists that Treg cells attenuate the increase in viral load at the beginning of the infection. In contrast, depletion of CD25+ cells once the initial SAg response has developed caused a lower viral load, suggesting that at later stages Treg cells may favor viral persistence. Thus, our results indicated that Treg cells play an important and complex role during MMTV infection. PMID:18495774
International Nuclear Information System (INIS)
Lin, Ta-Wei; Liao, Yunn-Shiuan; Chen, Chi-Feng; Yang, Jauh-Jung
2008-01-01
A dual-directional light-control film with a high-sag and high-asymmetric-shape long gapless hexagonal microlens array fabricated by an ultra-violent (UV) imprinting process is presented. Such a lens array is designed by ray-tracing simulation and fabricated by a micro-replication process including gray-scale lithography, electroplating process and UV curing. The shape of the designed lens array is similar to that of a near half-cylindrical lens array with a periodical ripple. The measurement results of a prototype show that the incident lights using a collimated LED with the FWHM of dispersion angle, 12°, are diversified differently in short and long axes. The numerical and experimental results show that the FWHMs of the view angle for angular brightness in long and short axis directions through the long hexagonal lens are about 34.3° and 18.1° and 31° and 13°, respectively. Compared with the simulation result, the errors in long and short axes are about 5% and 16%, respectively. Obviously, the asymmetric gapless microlens array can realize the aim of the controlled asymmetric angular brightness. Such a light-control film can be used as a power saving screen compared with convention diffusing film for the application of a rear projection display
International Nuclear Information System (INIS)
Bursill, L.A.; Jiang, B.; Peng, J.L.; Zhong, W.L.; Zhang, P.L.
1997-01-01
High-Resolution Transmission Electron Microscopic studies of nanocrystaline particles of BaTiO 3 and PbTiO 3 are reported. There are characteristic differences observed for BaTiO 3 prepared using sol gel (SG) and steric acid gel (SAG) methods. The former exhibit a critical size below which there is no paraelectric/ferroelectric phase transition, whereas BaTiO 3 prepared via the SAG route remained cubic for all conditions. The SAG preparations always showed chemical intergrowth defects whereas the SG preparations were single phase. Atomic resolution images of both varieties showed interesting surface steps and surface relaxations/reconstructions of some facets. Nanocrystalline PbTiO 3 prepared by the SG route remains tetragonal, albeit with decreasing c/a ratio, down to 25nm diameter. HRTEM observations of nanocrystalline PbTiO 3 are also presented. X-ray diffraction, dielectric and Raman scattering measurements also demonstrate pronounced size effects. The relationship between the observed nanostructures and size effects on the physical properties is discussed. 6 refs., 1 tab., 6 figs
Dangoudoubiyam, S; Oliveira, J B; Víquez, C; Gómez-García, A; González, O; Romero, J J; Kwok, O C H; Dubey, J P; Howe, D K
2011-06-01
Serum samples from 315 horses from Costa Rica, Central America, were examined for the presence of antibodies against Sarcocystis neurona, Neospora spp., and Toxoplasma gondii by using the surface antigen (SAG) SnSAG2 enzyme-linked immunosorbent assay (ELISA), the NhSAG1 ELISA, and the modified agglutination test, respectively. Anti- S. neurona antibodies were found in 42.2% of the horses by using the SnSAG2 ELISA. Anti- Neospora spp. antibodies were found in only 3.5% of the horses by using the NhSAG1 ELISA, and only 1 of these horses was confirmed seropositive by Western blot. Antibodies to T. gondii were found in 34.0% of the horses tested, which is higher than in previous reports from North and South America. The finding of anti- S. neurona antibodies in horses from geographical areas where Didelphis marsupialis has wide distribution suggests that D. marsupialis is a potential definitive host for this parasite and a source of infection for these horses.
Directory of Open Access Journals (Sweden)
Arun Kumar Haldar
2010-05-01
Full Text Available The inability of sodium antimony gluconate (SAG-unresponsive kala-azar patients to clear Leishmania donovani (LD infection despite SAG therapy is partly due to an ill-defined immune-dysfunction. Since dendritic cells (DCs typically initiate anti-leishmanial immunity, a role for DCs in aberrant LD clearance was investigated. Accordingly, regulation of SAG-induced activation of murine DCs following infection with LD isolates exhibiting two distinct phenotypes such as antimony-resistant (Sb(RLD and antimony-sensitive (Sb(SLD was compared in vitro. Unlike Sb(SLD, infection of DCs with Sb(RLD induced more IL-10 production and inhibited SAG-induced secretion of proinflammatory cytokines, up-regulation of co-stimulatory molecules and leishmanicidal effects. Sb(RLD inhibited these effects of SAG by blocking activation of PI3K/AKT and NF-kappaB pathways. In contrast, Sb(SLD failed to block activation of SAG (20 microg/ml-induced PI3K/AKT pathway; which continued to stimulate NF-kappaB signaling, induce leishmanicidal effects and promote DC activation. Notably, prolonged incubation of DCs with Sb(SLD also inhibited SAG (20 microg/ml-induced activation of PI3K/AKT and NF-kappaB pathways and leishmanicidal effects, which was restored by increasing the dose of SAG to 40 microg/ml. In contrast, Sb(RLD inhibited these SAG-induced events regardless of duration of DC exposure to Sb(RLD or dose of SAG. Interestingly, the inhibitory effects of isogenic Sb(SLD expressing ATP-binding cassette (ABC transporter MRPA on SAG-induced leishmanicidal effects mimicked that of Sb(RLD to some extent, although antimony resistance in clinical LD isolates is known to be multifactorial. Furthermore, NF-kappaB was found to transcriptionally regulate expression of murine gammaglutamylcysteine synthetase heavy-chain (mgammaGCS(hc gene, presumably an important regulator of antimony resistance. Importantly, Sb(RLD but not Sb(SLD blocked SAG-induced mgammaGCS expression in DCs by
Directory of Open Access Journals (Sweden)
Yang Wei
2017-08-01
Full Text Available Due to the high exploration cost, limited number of wells for source rocks drilling and scarce test samples for the Total Organic Carbon Content (TOC in the Huizhou sag, the TOC prediction of source rocks in this area and the assessment of resource potentials of the basin are faced with great challenges. In the study of TOC prediction, predecessors usually adopted the logging assessment method, since the data is only confined to a “point” and the regional prediction of the source bed in the seismic profile largely depends on the recognition of seismic facies, making it difficult to quantify TOC. In this study, we combined source rock geological characteristics, logging and seismic response and built the mathematical relation between quasi TOC curve and seismic data based on the TOC logging date of a single well and its internal seismic attribute. The result suggested that it was not purely a linear relationship that was adhered to by predecessors, but was shown as a complicated non-linear relationship. Therefore, the neural network algorithm and SVMs were introduced to obtain the optimum relationship between the quasi TOC curve and the seismic attribute. Then the goal of TOC prediction can be realized with the method of seismic inversion.
Arias, M; Yeargan, M; Francisco, I; Dangoudoubiyam, S; Becerra, P; Francisco, R; Sánchez-Andrade, R; Paz-Silva, A; Howe, D K
2012-04-30
Horses serve as an intermediate host for several species of Sarcocystis, all of which utilize canids as the definitive host. Sarcocystis spp. infection and formation of latent sarcocysts in horses often appears to be subclinical, but morbidity can occur, especially when the parasite burden is large. A serological survey was conducted to determine the presence of antibodies against Sarcocystis spp. in seemingly healthy horses from the Galicia region of Spain. Western blot analyses using Sarcocystis neurona merozoites as heterologous antigen suggested greater than 80% seroprevalance of Sarcocystis spp. in a sample set of 138 horses. The serum samples were further tested with enzyme-linked immunosorbent assays (ELISAs) based on recombinant S. neurona-specific surface antigens (rSnSAGs). As expected for horses from the Eastern Hemisphere, less than 4% of the serum samples were positive when analyzed with either the rSnSAG2 or the rSnSAG4/3 ELISAs. An additional 246 horses were tested using the rSnSAG2 ELISA, which revealed that less than 3% of the 384 samples were seropositive. Collectively, the results of this serologic study suggested that a large proportion of horses from this region of Spain are exposed to Sarcocystis spp. Furthermore, the anti-Sarcocystis seroreactivity in these European horses could be clearly distinguished from anti-S. neurona antibodies using the rSnSAG2 and rSnSAG4/3 ELISAs. Copyright © 2011 Elsevier B.V. All rights reserved.
2013-01-01
Background The Streptococcus Anginosus Group (SAG) represents three closely related species of the viridans group streptococci recognized as commensal bacteria of the oral, gastrointestinal and urogenital tracts. The SAG also cause severe invasive infections, and are pathogens during cystic fibrosis (CF) pulmonary exacerbation. Little genomic information or description of virulence mechanisms is currently available for SAG. We conducted intra and inter species whole-genome comparative analyses with 59 publically available Streptococcus genomes and seven in-house closed high quality finished SAG genomes; S. constellatus (3), S. intermedius (2), and S. anginosus (2). For each SAG species, we sequenced at least one numerically dominant strain from CF airways recovered during acute exacerbation and an invasive, non-lung isolate. We also evaluated microevolution that occurred within two isolates that were cultured from one individual one year apart. Results The SAG genomes were most closely related to S. gordonii and S. sanguinis, based on shared orthologs and harbor a similar number of proteins within each COG category as other Streptococcus species. Numerous characterized streptococcus virulence factor homologs were identified within the SAG genomes including; adherence, invasion, spreading factors, LPxTG cell wall proteins, and two component histidine kinases known to be involved in virulence gene regulation. Mobile elements, primarily integrative conjugative elements and bacteriophage, account for greater than 10% of the SAG genomes. S. anginosus was the most variable species sequenced in this study, yielding both the smallest and the largest SAG genomes containing multiple genomic rearrangements, insertions and deletions. In contrast, within the S. constellatus and S. intermedius species, there was extensive continuous synteny, with only slight differences in genome size between strains. Within S. constellatus we were able to determine important SNPs and changes in
International Nuclear Information System (INIS)
Xu Hong; Cai Qianzhong; Sun Heqing; Guo Zhenxuan; Yan Guijing; Dai Jing; Liu Dongying
2008-01-01
Fission track data of different geologic epoches from Binhai salient, Yancheng sag, Haian sag, Baiju sag, Gaoyou sag, Hongze sag and Jinhu sag of northern Jiangsu basin and seismic data from Laoshan uplift in South Yellow Sea basin and evolution of Paleozoic hydrocarbon resource-rocks headed in the Northern Jiangsu-South Yellow Sea basin were studied. Results indicate that Binhai salient uplifted in 38-15 Ma, forming 'structure uplifting model', Paleozoic hydrocarbon resource-rocks have the appearance of 'different layers but identical mature, different layers but identical temperature' with Laoshan uplift. All sags have the characters of 'long time heating model', and sedimentations in Cenozoic were exploited by 2 km. Mesozoic-Paleozoic hydrocarbon resource- rocks of Laoshan uplift get ahead of 10 km. Structure evolution was compared with Binhai salient. According to the modeling results of secondary hydrocarbon generation, Mesozoic-Paleozoic hydrocarbon resource-rocks of Laoshan uplift have the good reservoir potentiality and probably become an important new window for sea oil and gas exploration. (authors)
Directory of Open Access Journals (Sweden)
Rowshanfarzad P
2015-11-01
Full Text Available Pejman Rowshanfarzad,1 Peter Häring,2 Hans L Riis,3 Sune J Zimmermann,3 Martin A Ebert1,4 1School of Physics, The University of Western Australia, Crawley, WA, Australia; 2German Cancer Research Center (DKFZ, Medical Physics in Radiation Oncology, Heidelberg, Germany; 3Radiofysisk Laboratorium, Odense University Hospital, Odense C, Denmark; 4Department of Radiation Oncology, Sir Charles Gairdner Hospital, Nedlands, WA, Australia Background: In radiotherapy treatments, it is crucial to monitor the performance of linac components including gantry, collimation system, and electronic portal imaging device (EPID during arc deliveries. In this study, a simple EPID-based measurement method is suggested in conjunction with an algorithm to investigate the stability of these systems at various gantry angles with the aim of evaluating machine-related errors in treatments. Methods: The EPID sag, gantry sag, changes in source-to-detector distance (SDD, EPID and collimator skewness, EPID tilt, and the sag in leaf bank assembly due to linac rotation were separately investigated by acquisition of 37 EPID images of a simple phantom with five ball bearings at various gantry angles. A fast and robust software package was developed for automated analysis of image data. Three Siemens linacs were investigated. Results: The average EPID sag was within 1 mm for all tested linacs. Two machines showed >1 mm gantry sag. Changes in the SDD values were within 7.5 mm. EPID skewness and tilt values were <1° in all machines. The maximum sag in leaf bank assembly was <1 mm. Conclusion: The method and software developed in this study provide a simple tool for effective investigation of the behavior of Siemens linac components with gantry rotation. Such a comprehensive study has been performed for the first time on Siemens machines. Keywords: linac, Siemens, arc, sag, EPID, gantry
3D Power Line Extraction from Multiple Aerial Images
Directory of Open Access Journals (Sweden)
Jaehong Oh
2017-09-01
Full Text Available Power lines are cables that carry electrical power from a power plant to an electrical substation. They must be connected between the tower structures in such a way that ensures minimum tension and sufficient clearance from the ground. Power lines can stretch and sag with the changing weather, eventually exceeding the planned tolerances. The excessive sags can then cause serious accidents, while hindering the durability of the power lines. We used photogrammetric techniques with a low-cost drone to achieve efficient 3D mapping of power lines that are often difficult to approach. Unlike the conventional image-to-object space approach, we used the object-to-image space approach using cubic grid points. We processed four strips of aerial images to automatically extract the power line points in the object space. Experimental results showed that the approach could successfully extract the positions of the power line points for power line generation and sag measurement with the elevation accuracy of a few centimeters.
Self-assessment and goal-setting is associated with an improvement in interviewing skills.
Hanley, Kathleen; Zabar, Sondra; Charap, Joseph; Nicholson, Joseph; Disney, Lindsey; Kalet, Adina; Gillespie, Colleen
2014-01-01
Describe the relationship between medical students' self-assessment and goal-setting (SAGS) skills and development of interviewing skills during the first-year doctoring course. 157 first-year medical students completed three two-case standardized patient (SP) interviews. After each of the first two, students viewed videotapes of their interview, completed a SAGS worksheet, and reviewed a selected tape segment in a seminar. SAGS was categorized into good and poor quality and interviewing skills were rated by trained raters. SAGS improved over time (37% good week 1 vs. 61% good week 10). Baseline SAGS and interviewing skills were not associated. Initial SAGS quality was associated with change in interviewing skills - those with poor-quality SAGS demonstrated a decrease and those with good-quality SAGS demonstrated an increase in scores by 17 weeks (ANOVA F=4.16, p=0.024). For students whose SAGS skills were good at both week 1 and 10, interviewing skills declined in weeks 1-10 and then increased significantly at week 17. For those whose SAGS remained 'poor' in weeks 1-10, interviewing skills declined in weeks 10-17. In general, the quality of students' SAGS improved over time. Poor baseline SAGS skills and failure to improve were associated with a decrease in interviewing skills at 17 weeks. For students with better SAGS, interviewing skills increased at week 17. Improvement in SAGS skills was not associated with improved interviewing skills. Understanding structured self-assessment skills helps identify student characteristics that influence progressive mastery of communication skills and therefore may inform curriculum and remediation tailoring.
Directory of Open Access Journals (Sweden)
Xiang Zeng
2018-05-01
Full Text Available Types of organic matter and mineral associations and microstructures of shales can reflect the depositional mechanism and sedimentary environment. Therefore, analysis of organic matter and mineral associations is a prerequisite for research on fine-grained sedimentary rocks. Shales from the Eocene Shahejie Formation in the Dongying Sag of China were selected to classify their lithofacies and to investigate the characteristics of their organic matter and mineral associations. This analysis identified six lithofacies (e.g., laminated shales and massive mudstones; in all the lithofacies, clay minerals exhibit a positive correlation with detrital minerals, thus indicating that they were derived from the same source. The comprehensive analysis of mineral and organic matter associations reveals that detrital minerals were deposited with low-hydrogen index (HI OM. The deposition of detrital minerals was mainly a physical process. Clay minerals can undergo deposition in one of two ways due to their surface charge: they can either aggregate with high-HI OM via chemical deposition, thus forming organic-rich laminae, or they can be deposited together with low-HI OM via physical deposition, thus forming clay-rich laminae or a massive matrix. Carbonate minerals, which often coexist with high-HI OM, are biological sediments. The analysis of the sedimentary characteristics of these organic matter and mineral associations indicates that the sedimentary processes differ between various lithofacies: e.g., the discontinuous laminated shale represents the product of biophysical processes. Differences in depositional mechanisms are also present in each sub-member. Therefore, it is important to analyze the properties of minerals and organic matter, as well as their associations, to more deeply understand the classification of lithofacies and the depositional processes of shales and mudstones.
Herrmann, Daland C; Maksimov, Pavlo; Hotop, Andrea; Groß, Uwe; Däubener, Walter; Liesenfeld, Oliver; Pleyer, Uwe; Conraths, Franz J; Schares, Gereon
2014-10-01
Toxoplasmosis is an important zoonosis transmitted from animals to humans world-wide. In order to determine Toxoplasma gondii genotypes in individuals living in Germany and to compare findings with those in animals, we analysed nine independent and unlinked genetic markers (nSAG2, SAG3, BTUB, GRA6, c22-8, c29-2, L358, PK1 and Apico) by PCR-RFLP in 83 archived T. gondii-positive DNA samples from patients with ocular toxoplasmosis (n=35), toxoplasmic encephalitis (n=32), systemic toxoplasmosis after bone-marrow transplantation (n=15) and congenital toxoplasmosis (n=1). In 46 of these 83 samples the presence of T. gondii DNA was confirmed by conventional end-point PCR. Among these, 17 T. gondii-positive samples were typed at all nine loci. The majority (15/17, 88.2%) of these samples were of T. gondii type II (i.e., including both, the Apico type II and Apico type I variants). In addition, in one sample a T. gondii type II/type III allele combination and in another sample a T. gondii genotype displaying type III alleles at all markers was observed. In the remaining 11 samples, in which T. gondii could only be partially typed, exclusively type II (n=10) or type III (n=1) alleles were observed. Results of the present study suggest that the majority of patients in Germany are infected with type II T. gondii regardless of the clinical manifestation of toxoplasmosis. This finding is in accord with the predominance of type II T. gondii in oocysts isolated from cats and in tissues of other intermediate hosts in Germany. Copyright © 2014 Elsevier GmbH. All rights reserved.
Self-assessment and goal-setting is associated with an improvement in interviewing skills
Directory of Open Access Journals (Sweden)
Kathleen Hanley
2014-07-01
Full Text Available Purpose: Describe the relationship between medical students’ self-assessment and goal-setting (SAGS skills and development of interviewing skills during the first-year doctoring course. Method: 157 first-year medical students completed three two-case standardized patient (SP interviews. After each of the first two, students viewed videotapes of their interview, completed a SAGS worksheet, and reviewed a selected tape segment in a seminar. SAGS was categorized into good and poor quality and interviewing skills were rated by trained raters. Results: SAGS improved over time (37% good week 1 vs. 61% good week 10. Baseline SAGS and interviewing skills were not associated. Initial SAGS quality was associated with change in interviewing skills – those with poor-quality SAGS demonstrated a decrease and those with good-quality SAGS demonstrated an increase in scores by 17 weeks (ANOVA F=4.16, p=0.024. For students whose SAGS skills were good at both week 1 and 10, interviewing skills declined in weeks 1–10 and then increased significantly at week 17. For those whose SAGS remained ‘poor’ in weeks 1–10, interviewing skills declined in weeks 10–17. Conclusions: In general, the quality of students’ SAGS improved over time. Poor baseline SAGS skills and failure to improve were associated with a decrease in interviewing skills at 17 weeks. For students with better SAGS, interviewing skills increased at week 17. Improvement in SAGS skills was not associated with improved interviewing skills. Understanding structured self-assessment skills helps identify student characteristics that influence progressive mastery of communication skills and therefore may inform curriculum and remediation tailoring.
Allam, Eman; Ghoneima, Ahmed; Tholpady, Sunil S; Kula, Katherine
2018-06-19
The aim of this study was to determine whether molar incisor hypomineralization (MIH) is greater in patients with cleft lip and palate (CLP) who underwent primary alveolar grafting (PAG) as compared with CLP waiting for secondary alveolar grafting (SAG) and with controls. A retrospective analysis of intraoral photographs of 13 CLP patients who underwent a PAG, 28 CLP prior to SAG, and 60 controls without CLP was performed. Mantel-Haenszel χ tests were used to compare the 3 groups for differences in MIH scores, and Wilcoxon rank sum tests were used to compare the groups for differences in average MIH scores. A 5% significance level was used for all tests. Molar incisor hypomineralization scores were significantly higher for the PAG and SAG groups compared with the control group (P MIH (P = 0.016) compared with the SAG group. Molar incisor hypomineralization average scores were significantly higher for the 2 graft groups compared with the controls (P MIH score and average MIH score for incisors compared with the SAG group (P = 0.03). Cleft lip and palate patients have significantly greater MIH compared with controls, and CLP patients with PAGs have significantly greater MIH in the incisor region compared with CLP patients with SAGs, indicating that subjects with PAGs have more severely affected dentition.
Directory of Open Access Journals (Sweden)
Jinhua Dong
Full Text Available Neosporosis, caused by an intracellular parasite, Neospora caninum, is an infectious disease primarily of cattle and dogs. It occurs worldwide and causes huge damages to dairy farms. In this study, we immunized mice with recombinant surface-associated protein 1 of N. caninum (rNcSAG1 and developed two novel monoclonal antibodies, A10 and H3, against NcSAG1 using phage-display technology. Both clones bound to purified rNcSAG1 and the half maximal inhibitory concentrations of A10 and H3 are 50 and 72 nM of rNcSAG1, respectively. In immunofluorescence assays, both A10 and H3 Fabs bound to N. caninum parasites. Direct detection of N. caninum parasites was developed firstly using an enzyme-linked immunosorbent assay (ELISA with A10 and H3. Binding of A10 and H3 antibodies to rNcSAG1 was also inhibited by some certain anti-N. caninum antibodies in the neosporosis-positive cattle sera, suggesting they might bind to the same epitopes of NcSAG1 with those anti-N. caninum antibodies of bovine. These antibodies were demonstrated to have a potential for monitoring the N. caninum parasites in a dairy farm, which may lead to protect livestock from parasite-infection.
Directory of Open Access Journals (Sweden)
Juan Patiño-Martinez
2010-09-01
Full Text Available La emergencia de las crías de tortuga laúd eclosionadas en los nidos profundos desde la arena hasta la superficie de la playa ocurre sin ayuda parental y es el primer gran desafío de supervivencia en su ciclo de vida. Este estudio, desarrollado en la costa Caribe colombiana, describe el comportamiento social de emergencia de neonatos y evalúa el efecto de la traslocación de los nidos en los patrones temporales de emergencia. Se propone por primera vez que el espacio liberado por la deshidratación de falsos huevos (SAGs en la nidada, representa una ventaja reproductiva al facilitar el agrupamiento de los neonatos en un espacio muy limitado y favorecer la sincronía de la emergencia. El tiempo medio registrado para la emergencia en grupo fue de 3.3 días, variando entre uno y seis días. La traslocación de los nidos no afectó el patrón temporal de emergencia que fue predominantemente nocturno (77.77% en nidos naturales y 81.65% en trasladados. Los picos máximos de emergencias a la superficie coincidieron con los periodos de menor temperatura ambiental exterior (22:00h-06:00h. La ventaja selectiva de este patrón temporal y de la emergencia sincrónica está probablemente relacionada con las mayores tasas de depredación y mortalidad por hipertermia observadas durante el día.
Gaji, Rajshekhar Y; Howe, Daniel K
2009-07-01
The apicomplexan parasite Sarcocystis neurona undergoes a complex process of intracellular development, during which many genes are temporally regulated. The described study was undertaken to begin identifying the basic promoter elements that control gene expression in S. neurona. Sequence analysis of the 5'-flanking region of five S. neurona genes revealed a conserved heptanucleotide motif GAGACGC that is similar to the WGAGACG motif described upstream of multiple genes in Toxoplasma gondii. The promoter region for the major surface antigen gene SnSAG1, which contains three heptanucleotide motifs within 135 bases of the transcription start site, was dissected by functional analysis using a dual luciferase reporter assay. These analyses revealed that a minimal promoter fragment containing all three motifs was sufficient to drive reporter molecule expression, with the presence and orientation of the 5'-most heptanucleotide motif being absolutely critical for promoter function. Further studies should help to identify additional sequence elements important for promoter function and for controlling gene expression during intracellular development by this apicomplexan pathogen.
Semantic acquisition games harnessing manpower for creating semantics
Šimko, Jakub
2014-01-01
A comprehensive and extensive review of state-of-the-art in semantics acquisition game (SAG) design A set of design patterns for SAG designers A set of case studies (real SAG projects) demonstrating the use of SAG design patterns
Hirata, Ricardo; Gesicki, Ana; Sracek, Ondra; Bertolo, Reginaldo; Giannini, Paulo César; Aravena, Ramón
2011-04-01
This paper presents the results of a new investigation of the Guarani Aquifer System (SAG) in São Paulo state. New data were acquired about sedimentary framework, flow pattern, and hydrogeochemistry. The flow direction in the north of the state is towards the southwest and not towards the west as expected previously. This is linked to the absence of SAG outcrop in the northeast of São Paulo state. Both the underlying Pirambóia Formation and the overlying Botucatu Formation possess high porosity (18.9% and 19.5%, respectively), which was not modified significantly by diagenetic changes. Investigation of sediments confirmed a zone of chalcedony cement close to the SAG outcrop and a zone of calcite cement in the deep confined zone. The main events in the SAG post-sedimentary history were: (1) adhesion of ferrugineous coatings on grains, (2) infiltration of clays in eodiagenetic stage, (3) regeneration of coatings with formation of smectites, (4) authigenic overgrowth of quartz and K-feldspar in advanced eodiagenetic stage, (5) bitumen cementation of Pirambóia Formation in mesodiagenetic stage, (6) cementation by calcite in mesodiagenetic and telodiagenetic stages in Pirambóia Formation, (7) formation of secondary porosity by dissolution of unstable minerals after appearance of hydraulic gradient and penetration of the meteoric water caused by the uplift of the Serra do Mar coastal range in the Late Cretaceous, (8) authigenesis of kaolinite and amorphous silica in unconfined zone of the SAG and cation exchange coupled with the dissolution of calcite at the transition between unconfined and confined zone, and (9) authigenesis of analcime in the confined SAG zone. The last two processes are still under operation. The deep zone of the SAG comprises an alkaline pH, Na-HCO 3 groundwater type with old water and enriched δ 13C values (-18.8) close to the SAG outcrop. This is consistent with a conceptual geochemical model of the SAG, suggesting dissolution of calcite
Salgado-Pabón, Wilmara; Breshears, Laura; Spaulding, Adam R.; Merriman, Joseph A.; Stach, Christopher S.; Horswill, Alexander R.; Peterson, Marnie L.; Schlievert, Patrick M.
2013-01-01
ABSTRACT Infective endocarditis and kidney infections are serious complications of Staphylococcus aureus sepsis. We investigated the role of superantigens (SAgs) in the development of lethal sepsis, infective endocarditis, and kidney infections. SAgs cause toxic shock syndrome, but it is unclear if SAgs contribute to infective endocarditis and kidney infections secondary to sepsis. We show in the methicillin-resistant S. aureus strain MW2 that lethal sepsis, infective endocarditis, and kidney infections in rabbits are critically dependent on high-level SAgs. In contrast, the isogenic strain lacking staphylococcal enterotoxin C (SEC), the major SAg in this strain, is attenuated in virulence, while complementation restores disease production. SAgs’ role in infective endocarditis appears to be both superantigenicity and direct endothelial cell stimulation. Maintenance of elevated blood pressure by fluid therapy significantly protects from infective endocarditis, possibly through preventing bacterial accumulation on valves and increased SAg elimination. These data should facilitate better methods to manage these serious illnesses. PMID:23963178
Liu, Tingqi; Huang, Jingwei; Li, Yanlin; Ehsan, Muhammad; Wang, Shuai; Zhou, Zhouyang; Song, Xiaokai; Yan, Ruofeng; Xu, Lixin; Li, Xiangrui
2018-05-30
Coccidiosis is recognised as a major parasitic disease in chickens. Eimeria maxima is considered as a highly immunoprotective species within the Eimeria spp. family that infects chickens. In the present research, the surface antigen gene of E. maxima (EmSAG) was cloned, and the ability of EmSAG to stimulate protection against E. maxima was evaluated. Prokaryotic and eukaryotic plasmids expressing EmSAG were constructed. The EmSAG transcription and expression in vivo was performed based on the RT-PCR and immunoblot analysis. The expression of EmSAG in sporozoites and merozoites was detected through immunofluorescence analyses. The immune protection was assessed based on challenge experiments. Flow cytometry assays were used to determine the T cell subpopulations. The serum antibody and cytokine levels were evaluated by ELISA. The open reading frame (ORF) of EmSAG gene contained 645 bp encoding 214 amino acid residues. The immunoblot and RT-PCR analyses indicated that the EmSAG gene were transcribed and expressed in vivo. The EmSAG proteins were expressed in sporozoite and merozoite stages of E. maxima by the immunofluorescence assay. Challenge experiments showed that both pVAX1-SAG and the recombinant EmSAG (rEmSAG) proteins were successful in alleviating jejunal lesions, decreasing loss of body weight and the oocyst ratio. Additionally, these experiments possessed anticoccidial indices (ACI) of more than 170. Higher percentages of CD4 + and CD8 + T cells were detected in both EmSAG-inoculated birds than those of the negative control groups (P maxima.
Crustal structure of an exhumed IntraCONtinental Sag (ICONS): the Mekele Basin in Northern Ethiopia.
Alemu, T. B.; Abdelsalam, M. G.
2017-12-01
The Mekele Sedimentary Basin (MSB) in Ethiopia is a Paleozoic-Mesozoic IntraCONtinental Sag (ICONS) exposed due to Cenozoic domal and rift flank uplift associated with the Afar mantle plume and Afar Depression (AD). ICONS are formed over stable lithosphere, and in contrast to rift and foreland basins, show circular-elliptical shape in map view, saucer shaped in cross section, and concentric gravity minima. Surface geological features of the MSB have been shown to exhibit geologic characteristics similar to those of other ICONS. We used the World Gravity Map (WGM 2012) data to investigate subsurface-crustal structure of the MSB. We also used 2D power spectrum analysis and inversion of the gravity field to estimate the Moho depth. Our results show the Bouguer anomalies of the WGM 2012 ranges between 130 mGal and - 110 mGal with the highest values within the AD. Despite the effect of the AD on the gravity anomalies, the MSB is characterized by the presence of gravity low anomaly that reaches in places -110 mGal, especially in its western part. The Moho depth estimates, from both spectral analysis and inversion of the gravity data, is between 36 and 40 km depth over most of the western and southern margins of the MSB. However, as the AD is approached, in the eastern margins of the MSB, crustal thickness estimates are highly affected by the anomalously thin and magmatic segment of the AD, and the Moho depth range between 30 and 25 km. Our results are consistent with that of seismic studies in areas far from the MSB, but within the Northwestern Ethiopian Plateau where the MSB is located. Those studies have reported an abrupt decrease in Moho depth from 40 km beneath the Northwestern plateau, to 20 km in the adjacent AD. Though the MSB is small (100 kmX100 km) compared to other ICONS, and affected by the neighboring AD, it is characterized by elliptical gravity minima and a relatively thicker crust that gradually thickens away from the rift. In addition, seismic imaging
The irradiation influence on the properties of silver sulfide (Ag2S) colloidal nanoparticles
Rempel, S. V.; Kuznetsova, Yu. V.; Gerasimov, E. Yu.; Rempel', A. A.
2017-08-01
The aqueous solutions of different stability containing silver sulfide (Ag2S) nanoparticles are studied. The stable, transparent, and turbid solutions have been subjected to daylight for 7 months, to ultraviolet and laser irradiation, as well as to an electron beam. Solar radiation is found to favor the Ag2S reduction to Ag and/or the formation of Ag2S/Ag hybrid nanoparticles in the solution. At a high amount of hybrid nanoparticles, the exciton-plasmon interaction causes asymmetry in the absorption spectra. The exposure of Ag2S particles precipitated from the solution with the electron beam leads to the reversible growth of Ag threads. The possible exciton-plasmon interplay mechanisms in Ag2S/Ag hybrid nanoparticles are considered. The physical mechanisms of the changing Ag2S stoichiometry, the formation of metallic Ag and Ag2S/Ag hybrid nanoparticles are the generation of hot carriers and the energy transfer (exciton-plasmon interaction) in a metal-semiconductor hybrid nanosystem are elucidated, as well.
Directory of Open Access Journals (Sweden)
Christopher R Shaler
2017-06-01
develop a molecular signature consistent with exhaustion and failure to participate in antimicrobial defense. Accordingly, they upregulate lymphocyte-activation gene 3 (LAG-3, T cell immunoglobulin and mucin-3 (TIM-3, and/or programmed cell death-1 (PD-1, and acquire an anergic phenotype that interferes with their cognate function against Klebsiella pneumoniae and Escherichia coli; vi MAIT cell hyperactivation and anergy co-utilize a signaling pathway that is governed by p38 and MEK1/2. Collectively, our findings demonstrate a pathogenic, rather than protective, role for MAIT cells during infection. Furthermore, we propose a novel mechanism of SAg-associated immunosuppression in humans. MAIT cells may therefore provide an attractive therapeutic target for the management of both early and late phases of severe SAg-mediated illnesses.
MPD model for radar echo signal of hypersonic targets
Directory of Open Access Journals (Sweden)
Xu Xuefei
2014-08-01
Full Text Available The stop-and-go (SAG model is typically used for echo signal received by the radar using linear frequency modulation pulse compression. In this study, the authors demonstrate that this model is not applicable to hypersonic targets. Instead of SAG model, they present a more realistic echo signal model (moving-in-pulse duration (MPD for hypersonic targets. Following that, they evaluate the performances of pulse compression under the SAG and MPD models by theoretical analysis and simulations. They found that the pulse compression gain has an increase of 3 dB by using the MPD model compared with the SAG model in typical cases.
Publications - GMC 164 | Alaska Division of Geological & Geophysical
Staines St. 10-09-23, Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 , Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 (Orion #1), OCS Y-0334
Hoane, Jessica S; Morrow, Jennifer K; Saville, William J; Dubey, J P; Granstrom, David E; Howe, Daniel K
2005-09-01
Sarcocystis neurona is the primary causative agent of equine protozoal myeloencephalitis (EPM), a common neurologic disease of horses in the Americas. We have developed a set of enzyme-linked immunosorbent assays (ELISAs) based on the four major surface antigens of S. neurona (SnSAGs) to analyze the equine antibody response to S. neurona. The SnSAG ELISAs were optimized and standardized with a sample set of 36 equine sera that had been characterized by Western blotting against total S. neurona parasite antigen, the current gold standard for S. neurona serology. The recombinant SnSAG2 (rSnSAG2) ELISA showed the highest sensitivity and specificity at 95.5% and 92.9%, respectively. In contrast, only 68.2% sensitivity and 71.4% specificity were achieved with the rSnSAG1 ELISA, indicating that this antigen may not be a reliable serological marker for analyzing antibodies against S. neurona in horses. Importantly, the ELISA antigens did not show cross-reactivity with antisera to Sarcocystis fayeri or Neospora hughesi, two other equine parasites. The accuracy and reliability exhibited by the SnSAG ELISAs suggest that these assays will be valuable tools for examining the equine immune response against S. neurona infection, which may help in understanding the pathobiology of this accidental parasite-host interaction. Moreover, with modification and further investigation, the SnSAG ELISAs have potential for use as immunodiagnostic tests to aid in the identification of horses affected by EPM.
Hoane, Jessica S.; Morrow, Jennifer K.; Saville, William J.; Dubey, J. P.; Granstrom, David E.; Howe, Daniel K.
2005-01-01
Sarcocystis neurona is the primary causative agent of equine protozoal myeloencephalitis (EPM), a common neurologic disease of horses in the Americas. We have developed a set of enzyme-linked immunosorbent assays (ELISAs) based on the four major surface antigens of S. neurona (SnSAGs) to analyze the equine antibody response to S. neurona. The SnSAG ELISAs were optimized and standardized with a sample set of 36 equine sera that had been characterized by Western blotting against total S. neurona parasite antigen, the current gold standard for S. neurona serology. The recombinant SnSAG2 (rSnSAG2) ELISA showed the highest sensitivity and specificity at 95.5% and 92.9%, respectively. In contrast, only 68.2% sensitivity and 71.4% specificity were achieved with the rSnSAG1 ELISA, indicating that this antigen may not be a reliable serological marker for analyzing antibodies against S. neurona in horses. Importantly, the ELISA antigens did not show cross-reactivity with antisera to Sarcocystis fayeri or Neospora hughesi, two other equine parasites. The accuracy and reliability exhibited by the SnSAG ELISAs suggest that these assays will be valuable tools for examining the equine immune response against S. neurona infection, which may help in understanding the pathobiology of this accidental parasite-host interaction. Moreover, with modification and further investigation, the SnSAG ELISAs have potential for use as immunodiagnostic tests to aid in the identification of horses affected by EPM. PMID:16148170
Zhou, Kaixin; Xie, Lianyan; Han, Lizhong; Guo, Xiaokui; Wang, Yong; Sun, Jingyong
2017-01-01
ICE Sag37 , a novel integrative and conjugative element carrying multidrug resistance and potential virulence factors, was characterized in a clinical isolate of Streptococcus agalactiae . Two clinical strains of S. agalactiae , Sag37 and Sag158, were isolated from blood samples of new-borns with bacteremia. Sag37 was highly resistant to erythromycin and tetracycline, and susceptible to levofloxacin and penicillin, while Sag158 was resistant to tetracycline and levofloxacin, and susceptible to erythromycin. Transfer experiments were performed and selection was carried out with suitable antibiotic concentrations. Through mating experiments, the erythromycin resistance gene was found to be transferable from Sag37 to Sag158. Sma I-PFGE revealed a new Sma I fragment, confirming the transfer of the fragment containing the erythromycin resistance gene. Whole genome sequencing and sequence analysis revealed a mobile element, ICE Sag37 , which was characterized using several molecular methods and in silico analyses. ICE Sag37 was excised to generate a covalent circular intermediate, which was transferable to S. agalactiae . Inverse PCR was performed to detect the circular form. A serine family integrase mediated its chromosomal integration into rumA , which is a known hotspot for the integration of streptococcal ICEs. The integration site was confirmed using PCR. ICE Sag37 carried genes for resistance to multiple antibiotics, including erythromycin [ erm(B) ], tetracycline [ tet(O) ], and aminoglycosides [ aadE, aphA , and ant(6) ]. Potential virulence factors, including a two-component signal transduction system ( nisK/nisR ), were also observed in ICE Sag37 . S1-PFGE analysis ruled out the existence of plasmids. ICE Sag37 is the first ICE Sa2603 family-like element identified in S. agalactiae carrying both resistance and potential virulence determinants. It might act as a vehicle for the dissemination of multidrug resistance and pathogenicity among S. agalactiae .
Hartwell, Brittany L; Pickens, Chad J; Leon, Martin; Berkland, Cory
2017-06-12
A pressing need exists for antigen-specific immunotherapies (ASIT) that induce selective tolerance in autoimmune disease while avoiding deleterious global immunosuppression. Multivalent soluble antigen arrays (SAgA PLP:LABL ), consisting of a hyaluronic acid (HA) linear polymer backbone cografted with multiple copies of autoantigen (PLP) and cell adhesion inhibitor (LABL) peptides, are designed to induce tolerance to a specific multiple sclerosis (MS) autoantigen. Previous studies established that hydrolyzable SAgA PLP:LABL , employing a degradable linker to codeliver PLP and LABL, was therapeutic in experimental autoimmune encephalomyelitis (EAE) in vivo and exhibited antigen-specific binding with B cells, targeted the B cell receptor (BCR), and dampened BCR-mediated signaling in vitro. Our results pointed to sustained BCR engagement as the SAgA PLP:LABL therapeutic mechanism, so we developed a new version of the SAgA molecule using nonhydrolyzable conjugation chemistry, hypothesizing it would enhance and maintain the molecule's action at the cell surface to improve efficacy. "Click SAgA" (cSAgA PLP:LABL ) uses hydrolytically stable covalent conjugation chemistry (Copper-catalyzed Azide-Alkyne Cycloaddition (CuAAC)) rather than a hydrolyzable oxime bond to attach PLP and LABL to HA. We explored cSAgA PLP:LABL B cell engagement and modulation of BCR-mediated signaling in vitro through flow cytometry binding and calcium flux signaling assays. Indeed, cSAgA PLP:LABL exhibited higher avidity B cell binding and greater dampening of BCR-mediated signaling than hydrolyzable SAgA PLP:LABL . Furthermore, cSAgA PLP:LABL exhibited significantly enhanced in vivo efficacy compared to hydrolyzable SAgA PLP:LABL , achieving equivalent efficacy at one-quarter of the dose. These results indicate that nonhydrolyzable conjugation increased the avidity of cSAgA PLP:LABL to drive in vivo efficacy through modulated BCR-mediated signaling.
Manipulation of Innate and Adaptive Immunity by Staphylococcal Superantigens
Directory of Open Access Journals (Sweden)
Stephen W. Tuffs
2018-05-01
Full Text Available Staphylococcal superantigens (SAgs constitute a family of potent exotoxins secreted by Staphylococcus aureus and other select staphylococcal species. SAgs function to cross-link major histocompatibility complex (MHC class II molecules with T cell receptors (TCRs to stimulate the uncontrolled activation of T lymphocytes, potentially leading to severe human illnesses such as toxic shock syndrome. The ubiquity of SAgs in clinical S. aureus isolates suggests that they likely make an important contribution to the evolutionary fitness of S. aureus. Although the apparent redundancy of SAgs in S. aureus has not been explained, the high level of sequence diversity within this toxin family may allow for SAgs to recognize an assorted range of TCR and MHC class II molecules, as well as aid in the avoidance of humoral immunity. Herein, we outline the major diseases associated with the staphylococcal SAgs and how a dysregulated immune system may contribute to pathology. We then highlight recent research that considers the importance of SAgs in the pathogenesis of S. aureus infections, demonstrating that SAgs are more than simply an immunological diversion. We suggest that SAgs can act as targeted modulators that drive the immune response away from an effective response, and thus aid in S. aureus persistence.
Surface structures and dielectric response of ultrafine BaTiO3 particles
International Nuclear Information System (INIS)
Jiang, B.; Peng, J.L.; Bursill, L.A.
1998-01-01
Characteristic differences are observed for the dielectric response and microstructures of BaTiO 3 nanoscale fine powders prepared using sol gel (SG) and steric acid gel (SAG) methods. The former exhibit a critical size below which there is no paraelectric/ferroelectric phase transition whereas BaTiO 3 prepared via the SAG route remained cubic for all conditions. Atomic resolution images of both varieties showed a high density of interesting surface steps and facets. Computer simulated images of surface structure models showed that the outer (100) surface was typically a BaO layer and that at corners and ledges the steps are typically finished with Ba+2 ions; i.e. the surfaces and steps are Ba-rich. Otherwise the surfaces were typically clean and free of amorphous layers. The relationship between the observed surfaces structures and theoretical models for size effects on the dielectric properties is discussed. (authors)
Directory of Open Access Journals (Sweden)
Rathi S
2003-11-01
Full Text Available BACKGROUND: Drugs used in PKDL include parenteral sodium antimony gluconate (SAG, amphotericin-B, pentamidine, and ketoconazole (KTZ. SAG is the most effective one. Given alone, SAG has to be given for a long duration, leading to poor patient compliance and treatment failure. This study was carried out to compare the effectiness of SAG alone and a combination of SAG and KTZ for sixty days. METHODS: Ten patients of PKDL were included in the study. Five patients (Group A were given SAG intravenously, in the dose of 20 mg/kg per day and five (Group B were given SAG (intravenously 20 mg/kg per day and KTZ (200 mg twice daily orally. Both treatment regimens were given for sixty days. RESULTS: In Group A, the nodules and/or plaques showed approximate 80-85% clinical improvement, and macules showed 25-30% improvement. In group B (SAG + KTZ, there was 90-95% clinical improvement in the nodules and/or plaques and 25-30% in macules. CONCLUSION: This study suggests the therapeutic superiority of the combination treatment regimen in a shorter duration but is not conclusive as the number of patients was low. Further trials are recommended.
Guo, Wei; Liu, Qiang; Francis, John Anthony; Crowther, Dave; Thompson, Alan; Liu, Zhu; Li, Lin
2015-01-01
Lack of penetration, undercut and melt sagging are common welding defects for single-pass laser welds in thick plates, particularly when using a traditional 1G welding position (laser directed towards ground). This investigation shows, for the first time, that welding 13 mm thick high-strength S700 steel plates in the 2G position (laser beam perpendicular to the direction of gravity) can mitigate some of the common welding defects including undercut and sagging. A computational fluid dynamic ...
Commercial Building Motor Protection Response Report
Energy Technology Data Exchange (ETDEWEB)
James, Daniel P. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kueck, John [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2015-06-17
When voltages recover, motors may immediately reenergize and reaccelerate, or delay for a few minutes, or stay stalled. The estimated motor response is given for both the voltage sag magnitude and voltage sag duration. These response estimates are based on experience and available test data. Good data is available for voltage sag response for many components such as relays and contactors, but little data is available for both voltage sag and recovery response. The tables in Appendix A include data from recent voltage sag and recovery tests performed by SCE and BPA on air conditioners and energy management systems. The response of the motor can vary greatly depending on the type of protection and control. The time duration for the voltage sag consists of those times that are of interest for bulk power system modelers.
... Back Injectable Deoxycholic Acid Injectable Hyaluronic Acid Injectable Poly-l-lactic Acid Injectable Polymethylmethacrylate + Bovine Collagen Filler ... procedure? Does the treatment hurt? What are my pain management and anesthesia options? How long is the ...
... turkey neck,” this occurs as skin loses its elasticity and in cases where individuals have lost a ... technique or procedure is appropriate for my skin type? Did the doctor show me before-and-after ...
Rowshanfarzad, P; Riis, H L; Zimmermann, S J; Ebert, M A
2015-07-01
In radiotherapy treatments, it is crucial to monitor the performance of linear accelerator (linac) components, including gantry, collimation system and electronic portal imaging device (EPID) during arc deliveries. In this study, a simple EPID-based measurement method is suggested in conjunction with an algorithm to investigate the stability of these systems at various gantry angles with the aim of evaluating machine-related errors in treatments. The EPID sag, gantry sag, changes in source-to-detector distance (SDD), EPID and collimator skewness, EPID tilt and the sag in leaf bank assembly owing to linac rotation were separately investigated by acquisition of 37 EPID images of a simple phantom with 5 ball bearings at various gantry angles. A fast and robust software package was developed for automated analysis of the image data. Nine Elekta AB (Stockholm, Sweden) linacs of different models and number of years in service were investigated. The average EPID sag was within 2 mm for all tested linacs. Some machines showed >1-mm gantry sag. Changes in the SDD values were within 1.3 cm. EPID skewness and tilt values were <1° in all machines. The maximum sag in multileaf collimator leaf bank assemblies was around 1 mm. A meaningful correlation was found between the age of the linacs and their mechanical performance. Conclusions and Advances in knowledge: The method and software developed in this study provide a simple tool for effective investigation of the behaviour of Elekta linac components with gantry rotation. Such a comprehensive study has been performed for the first time on Elekta machines.
Chen, Tingting; Zhang, Jun
2018-04-01
The compatibilization of acrylonitrile-butadiene-styrene terpolymer (ABS) and poly(ethylene glycol-co-1,4-cyclohexanedimethanol terephthalate) (PETG) blends was first investigated. Styrene-acrylonitrile-glycidyl methacrylate terpolymer (SAG) and ABS grafted with maleic anhydride (ABS-g-MAH) were selected as reactive compatibilizers for the ABS/PETG blends. The compatibilization effect was assessed by scanning electron microscope (SEM), differential scanning calorimetry (DSC) and mechanical properties. And the effect of compatibilizers on the hydrophilicity of the blends was evaluated as well. SEM observation and DSC analysis confirmed that both SAG and ABS-g-MAH compatibilizers could improve the compatibility between ABS and PETG, leading to an improvement in toughness of the blend. The possible cause for the improvement of compatibility was the reaction between compatibilizers and PETG, which could in situ turn out compatibilizers that acted as interfacial agents to enhance the interfacial interaction in the blend. Especially, the addition of SAG significantly decreased the dispersion phase size and the interface voids almost disappeared. Since the in situ reactions between the epoxy groups of SAG and the end groups (sbnd COOH or sbnd OH) of PETG generated PETG-co-SAG copolymer at the blend interface, and the cross-linking reactions proposed to take place between SAG and the PETG-co-SAG copolymer, acting as compatibilizer, could significantly increase the interfacial interaction. The addition of SAG also enhanced the stiffness of the blends. Moreover, the addition of SAG made the blend more hydrophilic, whereas the addition of ABS-g-MAH made the blend more hydrophobic. Therefore, SAG was a good compatibilizer for the ABS/PETG blends and could simultaneously provide the blends with toughening, stiffening and hydrophilic effects.
Wang, Dong; Zhang, Limei; Yong, Changfu; Shen, Mingliang; Ali, Tariq; Shahid, Muhammad; Han, Kun; Zhou, Xuezhang; Han, Bo
2017-06-01
Staphylococcus aureus is one of the major etiological agents of bovine mastitis, harboring a wide variety of staphylococcal superantigen (SAg) toxin genes. The SAg toxin genes are reported to be closely associated with the pathogenicity of the Staph. aureus causing the bovine mastitis. This study was conducted to investigate SAg toxin gene profiles and to assess the relationships among SAg toxin genes, genotypes of Staph. aureus, and their pathogenic properties. A total of 327 quarter milk samples were collected from bovine mastitis cases for isolation and identification of pathogens. In total, 35 isolates were identified as Staph. aureus, and the prevalence of Staph. aureus in milk samples was 13.6% (35/256). Polymerase chain reaction (PCR) and randomly amplified polymorphic DNA (RAPD) assays were used to detect the SAg toxin genes and to genotype Staph. aureus strains isolated from milk samples of bovine mastitis in 10 dairy herds located in Ningxia, China, respectively. The results showed that among the Staph. aureus isolates (n = 35), 71.4% (n = 25) of isolates carried at least one SAg toxin gene. In total, 18 SAg genes and 21 different gene combination patterns were detected among these isolates. The most common SAg genes in Staph. aureus isolates were sei, sen, and seu (44.0% each), followed by seo, tst, and etB (28.0% each), etA (24.0%), sem and sep (16.0% each), seb, sec, sed, and sek (12.0% each), and sea and seh genes (8.0% each); the seg, sej, and ser genes were present in 4.0% of the isolates. Three gene combinations were found to be related to mobile genetic elements that carried 2 or more genes. The egc-cluster of the seg-sei-sem-sen-seo genes, located on the pathogenicity island Type I υSaβ, was detected in 16% of isolates. Interestingly, we observed 6 RAPD genotypes (I to VI) in Staph. aureus isolates, and 2 of these genotypes were strongly associated with the severity of bovine mastitis; there was a close relationship between the RAPD genotypes
Cao, Z.
2015-12-01
Jimusar Sag, which lies in the Junggar Basin,is one of the most typical tight oil study areas in China. However, the properties and origin of the crude oil and the geochemical characteristics of the tight oil from the Lucaogou Formation have not yet been studied. In the present study, 23 crude oilsfrom the Lucaogou Formation were collected for analysis, such as physical properties, bulk composition, saturated hydrocarbon gas chromatography-mass spectrometry (GC-MS), and the calculation of various biomarker parameters. In addition,source rock evaluation and porosity permeability analysis were applied to the mudstones and siltstones. Biomarkers of suitable source rocks (TOC>1, S1+S2>6mg/g, 0.7%
International Nuclear Information System (INIS)
Regis, J.; Tamura, M.; Park, M.C.; McGonigal, A.; Riviere, D.; Coulon, O.; Bartolomei, F.; Girard, N.; Figarella-Branger, D.; Chauvel, P.; Mangin, J.F.
2011-01-01
Background: Epilepsy surgery for magnetic resonance imaging (MRI)-negative patients has a less favorable outcome. Objective: Detection of subclinical abnormal gyration (SAG) patterns and their potential contribution to assessment of the topography of the epileptogenic zone (EZ) is addressed in MRI-negative patients with frontal lobe epilepsy. Methods: Between September 1998 and July 2005, 12 MRI-negative frontal lobe epilepsy patients underwent stereo-electro-encephalography with postcorticectomy follow-up of longer than 1 year (average, 3.3 years). Original software (BrainVISA/Anatomist, http://brainvisa.info) trained on a database of normal volunteers was used to determine which sulci had morphology out of the normal range (SAG). Topography of the EZ, SAG pattern, corticectomy, postoperative seizure control, and histopathology were analyzed. Results: At last follow-up, 8 of 12 patients (66.7%) were Engel class I (7 IA and 1 IB), 2 class II, and 2 class IV. Small focal cortical dysplasia was histologically diagnosed in 9 of the 12 patients (75%), including 7 of 8 seizure-free patients (87.5%). A SAG pattern was found to be in the EZ area in 9 patients (75%), in the ipsilateral frontal lobe out of the EZ in 2, and limited to the contralateral hemisphere in 1. Conclusion: SAG patterns appear to be associated with the topography of the EZ in MRI-negative frontal lobe epilepsy and may have a useful role in preoperative assessment. Small focal cortical dysplasia not detected with MRI is often found on histopathological examination, particularly in the depth of the posterior part of the superior frontal sulcus and intermediate frontal sulcus, suggesting a specific developmental critical zone in these locations. (authors)
Directory of Open Access Journals (Sweden)
Wenyan Feng
2016-11-01
Full Text Available Lian 4 fault block is located in the northwest of Fushan sag, Beibuwan Basin. It is a high-saturated condensate gas reservoir with rich condensate oil held by three faults. In order to seek an enhanced condensate oil recovery technology that is suitable for this condensate gas reservoir at its later development stage, it is necessary to analyze its reserve producing degree and remaining development potential after depletion production, depending on the supercritical fluid phase behavior and depletion production performance characteristics. The supercritical fluid theories and multiple reservoir engineering dynamic analysis methods were adopted comprehensively, such as dynamic reserves, production decline, liquid-carrying capacity of a production well, and remaining development potential analysis. It is shown that, at its early development stage, the condensate in Lian 4 fault block presented the features of supercritical fluid, and the reservoir pressure was lower than the dew point pressure, so retrograde condensate loss was significant. Owing to the retrograde condensate effect and the fast release of elastic energy, the reserve producing degree of depletion production is low in Lian 4 fault block, and 80% of condensate oil still remains in the reservoir. So, the remaining development potential is great. The supercritical condensate in Lian 4 fault block is of high density. Based on the optimization design by numerical simulation of compositional model, it is proposed to inject CO2 at the top and build up pressure by alternating production and injection, so that the secondary gas cap is formed while the gravity-stable miscible displacement is realized. In this way, the recovery factor of condensate reservoirs can be improved by means of the secondary development technology.
Morfología de la planta y características de rendimiento y calidad de almidón de sagú
Directory of Open Access Journals (Sweden)
Magda Piedad Valdés Restrepo
2010-07-01
Full Text Available El sagú Maranta arundinacea es una Marantaceae cuyo rizoma es utilizado en algunas zonas de Colombia para la elaboración de productos destinados a la alimentación humana. No obstante, el conocimiento agronómico de este cultivo es limitado. En este trabajo se estudiaron varios métodos de propagación, días a cosecha de rizomas, producción de almidón nativo y el análisis químico de esta planta en las condiciones del Valle del Cauca. El cultivo fue establecido en parcelas de 0.25 m x 1 m entre plantas dentro de surco y entre surcos, respectivamente. Para el análisis de los datos cuantitativos se utilizaron estadísticas descriptivas (medidas de tendencia central, de variación y de desviación. La planta adulta alcanzó una altura entre 50 y 75 cm y un rendimiento de rizoma fresco entre 1.46 y 1.94 kg/planta. El índice de cosecha varió entre 0.06 y 0.60; el rendimiento de almidón por el rizoma fresco varió entre 7.2% y 8.1%; la composición proximal (en % del rizoma fue: 22.3, 7.4, 3.62, 1.02, 6.98 y 80.9 para MS, PC, FC, EE, ceniza y ELN, respectivamente. Las pruebas de antimetabolitos mostraron ausencia de estos compuestos en el forraje fresco, con 41.3; 22.0; 22.5; 15.06; 57.13; 32.3; 9.2; 23.13 y 24.8% de MS, PC, FC, ceniza, FDN, FDA, lignina, celulosa y hemicelulosa, respectivamente. El valor relativo como forraje fue de 103.7. Se realizó el análisis granulométrico: el módulo de fineza, módulo de uniformidad y el tamaño de la partícula. El rendimiento de almidón de rizomas fue de 10.57 ± 1.35%, el gasto de agua de 50.45 l/kg de almidón rendido. El gránulo fue elipsoidal de 8 µm de diámetro y compuesto por 20.54% de amilosa y 79.46% de amilopectina, que genera una pasta opaca y resistente a la retrogradación. La temperatura final de gelificación fue de 73 °C, la viscosidad máxima de la pasta fue de 220 Unidades Brabender (U.B., con un pico de viscosidad definido, y posterior conservación de la trayectoria, con
Morfología de la planta y características de rendimiento y calidad de almidón de sagú
Directory of Open Access Journals (Sweden)
Sánchez Teresa
2010-09-01
Full Text Available El sagú Maranta arundinacea es una Marantaceae cuyo rizoma es utilizado en algunas zonas de Colombia para la elaboración de productos destinados a la alimentación humana. No obstante, el conocimiento agronómico de este cultivo es limitado. En este trabajo se estudiaron varios métodos de propagación, días a cosecha de rizomas, producción de almidón nativo y el análisis químico de esta planta en las condiciones del Valle del Cauca. El cultivo fue establecido en parcelas de 0.25 m x 1 m entre plantas dentro de surco y entre surcos, respectivamente. Para el análisis de los datos cuantitativos se utilizaron estadísticas descriptivas (medidas de tendencia central, de variación y de desviación. La planta adulta alcanzó una altura entre 50 y 75 cm y un rendimiento de rizoma fresco entre 1.46 y 1.94 kg/planta. El índice de cosecha varió entre 0.06 y 0.60; el rendimiento de almidón por el rizoma fresco varió entre 7.2% y 8.1%; la composición proximal (en % del rizoma fue: 22.3, 7.4, 3.62, 1.02, 6.98 y 80.9 para MS, PC, FC, EE, ceniza y ELN, respectivamente. Las pruebas de antimetabolitos mostraron ausencia de estos compuestos en el forraje fresco, con 41.3; 22.0; 22.5; 15.06; 57.13; 32.3; 9.2; 23.13 y 24.8% de MS, PC, FC, ceniza, FDN, FDA, lignina, celulosa y hemicelulosa, respectivamente. El valor relativo como forraje fue de 103.7. Se realizó el análisis granulométrico: el módulo de fineza, módulo de uniformidad y el tamaño de la partícula. El rendimiento de almidón de rizomas fue de 10.57 ± 1.35%, el gasto de agua de 50.45 l/kg de almidón rendido. El gránulo fue elipsoidal de 8 µm de diámetro y compuesto por 20.54% de amilosa y 79.46% de amilopectina, que genera una pasta opaca y resistente a la retrogradación. La temperatura final de gelificación fue de 73 °C, la viscosidad máxima de la pasta fue de 220 Unidades Brabender (U.B., con un pico de viscosidad definido, y posterior conservación de la
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Senescence is a highly regulated process accompanied by changes in gene expression. While the mRNA levels of most genes decline, the mRNA levels of specific genes (senescence associated genes, SAGs) increase during senescence. Arabidopsis SAG12 (AtSAG12) gene codes for papain-like cysteine protease.
PROPIEDADES FUNCIONALES DEL ALMIDON DE SAGU (Maranta arundinacea
Directory of Open Access Journals (Sweden)
CLEMENTE GRANADOS C
Full Text Available El sagú (Maranta arundinacea cuyo rizoma es utilizado en algunas zonas de Colombia para la elaboración de productos destinados a la alimentación humana. Se extrajo el almidón y se determinaron las propiedades funcionales, los almidones presentaron alta capacidad de retención de agua% CRA (162,8% para el sagú, respecto al 226% de la yuca, un alto índice de absorción de lípidos, % I.A.L (51% para sagú, respecto al 82,25% del almidón de yuca. La temperatura de gelatinización esrelativamente baja (65-75°C a 10 minutos para sagú respecto al almidón de yuca con 70-75°C en 20 minutos, posee un alto porcentaje de amilopectina (77% para el almidón de sagú, en comparación con 83,3% para el almidón de yuca por tanto es un gel que no retrograda y forma una pasta estable. Por lo que se concluye que se puede usar como alternativa promisoria en la industria alimentaria.
An anthropogenic origin of the "Sirente crater," Abruzzi, Italy
Speranza, Fabio; Sagnotti, Leonardo; Rochette, Pierre
2004-04-01
In this paper, we review the recent hypothesis, based mostly on geomorphological features, that a ~130 m-wide sag pond, surrounded by a saddle-shaped rim from the Sirente plain (Abruzzi, Italy), is the first-discovered meteoritic crater of Italy. Sub-circular depressions (hosting ponds), with geomorphological features and size very similar to those exhibited by the main Sirente sag, are exposed in other neighboring intermountain karstic plains from Abruzzi. We have sampled present day soils from these sag ponds and from the Sirente sags (both the main "crater" and some smaller ones, recently interpreted as a crater field) and various Abruzzi paleosols from excavated trenches with an age range encompassing the estimated age of the "Sirente crater." For all samples, we measured the magnetic susceptibility and determined the Ni and Cr contents of selected specimens. The results show that the magnetic susceptibility values and the geochemical composition are similar for all samples (from Sirente and other Abruzzi sags) and are both significantly different from the values reported for soils contaminated by meteoritic dust. No solid evidence pointing at an impact origin exists, besides the circular shape and rim of the main sag. The available observations and data suggest that the "Sirente crater," together with analogous large sags in the Abruzzi intermountain plains, have to be attributed to the historical phenomenon of "transumanza" (seasonal migration of sheep and shepherds), a custom that for centuries characterized the basic social-economical system of the Abruzzi region. Such sags were excavated to provide water for millions of sheep, which spent summers in the Abruzzi karstic high pasture lands, on carbonatic massifs deprived of natural superficial fresh water. Conversely, the distribution of the smaller sags from the Sirente plain correlates with the local pattern of the calcareous bedrock and, together with the characteristics of their internal structure, are
Xu, Qinghai; Shi, Wanzhong; Xie, Yuhong; Wang, Zhenfeng; Li, Xusheng; Tong, Chuanxin
2017-01-01
The Qiongdongnan Basin is a strongly overpressured basin with the maximum pressure coefficient (the ratio of the actual pore pressure versus hydrostatic pressure at the same depth) over 2.27. However, there exists a widespread low-overpressure interval between the strong overpressure intervals in the Yanan Sag of western basin. The mechanisms of the low-overpressure interval are not well understood. Three main approaches, pore pressure test data and well-log analysis, pressure prediction based on the relationship between the deviation of the velocity and the pressure coefficients, and numerical modeling, were employed to illustrate the distribution and evolution of the low-overpressure interval. And we analyzed and explained the phenomenon of the low-overpressure interval that is both underlain and overlain by high overpressure internal. The low-overpressure interval between the strong overpressure intervals can be identified and modelled by drilling data of P-wave sonic and the mud weight, and the numerical modeling using the PetroMod software. Results show that the low-overpressure interval is mainly composed of sandstone sediments. The porosities of sandstone in the low-overpressure interval primarily range from 15%-20%, and the permeabilities range from 10–100 md. Analysis of the geochemical parameters of C1, iC4/nC4, ΔR3, and numerical modeling shows that oil and gas migrated upward into the sandstone in the low-overpressure interval, and then migrated along the sandstone of low-overpressure interval into the Yacheng uplift. The low-overpressure both underlain and overlain by overpressure resulted from the fluids migrating along the sandstones in the low-overpressure interval into the Yacheng uplift since 1.9Ma. The mudstone in the strong overpressure interval is good cap overlain the sandstone of low-overpressure interval, therefore up-dip pinchouts or isolated sandstone in the low-overpressure interval locating the migration path of oil and gas are good
Ho, Sue-Kim; Nathan, Sheila; Wan, Kiew-Lian
2016-11-01
Eimeria tenella is the most pathogenic of the Eimeria species that infect chickens and causes huge economic losses to the poultry industry. The glycosylphosphatidylinositol-anchored surface antigen-5 (SAG5) found on the surface of the parasite has been shown to activate the chicken's immune system. In this study, recombinant SAG5 was expressed, purified and used to investigate the immune-inducing characteristics of the molecule. Chickens were immunized with purified recombinant SAG5 and sera were subjected to Enzyme-linked Immunosorbant Assay (ELISA). Results indicated that specific antibodies against rSAG5 were produced, with IgG detected at a higher level compared to IgA and IgM. Information on the immunological responses elicited by SAG5 provides essential knowledge that will contribute towards the effort to develop more effective strategies against coccidiosis.
Formation Mechanisms for Spur and Groove Features on Fringing Reefs
Bramante, J. F.; Ashton, A. D.; Perron, J. T.
2016-12-01
Spur and groove systems (SAGs) are ubiquitous morphological features found on fore-reef slopes globally. SAGs consist of parallel, roughly shore-normal ridges of actively growing coral and coralline algae (spurs) separated by offshore-sloping depressions typically carpeted by a veneer of sediment (grooves). Although anecdotal observations and recent statistical analyses have reported correlations between wave exposure and the distribution of SAGs on fore-reef slopes, the physical mechanisms driving SAG formation remain poorly understood. For example, there remains significant debate regarding the importance of coral growth versus bed erosion for SAG formation. Here we investigate a hypothesis that SAG formation is controlled by feedbacks between sediment production and diffusion and coral growth. Using linear stability analysis, we find that sediment production, coral growth, and the feedbacks between them are unable to produce stable periodic structures without a sediment sink. However, if incipient grooves act as conduits for sediment transport offshore, a positive feedback can develop as the groove bed erodes through wave-driven abrasion during offshore transport. Eventually a negative feedback slows groove deepening when the groove bed is armored by sediment, and the groove bed relaxes to a sediment-veneered equilibrium profile analogous to sediment-rich shorefaces. To test this hypothesis, we apply a numerical model that incorporates coral growth and sediment production, sediment diffusion, non-linear wave-driven abrasion, and sediment advection offshore. This model produces the periodic, linear features characteristic of SAG morphology. The relative magnitude of growth, production, diffusion, abrasion, and advection rates affect periodic spacing or wavelength of the modeled SAGs. Finally, we evaluate the ability of the model to replicate geographical variability in SAG characteristics using previously published datasets and reanalysis wave data.
Laurent, Gindre-Chanu; Edoardo, Perri; Ian, Sharp R.; Peacock, D. C. P.; Roger, Swart; Ragnar, Poulsen; Hercinda, Ferreira; Vladimir, Machado
2016-08-01
Ephemeral evaporitic conditions developed within the uppermost part of the transgressive Late Sag sequence in the Namibe Basin (SW Angola), leading to the formation of extensive centimetre- to metre-thick sulphate-bearing deposits and correlative microbialitic carbonates rich in pseudomorphs after evaporite crystals. The onshore pre-salt beds examined in this study are located up to 25 m underneath the major mid-Aptian evaporitic succession, which is typified at the outcrop by gypsiferous Bambata Formation and in the subsurface by the halite-dominated Loeme Formation. Carbonate-evaporite cycles mostly occur at the top of metre-thick regressive parasequences, which progressively onlap and overstep landward the former faulted (rift) topography, or fill major pre-salt palaeo-valleys. The sulphate beds are made up of alabastrine gypsum associated with embedded botryoidal nodules, dissolution-related gypsum breccia, and are cross-cut by thin satin-spar gypsum veins. Nodular and fine-grained fabrics are interpreted as being diagenetic gypsum deposits resulting from the dissolution and recrystallisation of former depositional subaqueous sulphates, whereas gypsum veins and breccia result from telogenetic processes. The carbonates display a broader diversity of facies, characterised by rapid lateral variations along strike. Thin dolomitic and calcitic bacterial-mediated filamentous microbialitic boundstones enclose a broad variety of evaporite pseudomorphs and can pass laterally over a few metres into sulphate beds. Dissolution-related depositional breccias are also common and indicate early dissolution of former evaporite layers embedded within the microbialites. Sulphate and carbonate units are interpreted as being concomitantly deposited along a tide-dominated coastal supra- to intertidal- sabkha and constitute high-frequency hypersaline precursor events, prior to the accumulation of the giant saline mid-Aptian Bambata and Loeme Formations. Petrographic and geochemical
Directory of Open Access Journals (Sweden)
Katherine J Kasper
2014-05-01
Full Text Available Establishing the genetic determinants of niche adaptation by microbial pathogens to specific hosts is important for the management and control of infectious disease. Streptococcus pyogenes is a globally prominent human-specific bacterial pathogen that secretes superantigens (SAgs as 'trademark' virulence factors. SAgs function to force the activation of T lymphocytes through direct binding to lateral surfaces of T cell receptors and class II major histocompatibility complex (MHC-II molecules. S. pyogenes invariably encodes multiple SAgs, often within putative mobile genetic elements, and although SAgs are documented virulence factors for diseases such as scarlet fever and the streptococcal toxic shock syndrome (STSS, how these exotoxins contribute to the fitness and evolution of S. pyogenes is unknown. Here we show that acute infection in the nasopharynx is dependent upon both bacterial SAgs and host MHC-II molecules. S. pyogenes was rapidly cleared from the nasal cavity of wild-type C57BL/6 (B6 mice, whereas infection was enhanced up to ∼10,000-fold in B6 mice that express human MHC-II. This phenotype required the SpeA superantigen, and vaccination with an MHC -II binding mutant toxoid of SpeA dramatically inhibited infection. Our findings indicate that streptococcal SAgs are critical for the establishment of nasopharyngeal infection, thus providing an explanation as to why S. pyogenes produces these potent toxins. This work also highlights that SAg redundancy exists to avoid host anti-SAg humoral immune responses and to potentially overcome host MHC-II polymorphisms.
The application of apatite fission track analysis to hydrocarbon exploration of Yanqi basin
International Nuclear Information System (INIS)
Wu Fuqiang; Liu Jiaduo; He Mingxi; Chen Gang
2000-01-01
The author introduces the method and principle of AFTA, i.e. annealing characteristics. Through analysing the AFT data of the six Jurassic samples from the Well Bonan-1 and the Well Yancan-1 in the Yanqi Basin, the authors conclude that in the north sag, the thickness of Cenozoic group was generally more than 2000 meters, the north sag was situated in Cenozoic compensation geothermal district, and the maximum palaeo-temperature of the middle-lower Jurassic was about 70-110 degree C in late Cenozoic; while in the south sag, the thickness of Cenozoic group was generally less than 1500 meters, the south sag was situated in Cenozoic deficient geothermal district, and the maximum palaeo-temperature of the lower middle lower Jurassic was about 80-110 degree C in latest Jurassic. The AFT ages show that in the north sag, the uplift event took place in late Cretaceous, while in the south sag, the uplift event took place in early Cretaceous. Therefore the main uplift event of the Yanqi Basin took place in Cretaceous period, and the uplift of the south was earlier than that of the north
Histoplasma Urinary Antigen Testing Obviates the Need for Coincident Serum Antigen Testing.
Libert, Diane; Procop, Gary W; Ansari, Mohammad Q
2018-03-07
Serum and urine antigen (SAg, UAg) detection are common tests for Histoplasma capsulatum. UAg detection is more widely used and reportedly has a higher sensitivity. We investigated whether SAg detection contributes meaningfully to the initial evaluation of patients with suspected histoplasmosis. We reviewed 20,285 UAg and 1,426 SAg tests ordered from 1997 to 2016 and analyzed paired UAg and SAg tests completed on the same patient within 1 week. We determined the positivity rate for each test. Of 601 paired specimens, 542 were concurrent negatives and 48 were concurrent positives (98% agreement). Medical records were available for eight of 11 pairs with discrepant results. UAg was falsely positive in six instances, truly positive once, and falsely negative once. These findings support using a single antigen detection test, rather than both UAg and SAg, as an initial screen for suspected histoplasmosis. This aligns with the current practice of most physicians.
Houseknecht, David W.; Connors, Christopher D.
2015-01-01
Basin evolution of the U.S. Chukchi shelf involved multiple phases, including Late Devonian–Permian rifting, Permian–Early Jurassic sagging, Late Jurassic–Neocomian inversion, and Cretaceous–Cenozoic foreland-basin development. The focus of ongoing exploration is a petroleum system that includes sag-phase source rocks; inversion-phase reservoir rocks; structure spanning the rift, sag, and inversion phases; and hydrocarbon generation during the foreland-basin phase.
12038_2016_9626_Supplementary 1..3
Indian Academy of Sciences (India)
negatively regulates stress-induced cell death. SUBARAN SINGH, ANUPRIYA SINGH and ASHIS KUMAR NANDI ... of OsSAG12-1 and OssAg12-2 amino acid sequences. Matrix: EBLOSUM62,. Gap_penalty: 10.0, Extend penalty: 0.5, Identity: 161/316 (50.9%, Similarity: 205/316 (64.9%), Gaps: 26/316 (8.2%, Score: 822.5.
International Nuclear Information System (INIS)
Ban, Deok Young; Lee, Sang Lae; Nam, Won Jong
1998-01-01
Effects of the Mo and W additions to Si-Cr spring steels on the microstructural evolution and mechanical properties in spring steels were investigated. It was found that the Mo and/or W addition does not change the behavior of tempered carbide at low temperatures, such as the precipitation of ε-carbide and the conversion of ε-carbide to cementite, via dilatometry tests and the observation of microstructure using TEM. However, it would reduce the coarsening rate of cementite at high temperature above 450 .deg. C, resulting in the smaller size of cementite particles due to the lower diffusion rate. Since the sag resistance depends on the distribution and the size of precipitates, steel C(0.2% W) showed the strongest sag resistance whereas steel A showed the weakest sag resistance, when tempered at 450 .deg. C. Also, an abundance of precipitates at 350 deg. C tempering exhibits the maximum loop area, i.e., the sag resistance for all the tested steels. The Mo and W additions to Si-Cr spring steels raised the ratio of loop area/tensile strength. Therefore, the Mo and W additions would be effective method to increase the sag resistance as well as strength in Si-Cr spring steels
Nguyen, Van-Tinh; Ko, Seok-Chun; Oh, Gun-Woo; Heo, Seong-Yeong; Jeon, You-Jin; Park, Won Sun; Choi, Il-Whan; Choi, Sung-Wook; Jung, Won-Kyo
2016-12-01
Microglia are the immune cells of the central nervous system (CNS). Overexpression of inflammatory mediators by microglia can induce several neurological diseases. Thus, the underlying basic requirement for neural tissue engineering is to develop materials that exhibit little or no neuro-inflammatory effects. In this study, we have developed a method to create porous scaffolds by adding fucoidan (Fu) into porous sodium alginate (Sa)/gelatine (G) (SaGFu). For mechanical characterization, in vitro degradation, stress/strain, swelling, and pore size were measured. Furthermore, the biocompatibility was evaluated by assessing the adhesion and proliferation of BV2 microglial cells on the SaGFu porous scaffolds using scanning electron microscopy (SEM) and lactate dehydrogenase (LDH) assay, respectively. Moreover, we studied the neuro-inflammatory effects of SaGFu on BV2 microglial cells. The effect of gelatine and fucoidan content on the various properties of the scaffold was investigated and the results showed that mechanical properties increased porosity and swelling ratio with an increase in the gelatine and fucoidan, while the in vitro biodegradability decreased. The average SaGFu diameter attained by fabrication of SaGFu ranged from 60 to 120μm with high porosity (74.44%-88.30%). Cell culture using gelatine 2.0% (SaG2Fu) and 4.0% (SaG4Fu), showed good cell proliferation; more than 60-80% that with Sa alone. Following stimulation with 0.5μg/mL LPS, microglia cultured in porous SaGFu decreased their expression of nitric oxide (NO), prostaglandin E2 (PGE2), and reactive oxygen species (ROS). SaG2Fu and SaG4Fu also inhibited the activation and translocation of p65 NF-κB protein levels, resulting in reduction of NO, ROS, and PGE2 production. These results provide insights into the diverse biological effects and opens new avenues for the applications of SaGFu in neuroscience. Copyright © 2016 Elsevier B.V. All rights reserved.
Morici, Eleonora; Simoni, Serena; Brenciani, Andrea; Giovanetti, Eleonora; Varaldo, Pietro E; Mingoia, Marina
2017-01-01
To investigate the genetic basis of catQ-mediated chloramphenicol resistance in Streptococcus agalactiae. Two clinical strains of catQ-positive chloramphenicol-resistant S. agalactiae (Sag236 and Sag403) were recently isolated, typed (MLST, PFGE pulsotypes, capsular types) and their antibiotic resistances investigated by phenotypic and genotypic approaches. Several molecular methods (PCR mapping, restriction assays, Southern blotting, sequencing and sequence analysis, conjugal transfer assays) were used to determine the genetic context of catQ and characterize a genetic element detected in the isolates. Sag236 and Sag403 shared the same ST (ST19), but exhibited a different capsular type (III and V, respectively) and pulsotype. Both harboured the macrolide resistance genes mef(I) and erm(TR) and the tetracycline resistance gene tet(M). Accordingly, they were resistant to chloramphenicol, erythromycin and tetracycline. catQ and mef(I) were associated in an IQ module that was indistinguishable in Sag236 and Sag403. In mating assays, chloramphenicol and erythromycin resistance proved transferable, at low frequency, only from Sag236. Transconjugants carried not only catQ and mef(I), but also erm(TR), suggesting a linkage of the three resistance genes in a mobile element, which, though seemingly non-mobile, was also detected in Sag403. The new element (designated ICESag236, ∼110 kb) results from recombination of two integrative and conjugative elements (ICEs) originally described in different streptococcal species: S. agalactiae ICESagTR7, carrying erm(TR); and Streptococcus pneumoniae ICESpn529IQ, carrying the prototype IQ module. These findings strengthen the notion that widespread streptococcal ICEs may form mosaics that enhance their diversity and spread, broaden their host range and carry new cargo genes. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions
Gao, Shan; Gao, Jiong; Zhu, Xiaoyu; Song, Yi; Li, Zhongpeng; Ren, Guodong; Zhou, Xin; Kuai, Benke
2016-09-06
Chlorophyll (Chl) degradation is an integral process of leaf senescence, and NYE1/SGR1 has been demonstrated as a key regulator of Chl catabolism in diverse plant species. In this study, using yeast one-hybrid screening, we identified three abscisic acid (ABA)-responsive element (ABRE)-binding transcription factors, ABF2 (AREB1), ABF3, and ABF4 (AREB2), as the putative binding proteins of the NYE1 promoter. Through the transactivation analysis, electrophoretic mobility shift assay, and chromatin immunoprecipitation, we demonstrated that ABF2, ABF3, and ABF4 directly bound to and activated the NYE1 promoter in vitro and in vivo. ABA is a positive regulator of leaf senescence, and exogenously applied ABA can accelerate Chl degradation. The triple mutant of the ABFs, abf2abf3abf4, as well as two ABA-insensitive mutants, abi1-1 and snrk2.2/2.3/2.6, exhibited stay-green phenotypes after ABA treatment, along with decreased induction of NYE1 and NYE2 expression. In contrast, overexpression of ABF4 accelerated Chl degradation upon ABA treatment. Interestingly, ABF2/3/4 could also activate the expression of two Chl catabolic enzyme genes, PAO and NYC1, by directly binding to their promoters. In addition, abf2abf3abf4 exhibited a functional stay-green phenotype, and senescence-associated genes (SAGs), such as SAG29 (SWEET15), might be directly regulated by the ABFs. Taken together, our results suggest that ABF2, ABF3, and ABF4 likely act as key regulators in mediating ABA-triggered Chl degradation and leaf senescence in general in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
Updated Status and Performance at the Fourth HST COS FUV Lifetime Position
Taylor, Joanna M.; De Rosa, Gisella; Fix, Mees B.; Fox, Andrew; Indriolo, Nick; James, Bethan; Jedrzejewski, Robert I.; Oliveira, Cristina M.; Penton, Steven V.; Plesha, Rachel; Proffitt, Charles R.; Rafelski, Marc; Roman-Duval, Julia; Sahnow, David J.; Snyder, Elaine M.; Sonnentrucker, Paule; White, James
2017-06-01
To mitigate the adverse effects of gain sag on the spectral quality and accuracy of Hubble Space Telescope’s Cosmic Origins Spectrograph FUV observations, COS FUV spectra will be moved from Lifetime Position 3 (LP3) to a new pristine location on the detectors at LP4 in July 2017. To achieve maximal spectral resolution while preserving detector area, the spectra will be shifted in the cross-dispersion (XD) direction by -2.5" (about -31 pixels) from LP3 or -5” (about 62 pixels) from the original LP1. At LP4, the wavelength calibration lamp spectrum can overlap with the previously gain-sagged LP2 PSA spectrum location. If lamp lines fall in the gain sag holes from LP2, it can cause line ratios to change and the wavelength calibration to fail. As a result, we have updated the Wavecal Parameters Reference Table and CalCOS to address this issue. Additionally, it was necessary to extend the current geometric correction in order to encompass the entire LP4 location. Here we present 2-D template profiles and 1-D spectral trace centroids derived at LP4 as well as LP4-related updates to the wavelength calibration, and geometric correction.
The clinical features of respiratory infections caused by the Streptococcus anginosus group.
Noguchi, Shingo; Yatera, Kazuhiro; Kawanami, Toshinori; Yamasaki, Kei; Naito, Keisuke; Akata, Kentaro; Shimabukuro, Ikuko; Ishimoto, Hiroshi; Yoshii, Chiharu; Mukae, Hiroshi
2015-10-26
The Streptococcus anginosus group (SAG) play important roles in respiratory infections. It is ordinarily difficult to distinguish them from contaminations as the causative pathogens of respiratory infections because they are often cultured in respiratory specimens. Therefore, it is important to understand the clinical characteristics and laboratory findings of respiratory infections caused by the SAG members. The aim of this study is to clarify the role of the SAG bacteria in respiratory infections. A total of 30 patients who were diagnosed with respiratory infections which were caused by the SAG bacteria between January 2005 and February 2015 were retrospectively evaluated. Respiratory infections caused by the SAG were mostly seen in male patients with comorbid diseases and were typically complicated with pleural effusion. Pleural effusion was observed in 22 (73.3%) patients. Empyema was observed in half of the 22 patients with pleural effusion. S. intermedius, S. constellatus and S. anginosus were detected in 16 (53.3 %), 11 (36.7 %) and 3 (10.0 %) patients, respectively. Six patients had mixed-infections. The duration from the onset of symptoms to the hospital visit was significantly longer in "lung abscess" patients than in "pneumonia" patients among the 24 patients with single infections, but not among the six patients with mixed-infection. The peripheral white blood cell counts of the "pneumonia" patients were higher than those of the "lung abscess" patients and S. intermedius was identified significantly more frequently in patients with pulmonary and pleural infections (pneumonia and lung abscess) than in patients with bacterial pleurisy only. In addition, the patients in whom S. intermedius was cultured were significantly older than those in whom S. constellatus was cultured. Respiratory infections caused by the SAG bacteria tended to be observed more frequently in male patients with comorbid diseases and to more frequently involve purulent formation. In
The clinical features of respiratory infections caused by the Streptococcus anginosus group
Noguchi, Shingo; Yatera, Kazuhiro; Kawanami, Toshinori; Yamasaki, Kei; Naito, Keisuke; Akata, Kentaro; Shimabukuro, Ikuko; Ishimoto, Hiroshi; Yoshii, Chiharu; Mukae, Hiroshi
2015-01-01
Background The Streptococcus anginosus group (SAG) play important roles in respiratory infections. It is ordinarily difficult to distinguish them from contaminations as the causative pathogens of respiratory infections because they are often cultured in respiratory specimens. Therefore, it is important to understand the clinical characteristics and laboratory findings of respiratory infections caused by the SAG members. The aim of this study is to clarify the role of the SAG bacteria in respi...
Solo dwarfs I: survey introduction and first results for the Sagittarius dwarf irregular galaxy
Higgs, C. R.; McConnachie, A. W.; Irwin, M.; Bate, N. F.; Lewis, G. F.; Walker, M. G.; Côté, P.; Venn, K.; Battaglia, G.
2016-05-01
We introduce the Solitary Local dwarfs survey (Solo), a wide-field photometric study targeting every isolated dwarf galaxy within 3 Mpc of the Milky Way. Solo is based on (u)gi multiband imaging from Canada-France-Hawaii Telescope/MegaCam for northern targets, and Magellan/Megacam for southern targets. All galaxies fainter than MV ≃ -18 situated beyond the nominal virial radius of the Milky Way and M31 (≳300 kpc) are included in this volume-limited sample, for a total of 42 targets. In addition to reviewing the survey goals and strategy, we present results for the Sagittarius dwarf irregular galaxy (Sag DIG), one of the most isolated, low-mass galaxies, located at the edge of the Local Group. We analyse its resolved stellar populations and their spatial distributions. We provide updated estimates of its central surface brightness and integrated luminosity, and trace its surface brightness profile to a level fainter than 30 mag arcsec-2. Sag DIG is well described by a highly elliptical (disc-like) system following a single component Sérsic model. However, a low-level distortion is present at the outer edges of the galaxy that, were Sag DIG not so isolated, would likely be attributed to some kind of previous tidal interaction. Further, we find evidence of an extremely low level, extended distribution of stars beyond ˜5 arcmin (>1.5 kpc) that suggests Sag DIG may be embedded in a very low-density stellar halo. We compare the stellar and H I structures of Sag DIG, and discuss results for this galaxy in relation to other isolated, dwarf irregular galaxies in the Local Group.
International Nuclear Information System (INIS)
Rowshanfarzad, Pejman; McGarry, Conor K; Barnes, Michael P; Sabet, Mahsheed; Ebert, Martin A
2014-01-01
In modern radiotherapy, it is crucial to monitor the performance of all linac components including gantry, collimation system and electronic portal imaging device (EPID) during arc deliveries. In this study, a simple EPID-based measurement method has been introduced in conjunction with an algorithm to investigate the stability of these systems during arc treatments with the aim of ensuring the accuracy of linac mechanical performance. The Varian EPID sag, gantry sag, changes in source-to-detector distance (SDD), EPID and collimator skewness, EPID tilt, and the sag in MLC carriages as a result of linac rotation were separately investigated by acquisition of EPID images of a simple phantom comprised of 5 ball-bearings during arc delivery. A fast and robust software package was developed for automated analysis of image data. Twelve Varian linacs of different models were investigated. The average EPID sag was within 1 mm for all tested linacs. All machines showed less than 1 mm gantry sag. Changes in SDD values were within 1.7 mm except for three linacs of one centre which were within 9 mm. Values of EPID skewness and tilt were negligible in all tested linacs. The maximum sag in MLC leaf bank assemblies was around 1 mm. The EPID sag showed a considerable improvement in TrueBeam linacs. The methodology and software developed in this study provide a simple tool for effective investigation of the behaviour of linac components with gantry rotation. It is reproducible and accurate and can be easily performed as a routine test in clinics
Directory of Open Access Journals (Sweden)
W. Meng
2018-01-01
Full Text Available The exchange and migration of basin materials that are carried by pore fluids are the essence of diagenesis, which can alter physical properties of clastic rocks as well as control formation and distribution of favorable reservoirs of petroliferous basins. Diagenetic products and pore fluids, resulting from migration and exchange of basin materials, can be used to deduce those processes. In this study, 300 core samples from 46 wells were collected for preparation of casting thin sections, SEM, BSE, EDS, inclusion analysis, and isotope analysis in Dongying Sag, Bohai Bay Basin, East China. Combined with geochemical characteristics of pore fluids and geological background of the study area, the source and exchange mechanisms of materials in the pore fluids of rift basins were discussed. It was revealed that the material exchange of pore fluids could be divided into five stages. The first stage was the evaporation concentration stage during which mainly Ca2+, Mg2+, and CO32- precipitated as high-Mg calcites. Then came the shale compaction stage, when mainly Ca2+ and CO32- from shale compaction water precipitated as calcites. The third stage was the carboxylic acid dissolution stage featured by predominant dissolution of plagioclases, during which Ca2+ and Na+ entered pore fluids, and Si and Al also entered pore fluids and then migrated as clathrates, ultimately precipitating as kaolinites. The fourth stage was the organic CO2 stage, mainly characterized by the kaolinization of K-feldspar as well as dissolution of metamorphic lithic fragments and carbon cements. During this stage, K+, Fe2+, Mg2+, Ca2+, HCO3-, and CO32- entered pore fluids. The fifth stage was the alkaline fluid stage, during which the cementation of ferro-carbonates and ankerites as well as illitization or chloritization of kaolinites prevailed, leading to the precipitation of K+, Fe2+, Mg2+, Ca2+, and CO32- from pore fluids.
Prognostic role of sensitive-to-apoptosis gene expression in rectal cancer
DEFF Research Database (Denmark)
Ozden, Sevgi A; Ozyurt, Hazan; Ozgen, Zerrin
2011-01-01
To investigate the association between prognosis of rectal cancer treated with chemoradiotherapy (CRT) and expression of sensitive-to-apoptosis (SAG), B-cell lymphoma-extra large (Bcl-X(L)) and Bcl-2 homologous antagonist/killer (Bak).......To investigate the association between prognosis of rectal cancer treated with chemoradiotherapy (CRT) and expression of sensitive-to-apoptosis (SAG), B-cell lymphoma-extra large (Bcl-X(L)) and Bcl-2 homologous antagonist/killer (Bak)....
Effects of the Charge Ions Strength on the Swelling of Organic-Inorganic Nanogels
Energy Technology Data Exchange (ETDEWEB)
Yu, Qin; Lu, Xiangguo; Wang, Jing; Guo, Qi; Niu, Liwei [Northeast Petroleum University, Daqing (China)
2016-07-15
The swelling behavior and swelling mechanism of hydrogels can be greatly affected by the charge strength of ions in them. To investigate such effects, we prepared two gels: a carboxylic acid gel (CAG) and a poly (2-acrylamide–methyl propane sulfonic acid) gel (SAG) based on starchy polyacrylamide (PAM) nanocomposite gels, both with montmorillonite, which underwent in situ intercalation, and used them as probes in swelling experiments. The equilibrium swelling rates (ESRs) of the hydrogels in both salt water and acidic water strongly depended on the charge strength of the ions in the chains. SAG had a higher ESR than CAG at the same mole ratio of polymer/water, which is attributed to the greater electrostatic repulsion between the strong electrolyte ions of SAG. Both water salinity and hydrogen ion contact of the hydrogels weakened ESR with the enhancement of charge ionic strength. The downward trend of ESR with increasing concentration of salt or hydrogen ions became weaker in SAG compared to CAG, which is attributed to the shielding and deprotonation effects of the strong electrolyte ions. Regarding the swelling mechanism, the chain relaxation occurred in neutral and acidic solutions for SAG and in neutral and weak acidic solutions for CAG, but water diffusion dominated in strong acidic solutions for CAG, leading to different swelling behaviors.
Wendte, J M; Miller, M A; Nandra, A K; Peat, S M; Crosbie, P R; Conrad, P A; Grigg, M E
2010-04-19
Sarcocystis neurona is an apicomplexan parasite identified as a cause of fatal neurological disease in the threatened southern sea otter (Enhydra lutris nereis). In an effort to characterize virulent S. neurona strains circulating in the marine ecosystem, this study developed a range of markers relevant for molecular genotyping. Highly conserved sequences within the 18S ribosomal gene array, the plastid-encoded RNA polymerase (RPOb) and the cytochrome c oxidase subunit 1 mitochondrial gene (CO1) were assessed for their ability to distinguish isolates at the genus and species level. For within-species comparisons, five surface antigens (SnSAG1-SnSAG5) and one high resolution microsatellite marker (Sn9) were developed as genotyping markers to evaluate intra-strain diversity. Molecular analysis at multiple loci revealed insufficient genetic diversity to distinguish terrestrial isolates from strains infecting marine mammals. Furthermore, SnSAG specific primers applied against DNA from the closely related species, Sarcocystis falcatula, lead to the discovery of highly similar orthologs to SnSAG2, 3, and 4, calling into question the specificity of diagnostic tests based on these antigens. The results of this study suggest a population genetic structure for S. neurona similar to that reported for the related parasite, Toxoplasma gondii, dominated by a limited number of successful genotypes. Published by Elsevier B.V.
Sagnac interferometer as a speed-meter-type, quantum-nondemolition gravitational-wave detector
International Nuclear Information System (INIS)
Chen Yanbei
2003-01-01
According to quantum measurement theory, 'speed meters' - devices that measure the momentum, or speed, of free test masses - are immune to the standard quantum limit (SQL). It is shown that a Sagnac-interferometer gravitational-wave detector is a speed meter and therefore in principle it can beat the SQL by large amounts over a wide band of frequencies. It is shown, further, that, when one ignores optical losses, a signal-recycled Sag nac interferometer with Fabry-Perot arm cavities has precisely the same performance, for the same circulating light power, as the Michelson speed-meter interferometer recently invented and studied by Purdue and the author. The influence of optical losses is not studied, but it is plausible that they be fairly unimportant for the Sag nac interferometer, as for other speed meters. With squeezed vacuum (squeeze factor e -2R =0.1) injected into its dark port, the recycled Sag nac interferometer can beat the SQL by a factor √(10)≅3 over the frequency band 10 Hz c ∼820 kw as is to be used by the (quantum limited) second-generation Advanced LIGO interferometers--if other noise sources are made sufficiently small. It is concluded that the Sag nac optical configuration, with signal recycling and squeezed-vacuum injection, is an attractive candidate for third-generation interferometric gravitational-wave detectors (LIGO-III and EURO)
Rowshanfarzad, Pejman; Häring, Peter; Riis, Hans L; Zimmermann, Sune J; Ebert, Martin A
2015-01-01
In radiotherapy treatments, it is crucial to monitor the performance of linac components including gantry, collimation system, and electronic portal imaging device (EPID) during arc deliveries. In this study, a simple EPID-based measurement method is suggested in conjunction with an algorithm to investigate the stability of these systems at various gantry angles with the aim of evaluating machine-related errors in treatments. The EPID sag, gantry sag, changes in source-to-detector distance (SDD), EPID and collimator skewness, EPID tilt, and the sag in leaf bank assembly due to linac rotation were separately investigated by acquisition of 37 EPID images of a simple phantom with five ball bearings at various gantry angles. A fast and robust software package was developed for automated analysis of image data. Three Siemens linacs were investigated. The average EPID sag was within 1 mm for all tested linacs. Two machines showed >1 mm gantry sag. Changes in the SDD values were within 7.5 mm. EPID skewness and tilt values were <1° in all machines. The maximum sag in leaf bank assembly was <1 mm. The method and software developed in this study provide a simple tool for effective investigation of the behavior of Siemens linac components with gantry rotation. Such a comprehensive study has been performed for the first time on Siemens machines.
Yang, Peng; Peng, Xiaomin; Cui, Shujuan; Shao, Junbin; Zhu, Xuping; Zhang, Daitao; Liang, Huijie; Wang, Quanyi
2013-07-30
Streptococcal superantigens (SAgs) are the major virulence factors of infection in humans for group A Streptococcus (GAS) bacteria. A panel consisting of seven duplex real-time PCR assays was developed to simultaneously detect 13 streptococcal SAgs and one internal control which may be important in the control of GAS-mediated diseases. Primer and probe sequences were selected based on the highly conserved region from an alignment of nucleotide sequences of the 13 streptococcal SAgs. The reaction conditions of the duplex real-time PCR were optimized and the specificity of the duplex assays was evaluated using SAg positive strains. The limit of detection of the duplex assays was determined by using 10-fold serial dilutions of the DNA of 13 streptococcal SAgs and compared to a conventional polymerase chain reaction (PCR) method for evaluating the duplex assays sensitivity. Using the duplex assays, we were able to differentiate between 13 SAgs from Streptococcus strains and other non-Streptococcus bacteria without cross-reaction. On the other hand, the limit of detection of the duplex assays was at least one or two log dilutions lower than that of the conventional PCR. The panel was highly specific (100%) and the limit of detection of these duplex groups was at least ten times lower than that obtained by using a conventional PCR method.
7 CFR 319.56-23 - Apricots, nectarines, peaches, plumcot, and plums from Chile.
2010-01-01
... organization of Chile (Servicio Agricola y Ganadero, referred to in this section as SAG) or a private export...) Responsibilities of Servicio Agricola y Ganadero. SAG will ensure that: (1) Apricots, nectarines, peaches, plumcot...
Evolutionary paths of streptococcal and staphylococcal superantigens
Directory of Open Access Journals (Sweden)
Okumura Kayo
2012-08-01
Full Text Available Abstract Background Streptococcus pyogenes (GAS harbors several superantigens (SAgs in the prophage region of its genome, although speG and smez are not located in this region. The diversity of SAgs is thought to arise during horizontal transfer, but their evolutionary pathways have not yet been determined. We recently completed sequencing the entire genome of S. dysgalactiae subsp. equisimilis (SDSE, the closest relative of GAS. Although speG is the only SAg gene of SDSE, speG was present in only 50% of clinical SDSE strains and smez in none. In this study, we analyzed the evolutionary paths of streptococcal and staphylococcal SAgs. Results We compared the sequences of the 12–60 kb speG regions of nine SDSE strains, five speG+ and four speG–. We found that the synteny of this region was highly conserved, whether or not the speG gene was present. Synteny analyses based on genome-wide comparisons of GAS and SDSE indicated that speG is the direct descendant of a common ancestor of streptococcal SAgs, whereas smez was deleted from SDSE after SDSE and GAS split from a common ancestor. Cumulative nucleotide skew analysis of SDSE genomes suggested that speG was located outside segments of steeper slopes than the stable region in the genome, whereas the region flanking smez was unstable, as expected from the results of GAS. We also detected a previously undescribed staphylococcal SAg gene, selW, and a staphylococcal SAg -like gene, ssl, in the core genomes of all Staphylococcus aureus strains sequenced. Amino acid substitution analyses, based on dN/dS window analysis of the products encoded by speG, selW and ssl suggested that all three genes have been subjected to strong positive selection. Evolutionary analysis based on the Bayesian Markov chain Monte Carlo method showed that each clade included at least one direct descendant. Conclusions Our findings reveal a plausible model for the comprehensive evolutionary pathway of streptococcal and
National Oceanic and Atmospheric Administration, Department of Commerce — Spur and groove (SAG) formations are found on the forereefs of many coral reefs worldwide. Modeling results have shown that SAG formations together with shoaling...
2011-02-17
... Management, Safety Assurance Group (SAG) is conducting an assessment of the Notice to Airmen (NOTAM... introduced into the NAS. In addition to on-site visits, the SOSM SAG audit team has prepared three surveys...
Directory of Open Access Journals (Sweden)
Norbert Stich
2014-05-01
Full Text Available Toxic shock syndrome (TSS results from the host’s overwhelming inflammatory response and cytokine storm mainly due to superantigens (SAgs. There is no effective specific therapy. Application of immunoglobulins has been shown to improve the outcome of the disease and to neutralize SAgs both in vivo and in vitro. However, in most experiments that have been performed, antiserum was either pre-incubated with SAg, or both were applied simultaneously. To mirror more closely the clinical situation, we applied a multiple dose (over five days lethal challenge in a rabbit model. Treatment with toxic shock syndrome toxin 1 (TSST-1 neutralizing antibody was fully protective, even when administered late in the course of the challenge. Kinetic studies on the effect of superantigen toxins are scarce. We performed in vitro kinetic studies by neutralizing the toxin with antibodies at well-defined time points. T-cell activation was determined by assessing T-cell proliferation (3H-thymidine incorporation, determination of IL-2 release in the cell supernatant (ELISA, and IL-2 gene activation (real-time PCR (RT-PCR. Here we show that T-cell activation occurs continuously. The application of TSST-1 neutralizing antiserum reduced IL-2 and TNFα release into the cell supernatant, even if added at later time points. Interference with the prolonged stimulation of proinflammatory cytokines is likely to be in vivo relevant, as postexposure treatment protected rabbits against the multiple dose lethal SAg challenge. Our results shed new light on the treatment of TSS by specific antibodies even at late stages of exposure.
Institute of Scientific and Technical Information of China (English)
GONG; Yuling; WANG; Liangshu; LIU; Shaowen; LI; Cheng; HAN
2004-01-01
Based on the geo-temperature data of 13 systematically continuous temperature log curves and 700 testing oil boreholes in Jiyang depression, Shengli Oilfield, and the measured thermal conductivities of 47 rock samples, the terrestrial heat flow densities of 114 boreholes of Jiyang depression and its surrounding areas are determined, including 13 of those data derived from systemically continuous temperature logging. The results show that Jiyang depression has a relatively high background heat flow with an average value (65.8 ± 5.4) mW/m2. The lateral variation of heat flow in basin has negative correlation with basement depth. Moreover, heat flow of uplift areas with shallower basement is high, so are those of regions with volcanic rocks, and those of depression areas with deep basement are relatively low. The heat flow densities of different structural units of Jiyang depression can be summarized as follows: The average heat flow value of Zhanhua sag is (67.4 ± 5.3) mW/m2, higher than that of the whole basin, that of Dongying sag is (66.0 ± 6.1) mW/m2, and that of Chezhen sag is (65.1 ± 3.7) mW/m2. It is apparent that these latter two values are approximate to the average value of the whole Jiyang depression,while the average value of Huimin sag is (63.6±5.0) mW/m2, lower than that of the whole basin. In fact, the basement depth and the distribution framework of uplift and depression areas are all controlled by the process of lithosphere extension. In addition, the distribution of volcanic rocks in basin is also relatively close to this extension geodynamic process. In summary, the distribution characteristics of terrestrial heat flow of Jiyang depression is determined by the Cenozoic tectono-thermal events of this region.
International Nuclear Information System (INIS)
Kandil, T.; Ayad, N.M.; Abdel Haleam, A.; Mahmoud, M.
2013-01-01
Egypt thermal research reactor (ETRR-2) was subjected to several Power Quality Problems such as voltage sags/swells, harmonics distortion, and short interruption. ETRR-2 encompasses a wide range of loads which are very sensitive to voltage variations and this leads to several unplanned shutdowns of the reactor due to trigger of the Reactor Protection System (RPS). The Dynamic Voltage Restorer (DVR) has recently been introduced to protect sensitive loads from voltage sags and other voltage disturbances. It is considered as one of the most efficient and effective solution. Its appeal includes smaller size and fast dynamic response to the disturbance. This paper describes a proposal of a DVR to improve power quality in ETRR-2 electrical distribution systems . The control of the compensation voltage is based on d-q-o algorithm. Simulation is carried out by Matlab/Simulink to verify the performance of the proposed method
Directory of Open Access Journals (Sweden)
Lakshman Naik Popavath
2018-04-01
Full Text Available The traditional configurations of power systems are changing due to the greater penetration of renewable energy sources (solar and wind, resulting in reliability issues. At present, the most severe power quality problems in distribution systems are current harmonics, reactive power demands, and the islanding of renewables caused by severe voltage variations (voltage sag and swell. Current harmonics and voltage sag strongly affect the performance of renewable-based power systems. Various conventional methods (passive filters, capacitor bank, and UPS are not able to mitigate harmonics and voltage sag completely. Based on several studies, custom power devices can mitigate harmonics completely and slightly mitigate voltage sags with reactive power supplies. To ensure the generating units remain grid-connected during voltage sags and to improve system operation during abnormal conditions, efficient and reliable utilization of PV solar farm inverter as STATCOMs is needed. This paper elaborates the dynamic performance of a VSC-based PV-STATCOM for power quality enhancement in a grid integrated system and low voltage ride through (LVRT capability. LVRT requirements suggest that the injection of real and reactive power supports grid voltage during abnormal grid conditions. The proposed strategy was demonstrated with MATLAB simulations.
Kim, Kyoung-Rok; An, Jung-Ung; Lee, Seon-Hwa; Oh, Deok-Kun
2015-01-01
Hydroxy fatty acids (HFAs) derived from omega-3 polyunsaturated fatty acids have been known as versatile bioactive molecules. However, its practical production from omega-3 or omega-3 rich oil has not been well established. In the present study, the stereo-selective enzymatic production of 9R-hydroxy-10E,12Z,15Z-octadecatrienoic acid (9R-HOTE) from α-linolenic acid (ALA) in perilla seed oil (PO) hydrolyzate was achieved using purified recombinant 9R-lipoxygenase (9R-LOX) from Nostoc sp. SAG 25.82. The specific activity of the enzyme followed the order linoleic acid (LA) > ALA > γ-linolenic acid (GLA). A total of 75% fatty acids (ALA and LA) were used as a substrate for 9R-LOX from commercial PO by hydrolysis of Candida rugosa lipase. The optimal reaction conditions for the production of 9R-HOTE from ALA using 9R-LOX were pH 8.5, 15°C, 5% (v/v) acetone, 0.2% (w/v) Tween 80, 40 g/L ALA, and 1 g/L enzyme. Under these conditions, 9R-LOX produced 37.6 g/L 9R-HOTE from 40 g/L ALA for 1 h, with a conversion yield of 94% and a productivity of 37.6 g/L/h; and the enzyme produced 34 g/L 9R-HOTE from 40 g/L ALA in PO hydrolyzate for 1 h, with a conversion yields of 85% and a productivity of 34 g/L/h. The enzyme also converted 9R-hydroxy-10E,12Z-octadecadienoic acid (9R-HODE) from 40 g/L LA for 1.0 h, with a conversion yield of 95% and a productivity of 38.4 g/L. This is the highest productivity of HFA from both ALA and ALA-rich vegetable oil using LOX ever reported. Therefore, our result suggests an efficient method for the production of 9R-HFAs from LA and ALA in vegetable oil using recombinant LOX in biotechnology.
A detailed comparison of system topologies for dynamic voltage restorers
DEFF Research Database (Denmark)
Nielsen, J.G.; Blaabjerg, Frede
2005-01-01
of energy storage, with energy taken from the grid during the voltage sag, and two topologies that take energy from stored energy devices during the voltage sag. Experimental tests using a 10-kVA DVR show that the no-energy storage concept is feasible, but an improved performance can be achieved for certain...... voltage sags using stored energy topologies. The results of this comparison rank the no-storage topology with a passive shunt converter on the load side first, followed by the stored energy topology with a constant dc-link voltage....
Salgado-Pabón, Wilmara; Breshears, Laura; Spaulding, Adam R; Merriman, Joseph A; Stach, Christopher S; Horswill, Alexander R; Peterson, Marnie L; Schlievert, Patrick M
2013-08-20
Infective endocarditis and kidney infections are serious complications of Staphylococcus aureus sepsis. We investigated the role of superantigens (SAgs) in the development of lethal sepsis, infective endocarditis, and kidney infections. SAgs cause toxic shock syndrome, but it is unclear if SAgs contribute to infective endocarditis and kidney infections secondary to sepsis. We show in the methicillin-resistant S. aureus strain MW2 that lethal sepsis, infective endocarditis, and kidney infections in rabbits are critically dependent on high-level SAgs. In contrast, the isogenic strain lacking staphylococcal enterotoxin C (SEC), the major SAg in this strain, is attenuated in virulence, while complementation restores disease production. SAgs' role in infective endocarditis appears to be both superantigenicity and direct endothelial cell stimulation. Maintenance of elevated blood pressure by fluid therapy significantly protects from infective endocarditis, possibly through preventing bacterial accumulation on valves and increased SAg elimination. These data should facilitate better methods to manage these serious illnesses. The Centers for Disease Control and Prevention reported in 2007 that Staphylococcus aureus is the most significant cause of serious infectious diseases in the United States (R. M. Klevens, M. A. Morrison, J. Nadle, S. Petit, K. Gershman, et al., JAMA 298:1763-1771, 2007). Among these infections are sepsis, infective endocarditis, and acute kidney injury. Infective endocarditis occurs in 30 to 60% of patients with S. aureus bacteremia and carries a mortality rate of 40 to 50%. Over the past decades, infective endocarditis outcomes have not improved, and infection rates are steadily increasing (D. H. Bor, S. Woolhandler, R. Nardin, J. Brusch, D. U. Himmelstein, PLoS One 8:e60033, 2013). There is little understanding of the S. aureus virulence factors that are key for infective endocarditis development and kidney abscess formation. We demonstrate that
Low VOC Barrier Coating for Industrial Maintenance
2012-09-01
VOC Total Solids (wt) Total Solids (volume) Percent Pigment Stormer Viscosity Brookfield Viscosity Pot Life Sag Resistance Theoretical...Percent Pigment – Stormer Viscosity – Brookfield Viscosity – Pot Life – Sag Resistance – Theoretical Coverage – Drying Times – Mixing Ratio
DEFF Research Database (Denmark)
Meyer, Christoph; De Doncker, Rik W.; Li, Yun Wei
2008-01-01
Most power quality problems in distribution systems are related to voltage sags. Therefore, different solutions have been examined to compensate these sags to avoid production losses at sensitive loads. Dynamic voltage restorers (DVRs) have been proposed to provide higher power quality. Currently......, a system wide integration of DVRs is hampered because of their high cost, in particular, due to the expensive DC-link energy storage devices. The cost of these DC-link capacitors remains high because the DVR requires a minimum DC-link voltage to be able to operate and to compensate a sag. As a result, only...... a small fraction of the energy stored in the DC-link capacitor is used, which makes it impractical for DVRs to compensate relatively long voltage sags. Present control strategies are only able to minimize the distortions at the load or to allow a better utilization of the storage system by minimizing...
Testing of the 3M Company ACCR Conductor
Energy Technology Data Exchange (ETDEWEB)
Stovall, J.P.; RIzy, D.T.; Kisner, R.A.; Deve, H.E. (3M Comp.)
2010-09-15
The 3M Company has developed a high-temperature low-sag conductor referred to as Aluminum- Conductor Composite-Reinforced or ACCR. The conductor uses an aluminum metal matrix material to replace the steel in conventional conductors so the core has a lower density and higher conductivity. The objective of this work is to accelerate the commercial acceptance by electric utilities of these new conductor designs by testing four representative conductor classes in controlled conditions. Overhead transmission lines use bare aluminum conductor strands wrapped around a steel core strands to transmit electricity. The typical cable is referred to as aluminum-conductor steel-reinforced (ACSR). The outer strands are aluminum, chosen for its conductivity, low weight, and low cost. The center strand is of steel for the strength required to support the weight without stretching the aluminum due to its ductility. The power density of a transmission corridor has been directly increased by increasing the voltage level. Transmission voltages have increased from 115-kV to 765- kV over the past 80 years. In the United States, further increasing the voltage level is not feasible at this point in time, so in order to further increase the power density of a transmission corridor, conductor designs that increase the current carrying capability have been examined. One of the key limiting factors in the design of a transmission line is the conductor sag which determines the clearance of the conductor above ground or underlying structures needed for electrical safety. Increasing the current carrying capability of a conductor increases the joule heating in the conductor which increases the conductor sag. A conductor designed for high-temperature and lowsag operation requires an engineered modification of the conductor materials. To make an advanced cable, the 3M Company solution has been the development of a composite conductor consisting of Nextel ceramic fibers to replace the steel core and
Hydrocarbon potential of a new Jurassic play, central Tunisia
International Nuclear Information System (INIS)
Beall, A.O.; Law, C.W.
1996-01-01
A largely unrecognized Jurassic Sag Basin has been identified in central Tunisia, proximal to the Permo-Carboniferous flexure delineating the northern boundary of the Saharan platform of north Africa. The northwestern margin of the Sag is delineated by an extensive region of salt-cored anticlines and localized salt diapirs extending north and west. Due to lack of deep drilling, delineation of the Sag is largely based on regional gravity data. Subsidence of the Jurassic Sag Basin is characterized by rapid expansion of Jurassic sediments from 400 m. of tidal flat and shelf carbonate at the western outcrop to over 2000 meters of tidal flat and basinal carbonate and shale within the basin center, a five-fold expansion. Rapid loading of the basin continued into Lower Cretaceous time, marked by lateral flowage of Triassic salt into pronounced structural trends. Published source rock data and interpreted subsurface well data provided the basis for GENEX 1-D hydrocarbon generation and expulsion modeling of the Sag. Middle Jurassic black source shales typically contain Type II and Type III kerogens with T.O.C.'s ranging up to 4 percent. Modeling results indicate that middle Jurassic shales are presently mature for liquid generation within portions of the Sag, with maximum generation taking place during the Tertiary. Potential hydrocarbon generation yields, based on 60 meters of mature source shale, are 20,000 BOE/acre for gas and 75,000 BOE/acre for liquids. Prospects within the region could contain an estimated potential reserve of several T.C.F. or over 1 billion barrels of oil
A study on the operation analysis of the power conditioning system with real HTS SMES coil
International Nuclear Information System (INIS)
Kim, A.R.; Jung, H.Y.; Kim, J.H.; Ali, Mohd. Hasan; Park, M.; Yu, I.K.; Kim, H.J.; Kim, S.H.; Seong, K.C.
2008-01-01
Voltage sag from sudden increasing loads is one of the major problems in the utility network. In order to compensate the voltage sag problem, power compensation devices have widely been developed. In the case of voltage sag, it needs an energy source to overcome the energy caused by voltage sag. According as the SMES device is characterized by its very high response time of charge and discharge, it has widely been researched and developed for more than 20 years. However, before the installation of SMES into utility, the system analysis has to be carried out with a certain simulation tool. This paper presents a real-time simulation algorithm for the SMES system by using the miniaturized SMES model coil whose properties are same as those of real size SMES coil. With this method, researchers can easily analyse the performance of SMES connected into utility network by abstracting the properties from the real modeled SMES coil and using the virtual simulated power network in RSCAD/RTDS
2010-09-09
... accordance with FAA Order JO 1030.4, ATO SysOps Services SMS Oversight, the FAA ATO System Operations Management, Safety Assurance Group (SAG) is conducting a comprehensive assessment of the Notice to Airmen... SAG audit team has prepared three surveys mirroring those sent by the Safety Support and Independent...
Pavlíková, Daniela; Zemanová, Veronika; Procházková, Dagmar; Pavlík, Milan; Száková, Jiřina; Wilhelmová, Naďa
2014-02-01
Increased endogenous plant cytokinin (CK) content through transformation with an isopentyl transferase (ipt) gene has been associated with improved plant stress tolerance. The objective of this study is to determine amino acid changes associated with elevated CK production in ipt transgenic tobacco (Nicotiana tabacum L., cv. Wisconsin 38). Nontransformed (WT) and transformed tobacco plants with ipt gene controlled by senescence-activated promoter (SAG) were exposed to zinc soil contamination (tested levels Zn1=250, Zn2=500, Zn3=750 mg kg(-1) soil). The Zn effect on plant stress metabolism resulted in changes in levels of selected free amino acids playing an important role in adaptation to stress and plant senescence (alanine, leucine, proline, methionine and γ-aminobutyrate) and differed for transformed and nontransformed tobacco plants. Analyses of amino acids confirmed that SAG tobacco plants had improved zinc tolerance compared with the WT plants. The enhanced Zn tolerance of SAG plants was associated with the maintenance of accumulation of proline, methionine and γ-aminobutyrate. The concentrations of leucine and alanine did not show significant differences between plant lines. © 2013 Published by Elsevier Inc.
Energy Technology Data Exchange (ETDEWEB)
Wilkins, Michael J.; Kennedy, David W.; Castelle, Cindy; Field, Erin; Stepanauskas, Ramunas; Fredrickson, Jim K.; Konopka, Allan
2014-02-09
Bacteria from the genus Pedobacter are a major component of microbial assemblages at Hanford Site and have been shown to significantly change in abundance in response to the subsurface intrusion of Columbia River water. Here we employed single cell genomics techniques to shed light on the physiological niche of these microorganisms. Analysis of four Pedobacter single amplified genomes (SAGs) from Hanford Site sediments revealed a chemoheterotrophic lifestyle, with the potential to exist under both aerobic and microaerophilic conditions via expression of both aa3-type and cbb3-type cytochrome c oxidases. These SAGs encoded a wide-range of both intra-and extra-cellular carbohydrate-active enzymes, potentially enabling the degradation of recalcitrant substrates such as xylan and chitin, and the utilization of more labile sugars such as mannose and fucose. Coupled to these enzymes, a diversity of transporters and sugar-binding molecules were involved in the uptake of carbon from the extracellular local environment. The SAGs were enriched in TonB-dependent receptors (TBDRs), which play a key role in uptake of substrates resulting from degradation of recalcitrant carbon. CRISPR-Cas mechanisms for resisting viral infections were identified in all SAGs. These data demonstrate the potential mechanisms utilized for persistence by heterotrophic microorganisms in a carbon-limited aquifer, and hint at potential linkages between observed Pedobacter abundance shifts within the 300 Area subsurface and biogeochemical shifts associated with Columbia River water intrusion.
Hariri, S; Abbasi, H R; Chin, S; Steinberg, G; Shahidi, R
2001-01-01
In the quest to develop a viable, frameless spinal navigation system, many researchers are utilizing the C-arm fluoroscope. However, there is a significant problem with the C-arm that must be quantified: the gravity-dependent sag effect resulting from the geometry of the C-arm and aggravated by the inequity of weight at each end of the C-arm. This study quantified the C-arm sag effect, giving researchers the protocol and data needed to develop a program that accounts for this distortion. The development of spinal navigation algorithms that account for the C-arm sag effect should produce a more accurate spinal navigation system.
Comparison of MARS-KS and SPACE for UPTF TRAM Loop Seal Clearing Experiment
Energy Technology Data Exchange (ETDEWEB)
Kim, Min Gil; Lee, Won Woong; Lee, Jeong Ik [KAIST, Daejeon (Korea, Republic of); Bang, Young Seok [KINS, Daejeon (Korea, Republic of)
2016-05-15
In this study, the authors assessed SPACE code, which was developed by a consortium led by Korea Hydro and Nuclear Power Co., Ltd. (KHNP), now in licensing process and MARS-KS code for UPTF TRAM loop seal clearing experiment to evaluate the code predictability regarding loop seal clearing for supporting the regulatory review. The sensitivity of PT/CT sagging contact angle has been studied. The results of sagging contact angle could explain in different ways. In the case of wide sagging contact angle, the result is quite conservative in the aspect of containment as the heat is well-transferred to moderator. it causes the moderator to heat up. On the other hand, the narrow sagging contact angle results fuel heatup and give limiting condition for fuel integrity. As a result of estimation, a proper application of sagging contact angle is required to provide limiting condition for subsequent analysis. The results from the two codes were compared to the experimental data, but due to the lack of information on the uncertainties it is too early to conclude the both code's performance. However, from the obtained analysis results, some differences between MARS-KS and SPACE are initially observed. Especially, SPACE has larger oscillation in the calculated mass flow rate value than MARS-KS. This phenomenon was observed in comparison of SPACE and MARS-KS CCFL model as well.
Rodak, L. E.; Kasarla, K. R.; Korakakis, D.
2007-08-01
The effect of gas flow on the selective area growth (SAG) of gallium nitride (GaN) grown via metal organic vapor phase epitaxy (MOVPE) has been investigated. In this study, the SAG of GaN was carried out on a silicon dioxide striped pattern along the GaN direction. SAG was initiated with the striped pattern oriented parallel and normal to the incoming gas flow in a horizontal reactor. The orientation of the pattern did not impact cross section of the structure after re-growth as both orientations resulted in similar trapezoidal structures bounded by the (0 0 0 1) and {1 1 2¯ n} facets ( n≈1.7-2.2). However, the growth rates were shown to depend on the orientation of the pattern as the normally oriented samples exhibited enhanced vertical and cross-sectional growth rates compared to the parallel oriented samples. All growths occurred under identical conditions and therefore the difference in growth rates must be attributed to a difference in mass transport of species.
Hecker, Yanina P; Cóceres, Verónica; Wilkowsky, Silvina E; Jaramillo Ortiz, José M; Morrell, Eleonora L; Verna, Andrea E; Ganuza, Agustina; Cano, Dora B; Lischinsky, Lilian; Angel, Sergio O; Zamorano, Patricia; Odeón, Anselmo C; Leunda, María R; Campero, Carlos M; Morein, Bror; Moore, Dadín P
2014-12-15
The aim of the present study was to evaluate the immunogenicity and protective efficacy of rNcSAG1, rNcHSP20 and rNcGRA7 recombinant proteins formulated with immune stimulating complexes (ISCOMs) in pregnant heifers against vertical transmission of Neospora caninum. Twelve pregnant heifers were divided into 3 groups of 4 heifers each, receiving different formulations before mating. Immunogens were administered twice subcutaneously: group A animals were inoculated with three recombinant proteins (rNcSAG1, rNcHSP20, rNcGRA7) formulated with ISCOMs; group B animals received ISCOM-MATRIX (without antigen) and group C received sterile phosphate-buffered saline (PBS) only. The recombinant proteins were expressed in Escherichia coli and purified nickel resin. All groups were intravenously challenged with the NC-1 strain of N. caninum at Day 70 of gestation and dams slaughtered at week 17 of the experiment. Heifers from group A developed specific antibodies against rNcSAG1, rNcHSP20 and rNcGRA7 prior to the challenge. Following immunization, an statistically significant increase of antibodies against rNcSAG1 and rNcHSP20 in all animals of group A was detected compared to animals in groups B and C at weeks 5, 13 and 16 (P0.001). There were no differences in IFN-γ production among the experimental groups at any time point (P>0.05). Transplacental transmission was determined in all foetuses of groups A, B and C by Western blot, immunohistochemistry and nested PCR. This work showed that rNcSAG1, rNcHSP20 and rNcGRA7 proteins while immunogenic in cattle failed to prevent the foetal infection in pregnant cattle challenged at Day 70 of gestation. Copyright © 2014 Elsevier B.V. All rights reserved.
Qin, J; Ma, X; Yi, Z; Tang, Z; Meng, Y
2016-03-01
Leaf senescence is an important physiological process during the plant life cycle. However, systemic studies on the impact of microRNAs (miRNAs) on the expression of senescence-associated genes (SAGs) are lacking. Besides, whether other Argonaute 1 (AGO1)-enriched small RNAs (sRNAs) play regulatory roles in leaf senescence remains unclear. In this study, a total of 5,123 and 1,399 AGO1-enriched sRNAs, excluding miRNAs, were identified in Arabidopsis thaliana and rice (Oryza sativa), respectively. After retrieving SAGs from the Leaf Senescence Database, all of the AGO1-enriched sRNAs and the miRBase-registered miRNAs of these two plants were included for target identification. Supported by degradome signatures, 200 regulatory pairs involving 120 AGO1-enriched sRNAs and 40 SAGs, and 266 regulatory pairs involving 64 miRNAs and 42 SAGs were discovered in Arabidopsis. Moreover, 13 genes predicted to interact with some of the above-identified target genes at protein level were validated as regulated by 17 AGO1-enriched sRNAs and ten miRNAs in Arabidopsis. In rice, only one SAG was targeted by three AGO1-enriched sRNAs, and one SAG was targeted by miR395. However, five AGO1-enriched sRNAs were conserved between Arabidopsis and rice. Target genes conserved between the two plants were identified for three of the above five sRNAs, pointing to the conserved roles of these regulatory pairs in leaf senescence or other developmental procedures. Novel targets were discovered for three of the five AGO1-enriched sRNAs in rice, indicating species-specific functions of these sRNA-target pairs. These results could advance our understanding of the sRNA-involved molecular processes modulating leaf senescence. © 2015 German Botanical Society and The Royal Botanical Society of the Netherlands.
The Effects of Multi-Age Grouping on Young Children and Teacher Preparation.
Jensen, Melanie K.; Green, Virginia P.
1993-01-01
This literature review on the effects of multiage groupings (MAGs) in the primary grades supports their use and argues that children in MAGs perform as well academically as children in single-age groupings (SAGs) and develop better self-concept and school attitudes than children in SAGs. Expresses concerns over lack of training and support for…
Directory of Open Access Journals (Sweden)
Miska Prasad
2016-12-01
Full Text Available The voltage events namely voltage sags and voltage swells represent the most common, frequent and important power quality events in today’s power system. Dynamic voltage restorer (DVR is one of the key components used to mitigate the supply voltage quality disturbances in terms of voltage sags and swells in the distribution system. It consists of an energy storage unit, a voltage source inverter, a filter, a coupling transformer and the control system. This paper presents three different inverter configurations of dynamic voltage restorer (DVR for mitigation of voltage events such as voltage sags and swells with sudden addition or removal of the nonlinear load. These three configurations are voltage source inverter based DVR (VSI-DVR, current source inverter based DVR (CSI-DVR and impedance or Z-source inverter based DVR (ZSI-DVR. The d-q control technique is used to control the operation of the DVR. The response of ZSI-DVR for mitigation of voltage sags and swells are investigated and compared with VSI-DVR and CSI-DVR using MATLAB/SIMULINK environment.
Jian, Le; Cao, Wang; Jintao, Yang; Yinge, Wang
2018-04-01
This paper describes the design of a dynamic voltage restorer (DVR) that can simultaneously protect several sensitive loads from voltage sags in a region of an MV distribution network. A novel reference voltage calculation method based on zero-sequence voltage optimisation is proposed for this DVR to optimise cost-effectiveness in compensation of voltage sags with different characteristics in an ungrounded neutral system. Based on a detailed analysis of the characteristics of voltage sags caused by different types of faults and the effect of the wiring mode of the transformer on these characteristics, the optimisation target of the reference voltage calculation is presented with several constraints. The reference voltages under all types of voltage sags are calculated by optimising the zero-sequence component, which can reduce the degree of swell in the phase-to-ground voltage after compensation to the maximum extent and can improve the symmetry degree of the output voltages of the DVR, thereby effectively increasing the compensation ability. The validity and effectiveness of the proposed method are verified by simulation and experimental results.
Zhou, D.; Sun, Z.; Pang, X.; Wu, X.; Xu, H.; Qiu, N.
2011-12-01
With the advance of hydrocarbon exploration into deep waters of the northern SCS, structural details from continental slope to deepsea basin have been revealed. A striking feature is the dramatic change in Cenozoic extension along and across the strike as well as with the time. Along strike the slope is seperated by lithospheric faults into segments with different amount of Cenozoic extension. The breakup occurred in the no-extension eastern segment (the Chaoshan depression), the most strongly extended central segment (the Baiyun sag) but failed in the western segment of intermediate extension (the Qingdongnan basin). This pattern violates the expectation that breakup occurs at first where the extension reached the maximum. In the central segment, the style of extension varies significantly in dip direction. Differing from the belts of half grabens in the shelf, the extension is expressed as a large downwarp (the Baiyun sag) in the slope, and as irregularly shaped sags (the Liwan sag) near the continental-oceanic boundary (COB). The Baiyun sag (BYS) is the largest and deepest sag in the Pearl River Mouth basin (PRMB). Long-cable MCS revealed that at the center of the BYS the crust thinned to Mexico where thrust belts developed by gravitational sliding. Multi-staged magmatic activities have contributed to but could not fully explain the structural complexities of the LWS. Perhaps basement structures have played an important role as the sag might be developed upon the relict Mesozoic West Pacific subduction system. In addition, two horizons of deep-seated waving reflectors are identified beneath the LWS, which are suspected to be respectively a detachment surface and the intra-crustal shear zones related to lower-crust flow. A good understanding of these features may help answering the fundamental question on what controls the style, magnitude, and segmentation of passive margin extension and breakup, what is the mechanism, and what differences between marginal sea
Kim, Yeong Hoon; Bhatt, Lokraj; Ahn, Hye-Jin; Yang, Zhaoshou; Lee, Won-Kyu; Nam, Ho-Woo
2017-10-01
The effects of tyrosine kinase inhibitors (TKIs) were evaluated on growth inhibition of intracellular Toxoplasma gondii in host ARPE-19 cells. The number of tachyzoites per parasitophorous vacuolar membrane (PVM) was counted after treatment with TKIs. T. gondii protein expression was assessed by western blot. Immunofluorescence assay was performed using Programmed Cell Death 4 (PDCD4) and T. gondii GRA3 antibodies. The TKIs were divided into 3 groups; non-epidermal growth factor receptor (non-EGFR), anti-human EGFR 2 (anti-HER2), and anti-HER2/4 TKIs, respectively. Group I TKIs (nintedanib, AZD9291, and sunitinib) were unable to inhibit proliferation without destroying host cells. Group II TKIs (lapatinib, gefitinib, erlotinib, and AG1478) inhibited proliferation up to 98% equivalent to control pyrimethamine (5 μM) at 20 μM and higher, without affecting host cells. Group III TKIs (neratinib, dacomitinib, afatinib, and pelitinib) inhibited proliferation up to 98% equivalent to pyrimethamine at 1-5 μM, but host cells were destroyed at 10-20 μM. In Group I, TgHSP90 and SAG1 inhibitions were weak, and GRA3 expression was moderately inhibited. In Group II, TgHSP90 and SAG1 expressions seemed to be slightly enhanced, while GRA3 showed none to mild inhibition; however, AG1478 inhibited all proteins moderately. Protein expression was blocked in Group III, comparable to pyrimethamine. PDCD4 and GRA3 were well localized inside the nuclei in Group I, mildly disrupted in Group II, and were completely disrupted in Group III. This study suggests the possibility of a vital T. gondii TK having potential HER2/4 properties, thus anti-HER2/4 TKIs may inhibit intracellular parasite proliferation with minimal adverse effects on host cells.
Evaluation of effects of platelet-rich plasma on human facial skin.
Yuksel, Esra Pancar; Sahin, Gokhan; Aydin, Fatma; Senturk, Nilgun; Turanli, Ahmet Yasar
2014-10-01
Platelet-rich plasma (PRP) has been used for rapid healing and tissue regeneration in many fields of medicine. This study was conducted to evaluate the effects of PRP application procedure on human facial skin. PRP was applied thrice at 2-week intervals on the face of ten healthy volunteers. It was applied to individual's forehead, malar area, and jaw by a dermaroller, and injected using a 27-gauge injector into the wrinkles of crow's feet. Participants were asked to grade on a scale from 0 to 5 for general appearance, skin firmness-sagging, wrinkle state and pigmentation disorder of their own face before each PRP procedure and 3 months after the last PRP procedure. While volunteers were evaluating their own face, they were also assessed by three different dermatologists at the same time by the same five-point scale. There was statistically significant difference regarding the general appearance, skin firmness-sagging and wrinkle state according to the grading scale of the patients before and after three PRP applications. Whereas there was only statistically significant difference for the skin firmness-sagging according to the assessment of the dermatologists. PRP application could be considered as an effective procedure for facial skin rejuvenation.
International Nuclear Information System (INIS)
Hildmann, Christian
2016-01-01
In Germany and in Europe it is due to the ''Energiewende'' necessary to transmit more electrical energy with existing overhead transmission lines. One possible technical solution to reach this aim is the use of high temperature low sag conductors (HTLS-conductors). Compared to the common Aluminium Conductor Steel Reinforced (ACSR), HTLS-conductors have higher rated currents and rated temperatures. Thus the electrical connections for HTLS-conductors are stressed to higher temperatures too. These components are most important for the safe and reliable operation of an overhead transmission line. Besides other connection technologies, hexagonal compression connections with ordinary transmission line conductors have proven themselves since decades. From the literature, mostly empirical studies with electrical tests for compression connections are known. The electrical contact behaviour, i.e. the quality of the electrical contact after assembly, of these connections has been investigated insufficiently. This work presents and enhances an electrical model of compression connections, so that the electrical contact behaviour can be determined more accurate. Based on this, principal considerations on the current distribution in the compression connection and its influence on the connection resistance are presented. As a result from the theoretical and the experimental work, recommendations for the design of hexagonal compression connections for transmission line conductors were developed. Furthermore it is known from the functional principle of compression type connections, that the electrical contact behaviour can be influenced from their form fit, force fit and cold welding. In particular the forces in compression connections have been calculated up to now by approximation. The known analytical calculations simplify the geometry and material behaviour and do not consider the correct mechanical load during assembly. For these reasons the joining process
Dynamic Performance Evaluation of PV Integration
Gao, Ruilin; Jiang, Anwen; Chen, Hongjin
2018-03-01
Topics on adaptability of Grid-connected photovoltaic systems (GCPVS) under sag conditions has been proposed. A basic low-voltage-ride-through (LVRT) strategy widely used in engineering practice is taken in this paper and manages to ride through different sag conditions. The role of hardware protection has been discussed in detail. By simulation validated that the proposed GCPVS have strong adaptability
Pan, L., Sr.; Ren, J.
2017-12-01
The South China Sea (SCS) is one of the largest marginal sea on southeast Asia continental margin, developed Paleogene extension-rifting continental margin system which is rare in the world and preserving many deformed characterizes of this kind system. With the investigation of the SCS, guiding by the development of tectonics and geo-physics, especially the development of tectonics and the high quality seismic data based on the development of geo-physics, people gradually accept that the northern margin of the SCS has some detachment basin characterizes. After researching the northern margin of the SCS, we come up with lithosphere profiles across the shelf, slope and deep sea basin in the northeast of the SCS to confirm the tectonic style of ocean-continental transition and the property of the detachment fault. Furthermore, we describe the outline of large detachment basins at northern SCS. Based on the large number of high-quality 2D and 3D deep seismic profile(TWT,10s), drilling and logging data, combined with domestic and international relevant researches, using basin dynamics and tectono-stratigraphy theory, techniques and methods of geology and geophysics, qualitative and quantitative, we describe the formation of the detachment basin and calculate the fault activity rate, stretching factor and settlement. According to the research, we propose that there is a giant and complete detachment basin system in the northern SCS and suggest three conclusions. First of all, the detachment basin system can be divided into three domains: proximal domain covering the Yangjiang Sag, Shenhu uplift and part of Shunde Sag, necking zone covering part of the Shunde Sag and Heshan Sag, distal domain covering most part of Heshan Sag. Second, the difference of the stretching factor is observed along the three domains of the detachment basin system. The factor of the proximal domain is the minimum among them. On the other side, the distal domain is the maximum among them. This
Barbosa, Lorraine; Johnson, Christine K; Lambourn, Dyanna M; Gibson, Amanda K; Haman, Katherine H; Huggins, Jessica L; Sweeny, Amy R; Sundar, Natarajan; Raverty, Stephen A; Grigg, Michael E
2015-08-01
Sarcocystis neurona is an important cause of protozoal encephalitis among marine mammals in the northeastern Pacific Ocean. To characterise the genetic type of S. neurona in this region, samples from 227 stranded marine mammals, most with clinical or pathological evidence of protozoal disease, were tested for the presence of coccidian parasites using a nested PCR assay. The frequency of S. neurona infection was 60% (136/227) among pinnipeds and cetaceans, including seven marine mammal species not previously known to be susceptible to infection by this parasite. Eight S. neurona fetal infections identified this coccidian parasite as capable of being transmitted transplacentally. Thirty-seven S. neurona-positive samples were multilocus sequence genotyped using three genetic markers: SnSAG1-5-6, SnSAG3 and SnSAG4. A novel genotype, referred to as Type XIII within the S. neurona population genetic structure, has emerged recently in the northeastern Pacific Ocean and is significantly associated with an increased severity of protozoal encephalitis and mortality among multiple stranded marine mammal species. Published by Elsevier Ltd.
Local administration of a hedgehog agonist accelerates fracture healing in a mouse model
International Nuclear Information System (INIS)
Kashiwagi, Miki; Hojo, Hironori; Kitaura, Yoshiaki; Maeda, Yujiro; Aini, Hailati; Takato, Tsuyoshi; Chung, Ung-il; Ohba, Shinsuke
2016-01-01
Bone fracture healing is processed through multiple biological stages including the transition from cartilaginous callus to bony callus formation. Because of its specific, temporal and indispensable functions demonstrated by mouse genetic studies, Hedgehog (Hh) signaling is one of the most potent signaling pathways involved in these processes, but the effect of Hh-signaling activation by small compounds on the repair process had not yet been addressed. Here we examined therapeutic effects of local and one shot-administration of the Hh agonist known as smoothened agonist (SAG) on bone fracture healing in a mouse model. A quantitative analysis with three-dimensional micro-computed tomography showed that SAG administration increased the size of both the cartilaginous callus and bony callus at 14 days after the surgery. A histological analysis showed that SAG administration increased the number of cells expressing a proliferation marker and a chondrocyte marker in cartilaginous callus as well as the cells expressing an osteoblast marker in bony callus. These results indicate that the SAG administration resulted in an enhancement of callus formation during bone fracture healing, which is at least in part mediated by an increase in chondrocyte proliferation in cartilaginous callus and the promotion of bone formation in bony callus. Therapeutic strategies with a SAG-mediated protocol may thus be useful for the treatment of bone fractures. - Highlights: • Local administration of a Hh agonist accelerates callus formation. • The Hh agonist administration promotes chondrocyte proliferation in the soft callus. • The Hh agonist administration increases osteoblast formation in the hard callus.
Zhao, J-L; Ding, Y-X; Zhao, H-X; He, X-L; Li, P-F; Li, Z-F; Guan, H; Guo, X
2014-10-11
Clinical endometritis is an important disease of dairy cattle and results in decreased reproductive performance. This disease is caused by contamination of the uterus with a broad spectrum of microorganisms after calving. In this study, staphylococcal isolates from the uterus of dairy cows with clinical endometritis were tested for their distribution of superantigen (SAg) genes and antimicrobial resistance. Between the 127 staphylococcal isolates collected in this study, 10 species were identified. The predominant strain identified was Staphylococcus aureus (n=53), followed by Staphylococcus saprophyticus (n=38) and Staphylococcus chromogenes (n=22). PCR analysis demonstrated that most isolates (63.0 per cent) harboured at least one SAg gene. The most commonly observed SAg gene and genotype was selj (38.6 per cent) and sec-selj-seln (24.0 per cent), respectively. Most isolates were resistant to penicillin (79.5 per cent), ampicillin (71.7 per cent), erythromycin (56.7 per cent), and tetracycline (52.0 per cent). PCR analysis demonstrated that the antimicrobial resistance determinants ermA, ermB, ermC, tetK, tetM and blaZ were detected in 0 per cent, 44.4 per cent, 51.4 per cent, 68.2 per cent, 13.6 per cent and 86.1 per cent of the erythromycin, tetracycline and β-lactam resistant isolates, respectively. There were 22 (17.3 per cent of all isolates) coagulase-negative staphylococci shown to be methicillin resistant. In the methicillin-resistant isolates, significant resistances to ampicillin, erythromycin and penicillin were observed (P<0.01). The results of this study demonstrate that staphylococci recovered from dairy cows with clinical endometritis contain an extensive and complex prevalence of SAg genes. Significant resistances to antibiotics were also seen, highlighting the need for the rational appliance of antibiotics in veterinary medicine. British Veterinary Association.
Instituições, Território e Sistemas Agroindustriais: uma proposta de análise histórico-comparativa
Directory of Open Access Journals (Sweden)
Marlon Vinícius Brisola
2015-06-01
Full Text Available Resumo A política de Estado que prioriza a produção e a exportação de produtos agropecuários in natura ou semi-processados tem sido a tônica de alguns países, especialmente, Brasil, Argentina, Uruguai, Chile e Colômbia, na América Latina. Nesses espaços, os Sistemas Agroindustriais (SAGs representam importantes campos de análise econômica, política e social, demarcando o grau de desenvolvimento de determinados territórios ou populações. Uma das características dos SAGs é a constituição de redes que têm diferentes níveis de consolidação e especificidades, em função da complexidade das atividades de processamento, do nível de incertezas mercadológicas e da estrutura concorrencial. Contudo, distinções entre SAGs de produtos adversos ou concorrentes, ou entre diferentes territórios onde atuam um mesmo SAG, podem ser observadas e, tais diferenças, podem estar relacionadas a diferentes constituições institucionais que os regem. Partindo dessa premissa, propõe-se este estudo ao sugerir a utilização da técnica QCA (Qualitative Comparative Analysis associada à análise histórico-comparativa de casos como método para o entendimento dos efeitos da evolução institucional territorial sobre o desempenho econômico dos SAGs. O mesmo método foi utilizado por Brisola (2013 para analisar o padrão de relação entre o Estado e as associações empresariais industriais, no Brasil e na Argentina, no período entre 1956 e 1978, e compará-lo ao seu impacto sobre o upgrading industrial, em cada um destes países. A replicação do método e a sua discussão passa pela definição conceitual das dimensões do estudo, bem como pela caracterização dos indicadores que as suportam, utilizando como casos os marcos político-temporais que retratam as diferentes constituições institucionais dos territórios sob análise. Espera-se, como resultado, encontrar, com a aplicação dessa metodologia, melhores interpretações das
Energy Technology Data Exchange (ETDEWEB)
Conceicao, Claudio Alvares; Jesus, Edmundo Goncalves de [PETROBRAS, Betim, MG (Brazil). Refinaria Gabriel Passos - REGAP; Cardoso Filho, Braz de Jesus; Silva, Selenio Rocha [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)
2006-05-15
The objective of the present study has been to identify equipment or systems sensitive to voltage sag, as well as to develop an appropriate solution for minimizing this sensibility. The presented proposal allows to the electric system of a petroleum refinery continues operating in spite of a momentary voltage sag, during an interval of enough time to support the phenomenon and to maintain the operational continuity.
Discrete element simulation of mill charge in 3D using the BLAZE-DEM GPU framework
CSIR Research Space (South Africa)
Govender, Nicolin
2015-08-01
Full Text Available The Discrete Element Method (DEM) simulation of charge motion in ball, semi autogenous (SAG) and autogenous mills has advanced to a stage where the effects of lifter design, power draft and product size can be evaluated with sufficient accuracy...
Magnetic design considerations for the SSC vertical bending (BV1C) magnet
International Nuclear Information System (INIS)
Venkatraman, V.; Goodzeit, C.; Jayakumar, R.; Nobrega, F.; Snitchler, G.
1994-01-01
The BV1C magnet is a large aperture, vertical bending magnet to be used to bend proton beams in the interaction region. An aperture larger than 80 mm is required. The central field has to be a minimum of 6T with a 10% margin. The lattice requirements for field quality are stringent because two counter beams traverse this magnet off the center axis. This magnet's transfer function sag is specified to match closely the transfer function sag of the low beta quadrupoles. With these specifications in mind, suitable designs for the 2-D magnetic cross-sections have been analyzed
Benchmarking of Voltage Sag Generators
DEFF Research Database (Denmark)
Yang, Yongheng; Blaabjerg, Frede; Zou, Zhixiang
2012-01-01
The increased penetration of renewable energy systems, like photovoltaic and wind power systems, rises the concern about the power quality and stability of the utility grid. Some regulations for Low Voltage Ride-Through (LVRT) for medium voltage or high voltage applications, are coming into force...
DEFF Research Database (Denmark)
Søltoft, Pia
2016-01-01
I modsætning til ironi er humor for Kierkegaard fællesskabsgivende – ironikeren hævder sig selv, men humoristen har sympati med den, man ler med. Humor er hos Kierkegaard udtryk for, at humoristen forliger sig med tilværelsen og dens luner, og dermed grænser humoren hos Kierkegaard op til det...
International Nuclear Information System (INIS)
Barashkov, A.V.; Glonti, G.L.; Gongadze, A.L.; Gostkin, M.I.; Gus'kov, A.V.; Dedovich, D.V.; Demichev, M.A.; Zhemchugov, A.S.; Il'yushenko, E.N.; Kotov, S.A.; Korolevich, Ya.V.; Kruchonok, V.G.; Krumshtejn, Z.V.; Kuznetsov, N.K.; Lomidze, D.D.; Potrap, I.N.; Kharchenko, D.V.; Tskhadadze, Eh.G.; Chepurnov, V.F.; Shelkov, G.A.; Podkladkin, S.Yu.; Sekhniaidze, G.G.
2005-01-01
The common support system for muon BMS/BMF drift chambers with trigger RPC chambers for the muon spectrometer of the ATLAS experiment is described. The support systems are intended for the chambers integration into combined modules and for the subsequent installation in the experimental set-up. The technology of chambers integration is described. The sagging of the drift chambers was tested by tilting the modules at different angles. The measurements were performed by means of the RASNIK optical system. The normal operation of kinematic supports was confirmed. We also present the method of the sag regulation for the BMS/BMF chambers lying in the horizontal plane which provides the minimum difference between signal wire and detector tube body sags when the modules are later installed in their working positions
Directory of Open Access Journals (Sweden)
Zhang Gongcheng
2014-10-01
Full Text Available The Oligocene Yacheng Fm contains the most important source rocks that have been confirmed by exploratory wells in the Qiongdongnan Basin. The efficiency of these source rocks is the key to the breakthrough in natural gas exploration in the study area. This paper analyzes the hydrocarbon potential of each sag in this basin from the perspective of control of both source rocks and geothermal heat. Two types of source rocks occur in the Yacheng Fm, namely mudstone of transitional facies and mudstone of neritic facies. Both of them are dominated by a kerogen of type-III, followed by type-II. Their organic matter abundances are controlled by the amount of continental clastic input. The mudstone of transitional facies is commonly higher in organic matter abundance, while that of neritic facies is lower. The coal-measure source rocks of transitional facies were mainly formed in such environments as delta plains, coastal plains and barrier tidal flat-marshes. Due to the control of Cenozoic lithosphere extension and influence of neotectonism, the geothermal gradient, terrestrial heat flow value (HFV and level of thermal evolution are generally high in deep water. The hot setting not only determines the predominance of gas generation in the deep-water sags, but can promote the shallow-buried source rocks in shallow water into oil window to generate oil. In addition to promoting the hydrocarbon generation of source rocks, the high geothermal and high heat flow value can also speed up the cracking of residual hydrocarbons, thus enhancing hydrocarbon generation efficiency and capacity. According to the theory of joint control of source quality and geothermal heat on hydrocarbon generation, we comprehensively evaluate and rank the exploration potentials of major sags in the Qiongdongnan Basin. These sags are divided into 3 types, of which type-I sags including Yanan, Lingshui, Baodao, Ledong and Huaguang are the highest in hydrocarbon exploration potential.
DNA immunisation. New histochemical and morphometric data
Directory of Open Access Journals (Sweden)
D Ehirchiou
2010-01-01
Full Text Available Splenic germinal center reactions were measured during primary response to a plasmidic DNA intramuscular injection. Cardiotoxin-pretreated Balb/c mice were immunized with DNA plasmids encoding or not the SAG1 protein, a membrane antigen of Toxoplasma gondii. Specific anti-SAG1 antibodies were detected on days 16 and 36 after injection of coding plasmids. The results of ELISAs showed that the SAG1-specific antibodies are of the IgG2a class. Morphometric analyses were done on serial immunostained cryosections of spleen and draining or non-draining lymph nodes. This new approach made it possible to evaluate the chronological changes induced by DNA immunisation in the germinal centres (in number and in size. Significant increases in the number of germinal centres were measured in the spleen and only in draining lymph nodes after plasmid injection. the measured changes of the germinal centers appeared to result from the adjuvant stimulatory effect of the plasmidic DNA since both the coding and the noncoding plasmid DNA induced them. No measurable changes were recorded in the Tdependent zone of lymph organs.
Pridgeon, Julia W; Klesius, Phillip H
2013-05-31
To develop attenuated bacteria as potential live vaccines, sparfloxacin was used in this study to modify 40 isolates of Streptococcus agalactiae. Majority of S. agalactiae used in this study were able to develop at least 80-fold resistance to sparfloxacin. When the virulence of the sparfloxacin-resistant S. agalactiae isolates were tested in 10-12g Nile tilapia by intraperitoneal injection at dose of 2×10(7)CFU/fish, 31 were found to be avirulent to fish. Of the 31 avirulent sparfloxacin-resistant S. agalactiae isolates, 30 provided 75-100% protection to 10-12g Nile tilapia against challenges with a virulent S. agalactiae isolate Sag 50. When the virulence of the 30 sparfloxacin-resistant S. agalactiae isolates was tested in 3-5g Nile tilapia by intraperitoneal injection at dose of 2×10(7)CFU/fish, six were found to be avirulent to 3-5g Nile tilapia. Of the six avirulent sparfloxacin-resistant S. agalactiae isolates, four provided 3-5g Nile tilapia 100% protection against challenges with homologous isolates, including Sag 97-spar isolate that was non-hemolytic. However, Sag 97-spar failed to provide broad cross-protection against challenges with heterologous isolates. When Nile tilapia was vaccinated with a polyvalent vaccine consisting of 30 sparfloxacin-resistant S. agalactiae isolates at dose of 2×10(6)CFU/fish, the polyvalent vaccine provided significant (PS. agalactiae. Taken together, our results suggest that a polyvalent vaccine consisting of various strains of S. agalactiae might be essential to provide broader protection to Nile tilapia against infections caused by S. agalactiae. Published by Elsevier Ltd.
Slight rise possible in U.S. drilling; Canadian action sags
International Nuclear Information System (INIS)
Petzet, G.A.; Beck, R.J.
1996-01-01
The low level of US drilling evident in 1995 is likely to continue into 1996. Anticipated increases in the average prices of crude oil and natural gas will sustain only about a 2% increase in the number of wells drilled year to year in the US. A second year of decline can be expected in Canada from 1993's historic high, but total drilling will remain above the average of well counts for the past 10 years. Here are the main points of OGJ's early year drilling forecast for 1996: (1) Operators will drill 21,800 wells, compared with the 21,300 OGJ estimates they drilled in 1995. (2) The active rotary rig count will average 750, up 14% from 1995. (3) Operators will drill 3,300 exploratory wells of all types, up from 3,119 last year. (4) A surveyed group of major operators will drill 2,551 wells during the year, down from the 2,920 wells the same group operated in 1995. The 1996 figures includes 245 exploratory wells of all types, up from 219 last year. Meanwhile, drilling in western Canada will total 9,375 wells, down 12% from 1995 but still a healthy number historically. This paper provides exploration statistics for both the US and Canada and is broken down by state and province. It gives data on both exploratory and development wells. Data is also broken down by specific field
Verification of aspheric contact lens back surfaces.
Dietze, Holger H; Cox, Michael J; Douthwaite, William A
2003-08-01
To suggest a tolerance level for the degree of asphericity of aspheric rigid gas-permeable contact lenses and to find a simple method for its verification. Using existing tolerances for the vertex radius, tolerance limits for eccentricity and p values and were calculated. A keratometer-based method and a method based on sag measurements were used to measure the vertex radius and eccentricity of eight concave progressively aspheric surfaces and six concave ellipsoidal surfaces. The results were compared with a gold standard measurement made using a high-precision mechanical instrument (Form Talysurf). The suggested tolerance for eccentricity and p value and is +/-0.05. The keratometer method was very accurate and precise at measuring the vertex radius (mean deviation +/- SD from Talysurf results, -0.002 +/- 0.008 mm). The keratometer was more precise than and similar in accuracy to the sag method for measurement of asphericity (mean deviation of keratometer method results from Talysurf results, 0.017 +/- 0.018; mean deviation of sag method results from Talysurf results using five semichords, -0.016 +/- 0.032). Neither method was precise enough to verify the asphericity within the suggested tolerance. The keratometer can be efficiently used to verify the back vertex radius within its International Organization for Standardization tolerance and the back surface asphericity within an eccentricity/p value tolerance of +/-0.1. The method is poor for progressive aspheres with large edge blending zones. Deriving the eccentricity from sag measurements is a potential alternative if the mathematical description of the surface is known. The limiting factor of this method is the accuracy and precision of individual sag measurements.
Directory of Open Access Journals (Sweden)
David Carmena
2005-12-01
Full Text Available Hydatid cyst fluid (HCF, somatic antigens (S-Ag and excretory-secretory products (ES-Ag of Echinococcus granulosus protoscoleces are used as the main antigenic sources for immunodiagnosis of human and dog echinococcosis. In order to determine their non-shared as well as their shared antigenic components, these extracts were studied by ELISA-inhibition and immunoblot-inhibition. Assays were carried out using homologous rabbit polyclonal antisera, human sera from individuals with surgically confirmed hydatidosis, and sera from dogs naturally infected with E. granulosus. High levels of cross-reactivity were observed for all antigenic extracts, but especially for ES-Ag and S-Ag. Canine antibodies evidenced lesser avidity for their specific antigens than antibodies from human origin. The major antigenic components shared by HCF, S-Ag, and ES-Ag have apparent molecular masses of 4-6, 20-24, 52, 80, and 100-104 kDa, including doublets of 41/45, 54/57, and 65/68 kDa. Non-shared polypeptides of each antigenic extract of E. granulosus were identified, having apparent masses of 108 and 78 kDa for HCF, of 124, 94, 83, and 75 kDa for S-Ag, and of 89, 66, 42, 39, 37, and 35 kDa for ES-Ag.
DEFF Research Database (Denmark)
Zhao, Xin; Firoozabadi, Mehdi Savaghebi; Quintero, Juan Carlos Vasquez
2015-01-01
. In this paper, a voltage support strategy based on negative sequence droop control, which regulate the positive/negative sequence active and reactive power flow by means of sending proper voltage reference to the inner control loop, is proposed for the grid connected MGs to ride through voltage sags under...... complex line impedance conditions. In this case, the MGs should inject a certain amount of positive and negative sequence power to the grid so that the voltage quality at load side can be maintained at a satisfied level. A two layer hierarchical control strategy is proposed in this paper. The primary...... control loop consists of voltage and current inner loops, conventional droop control and virtual impedance loop while the secondary control loop is based on positive/negative sequence droop control which can achieve power injection under voltage sags. Experimental results with asymmetrical voltage sags...
Zou, Zhi; Huang, Qixing; Xie, Guishui; Yang, Lifu
2018-01-10
Papain-like cysteine proteases (PLCPs) are a class of proteolytic enzymes involved in many plant processes. Compared with the extensive research in Arabidopsis thaliana, little is known in castor bean (Ricinus communis) and physic nut (Jatropha curcas), two Euphorbiaceous plants without any recent whole-genome duplication. In this study, a total of 26 or 23 PLCP genes were identified from the genomes of castor bean and physic nut respectively, which can be divided into nine subfamilies based on the phylogenetic analysis: RD21, CEP, XCP, XBCP3, THI, SAG12, RD19, ALP and CTB. Although most of them harbor orthologs in Arabidopsis, several members in subfamilies RD21, CEP, XBCP3 and SAG12 form new groups or subgroups as observed in other species, suggesting specific gene loss occurred in Arabidopsis. Recent gene duplicates were also identified in these two species, but they are limited to the SAG12 subfamily and were all derived from local duplication. Expression profiling revealed diverse patterns of different family members over various tissues. Furthermore, the evolution characteristics of PLCP genes were also compared and discussed. Our findings provide a useful reference to characterize PLCP genes and investigate the family evolution in Euphorbiaceae and species beyond.
Thermodynamic properties of solid solutions in the system Ag2S–Ag2Se
International Nuclear Information System (INIS)
Pal’yanova, G.A.; Chudnenko, K.V.; Zhuravkova, T.V.
2014-01-01
We have summarized experimental data on the phase diagram of the system Ag 2 S–Ag 2 Se. Standard thermodynamic functions of four solid solutions in this system have been calculated using the model of regular and subregular solutions: a restricted fcc solid solution γ-Ag 2 S-Ag 2 S 1−x Se x (x 2 S–Ag 2 Se, monoclinic solid solution (α) from Ag 2 S to Ag 2 S 0.4 Se 0.6 , and orthorhombic solid solution (α) from Ag 2 S 0.3 Se 0.7 to the Ag 2 Se. G mix and S mix have been evaluated using the subregular model for asymmetric solution for the region Ag 2 S 0.4 Se 0.6 –Ag 2 S 0.3 Se 0.7 . The thermodynamic data can be used for modeling in complex natural systems and in matters of semiconductor materials
Comparative Single-Cell Genomics of Chloroflexi from the Okinawa Trough Deep-Subsurface Biosphere.
Fullerton, Heather; Moyer, Craig L
2016-05-15
Chloroflexi small-subunit (SSU) rRNA gene sequences are frequently recovered from subseafloor environments, but the metabolic potential of the phylum is poorly understood. The phylum Chloroflexi is represented by isolates with diverse metabolic strategies, including anoxic phototrophy, fermentation, and reductive dehalogenation; therefore, function cannot be attributed to these organisms based solely on phylogeny. Single-cell genomics can provide metabolic insights into uncultured organisms, like the deep-subsurface Chloroflexi Nine SSU rRNA gene sequences were identified from single-cell sorts of whole-round core material collected from the Okinawa Trough at Iheya North hydrothermal field as part of Integrated Ocean Drilling Program (IODP) expedition 331 (Deep Hot Biosphere). Previous studies of subsurface Chloroflexi single amplified genomes (SAGs) suggested heterotrophic or lithotrophic metabolisms and provided no evidence for growth by reductive dehalogenation. Our nine Chloroflexi SAGs (seven of which are from the order Anaerolineales) indicate that, in addition to genes for the Wood-Ljungdahl pathway, exogenous carbon sources can be actively transported into cells. At least one subunit for pyruvate ferredoxin oxidoreductase was found in four of the Chloroflexi SAGs. This protein can provide a link between the Wood-Ljungdahl pathway and other carbon anabolic pathways. Finally, one of the seven Anaerolineales SAGs contains a distinct reductive dehalogenase homologous (rdhA) gene. Through the use of single amplified genomes (SAGs), we have extended the metabolic potential of an understudied group of subsurface microbes, the Chloroflexi These microbes are frequently detected in the subsurface biosphere, though their metabolic capabilities have remained elusive. In contrast to previously examined Chloroflexi SAGs, our genomes (several are from the order Anaerolineales) were recovered from a hydrothermally driven system and therefore provide a unique window into
Production of engineered long-life and male sterile Pelargonium plants
Directory of Open Access Journals (Sweden)
García-Sogo Begoña
2012-08-01
Full Text Available Abstract Background Pelargonium is one of the most popular garden plants in the world. Moreover, it has a considerable economic importance in the ornamental plant market. Conventional cross-breeding strategies have generated a range of cultivars with excellent traits. However, gene transfer via Agrobacterium tumefaciens could be a helpful tool to further improve Pelargonium by enabling the introduction of new genes/traits. We report a simple and reliable protocol for the genetic transformation of Pelargonium spp. and the production of engineered long-life and male sterile Pelargonium zonale plants, using the pSAG12::ipt and PsEND1::barnase chimaeric genes respectively. Results The pSAG12::ipt transgenic plants showed delayed leaf senescence, increased branching and reduced internodal length, as compared to control plants. Leaves and flowers of the pSAG12::ipt plants were reduced in size and displayed a more intense coloration. In the transgenic lines carrying the PsEND1::barnase construct no pollen grains were observed in the modified anther structures, which developed instead of normal anthers. The locules of sterile anthers collapsed 3–4 days prior to floral anthesis and, in most cases, the undeveloped anther tissues underwent necrosis. Conclusion The chimaeric construct pSAG12::ipt can be useful in Pelargonium spp. to delay the senescence process and to modify plant architecture. In addition, the use of engineered male sterile plants would be especially useful to produce environmentally friendly transgenic plants carrying new traits by preventing gene flow between the genetically modified ornamentals and related plant species. These characteristics could be of interest, from a commercial point of view, both for pelargonium producers and consumers.
A Robust Control Scheme for Medium-Voltage-Level DVR Implementation
DEFF Research Database (Denmark)
Blaabjerg, Frede; Loh, Poh Chiang; Li, Yun Wei
2007-01-01
of Hinfin controller weighting function selection, inner current loop tuning, and system disturbance rejection capability is presented. Finally, the designed control scheme is extensively tested on a laboratory 10-kV MV-level DVR system with varying voltage sag (balanced and unbalanced) and loading (linear....../nonlinear load and induction motor load) conditions. It is shown that the proposed control scheme is effective in both balanced and unbalanced sag compensation and load disturbance rejection, as its robustness is explicitly specified....
WTO - den fjerde dimension i dansk international skatteret?
DEFF Research Database (Denmark)
Sørensen, Karsten Engsig
2000-01-01
På baggrund af en netop afgjort sag vedrørende beskatning af de amerikanske Foreign Sales Corporations (FSC), undersøges det hvordan WTO-aftalerne, herunder særligt subsidie-aftalen, kan få betydning for national skatteret.......På baggrund af en netop afgjort sag vedrørende beskatning af de amerikanske Foreign Sales Corporations (FSC), undersøges det hvordan WTO-aftalerne, herunder særligt subsidie-aftalen, kan få betydning for national skatteret....
Directory of Open Access Journals (Sweden)
Noorbakhsh S
2013-03-01
Full Text Available Background: Staphylococcal superantigens (SAg's may have some role in otitis media with effusion (OME. The aim of this study was the search of staphylococcal SAg's in middle ear effusion of children with OME. Methods: This cross sectional-analytic study was done in ENT & pediatric wards upon 64 children with otitis media with effusion (OME between 1-15 years, (mean age=7.42+4 years of Rasoul Akram University Hospital, Tehran, Iran in 2009-2011. Fifty six percent (36 of cases were male, 43.8% (28 were female. Staphylococcal SAg's; Toxic Shock Syndrome Toxin-1 (TSST-1, Staphylococcal enterotoxin A, B, C, D (Enzyme immune assay, AB Cam, USA were detected in middle ear effusion samples after conventional culture.Results: None type of SAg's found in 39% of OME cases, enterotoxin B found in: 22%; enterotoxin A: 17%, enterotoxin C: 15.6%, enterotoxin D: 12.5%, Toxic Shock Syndrome Toxin-1 (TSST-1: 7.8% Mean age of cases with positive TSST-1, enterotoxin A, B, C, and D was: 1, 5, 8.6, 9.6 and 9.6 years respectively. Positive TSST had no agreement with positive enterotoxin A and C but had weak agreement with type B and D. Mean age of cases with positive TSST was one years which had significant difference with (7.9 years in cases with negative TSST test (P<0.0001.Conclusion: At least one or more type of staphylococcal toxins had found in middle ear effusion of 70% of OME cases with negative culture for Staphylococcus aureus. Even in culture negative cases, staphylococcal toxins might have some immunologic role in middle ear effusion forming. Finding the SAg's (at least one type are important for treatment of immunosuppressive or corticosteroid in cases with resistant OME.
International Nuclear Information System (INIS)
Guzman G, K. A.; Gallego D, E.; Lorente F, A.; Ibanez F, S.; Vega C, H. R.; Mendez V, R.; Gonzalez, J. A.
2015-10-01
Using Monte Carlo methods with the code MCNPX, was estimated the response of a scintillation neutron detector of Zn S(Ag) with a mixture of 10 B high enrichment. The detector consists of four plates of Poly (methyl methacrylate) (PMMA) and five layers of ∼0, 017 cm 10 B+ZnS(Ag) in contact with PMMA. The naked detector response was calculated and with different thicknesses of high density polyethylene moderator, for 29 monoenergetic sources and for sources of 241 AmBe and 252 Cf of neutrons. In these calculations the reactions 10 B(n,α) 7 Li and neutron fluence in the sensitive area of detector 10 B+ZnS(Ag) were estimated. Measurements were performed in the Laboratory of Neutron Measurement to quantify detections in counts per second to a neutron source of 252 Cf to 200 cm on the bench, modeling with MCNPX, these measures were compared to validate the model and the Zn S(Ag) efficiency of α detection was estimated. Calculations in the LPN-CIEMAT were realized. Starting from the validation new models were carried out with geometries that improve the detector response, trying reaching the detection of 2, 5 cps-ng of 252 Cf comparable requirement for responding to the installed equipment of 3 He in the radiation portal monitor. This type of detector can be considered an alternative to detectors of 3 He for detecting special nuclear material. (Author)
Endogenous MMTV proviruses induce susceptibility to both viral and bacterial pathogens.
Directory of Open Access Journals (Sweden)
Sanchita Bhadra
2006-12-01
Full Text Available Most inbred mice carry germline proviruses of the retrovirus, mouse mammary tumor virus (MMTV (called Mtvs, which have multiple replication defects. A BALB/c congenic mouse strain lacking all endogenous Mtvs (Mtv-null was resistant to MMTV oral and intraperitoneal infection and tumorigenesis compared to wild-type BALB/c mice. Infection of Mtv-null mice with an MMTV-related retrovirus, type B leukemogenic virus, also resulted in severely reduced viral loads and failure to induce T-cell lymphomas, indicating that resistance is not dependent on expression of a superantigen (Sag encoded by exogenous MMTV. Resistance to MMTV in Mtv-null animals was not due to neutralizing antibodies. Further, Mtv-null mice were resistant to rapid mortality induced by intragastric inoculation of the Gram-negative bacterium, Vibrio cholerae, but susceptibility to Salmonella typhimurium was not significantly different from BALB/c mice. Susceptibility to both MMTV and V. cholerae was reconstituted by the presence of any one of three endogenous Mtvs located on different chromosomes and was associated with increased pathogen load. One of these endogenous proviruses is known to encode only Sag. Therefore, Mtv-encoded Sag appears to provide a unique genetic susceptibility to specific viruses and bacteria. Since human endogenous retroviruses also encode Sags, these studies have broad implications for pathogen-induced responses in mice and humans.
Cunningham, Kevin J.; Kluesner, Jared W.; Westcott, Richard L.; Robinson, Edward; Walker, Cameron; Khan, Shakira A.
2017-12-08
an approach never before applied to this area. Notably, the 3D geomodeling provided 3D visualizations and geocellular models of the depositional sequences, hydrostratigraphy, and structural features. The geocellular data could be used to update the hydrogeologic structure inherent to groundwater flow simulations that are designed to address the sustainability of the water resources of the Floridan aquifer system.Two kinds of pathways that could enable upward cross-formational flow of injected treated wastewater from the Boulder Zone have been identified in the 80 miles of high-resolution seismic data collected for this study: a near-vertical reverse fault and karst collapse structures. The single reverse fault, inferred to be of tectonic origin, is in extreme northeastern Broward County and has an offset of about 19 feet at the level of the Arcadia Formation. Most of the 17 karst collapse structures identified manifest as columniform, vertically stacked sagging seismic reflections that span early Eocene to Miocene age rocks equivalent to much of the Floridan aquifer system and the lower part of the overlying intermediate confining unit. In some cases, the seismic-sag structures extend upward into strata of Pliocene age. The seismic-sag structures are interpreted to have a semicircular shape in plan view on the basis of comparison to (1) other seismic-sag structures in southeastern Florida mapped with two 2D seismic cross lines or 3D data, (2) comparison to these structures located in other carbonate provinces, and (3) plausible extensional ring faults detected with multi-attribute analysis. The seismic-sag structures in the study area have heights as great as 2,500 vertical feet, though importantly, one spans about 7,800 feet. Both multi-attribute analysis and visual detection of offset of seismic reflections within the seismic-sag structures indicate faults and fractures are associated with many of the structures. Multi-attribute analysis highlighting chimney fluid pathways
International Nuclear Information System (INIS)
Ishii, Yoshitaka; Markus, Michelle A.; Tycko, Robert
2001-01-01
Water-soluble biological macromolecules can be weakly aligned by dissolution in a strained, hydrated gel such as cross-linked polyacrylamide, an effect termed 'strain-induced alignment in a gel' (SAG). SAG induces nonzero nuclear magnetic dipole-dipole couplings that can be measured in high-resolution NMR spectra and used as structural constraints. The dependence of experimental 15 N- 1 H dipolar couplings extracted from two-dimensional heteronuclear single quantum coherence (HSQC) spectra on several properties of compressed polyacrylamide, including the extent of compression, the polyacrylamide concentration, and the cross-link density, is reported for the B1 immunoglobulin binding domain of streptococcal protein G (protein G/B1, 57 residues). It is shown that the magnitude of macromolecular alignment can be widely varied by adjusting these properties, although the orientation and asymmetry of the alignment tensor are not affected significantly. The dependence of the 15 N relaxation times T 1 and T 2 of protein G/B1 on polyacrylamide concentration are also reported. In addition, the results of 15 N relaxation and HSQC experiments on the RNA binding domain of prokaryotic protein S4 from Bacillus stearothermophilus (S4 Δ41, residues 43-200) in a compressed polyacrylamide gel are presented. These results demonstrate the applicability of SAG to proteins of higher molecular weight and greater complexity. A modified in-phase/anti-phase (IPAP) HSQC technique is described that suppresses natural-abundance 15 N background signals from amide groups in polyacrylamide, resulting in cleaner HSQC spectra in SAG experiments. The mechanism of protein alignment in strained polyacrylamide gels is contrasted with that in liquid crystalline media
Preliminary Report on Oak Ridge National Laboratory Testing of Drake/ACSS/MA2/E3X
Energy Technology Data Exchange (ETDEWEB)
Irminger, Philip [ORNL; Davis, Cody [General Cable Corporation; Temple, Bill [General Cable Corporation; Baker, Gord [General Cable Corporation; Starke, Michael R [ORNL
2016-01-01
A key to industry acceptance of a new technology is extensive validation in field trials. The Powerline Conductor Accelerated Test facility (PCAT) at Oak Ridge National Laboratory (ORNL) is specifically designed to evaluate the performance and reliability of a new conductor technology under real world conditions. The facility is set up to capture large amounts of data during testing. General Cable used the ORNL PCAT facility to validate the performance of TransPowr with E3X Technology a standard overhead conductor with an inorganic high emissivity, low absorptivity surface coating. Extensive testing has demonstrated a significant improvement in conductor performance across a wide range of operating temperatures, indicating that E3X Technology can provide a reduction in temperature, a reduction in sag, and an increase in ampacity when applied to the surface of any overhead conductor. This report provides initial results of that testing.
Visualization of an air-water interface on superhydrophobic surfaces in turbulent channel flows
Kim, Hyunseok; Park, Hyungmin
2017-11-01
In the present study, three-dimensional deformation of air-water interface on superhydrophobic surfaces in turbulent channel flows at the Reynolds numbers of Re = 3000 and 10000 is measured with RICM (Reflection Interference Contrast Microscopy) technique. Two different types of roughness feature of circular hole and rectangular grate are considered, whose depth is 20 μm and diameter (or width) is varied between 20-200 μm. Since the air-water interface is always at de-pinned state at the considered condition, air-water interface shape and its sagging velocity is maintained to be almost constant as time goes one. In comparison with the previous results under the laminar flow, due to turbulent characteristics of the flow, sagging velocity is much faster. Based on the measured sagging profiles, a modified model to describe the air-water interface dynamics under turbulent flows is suggested. Supported by City of Seoul through Seoul Urban Data Science Laboratory Project (Grant No 0660-20170004) administered by SNU Big Data Institute.
Pattern Transitions in a Soft Cylindrical Shell
Yang, Yifan; Dai, Hui-Hui; Xu, Fan; Potier-Ferry, Michel
2018-05-01
Instability patterns of rolling up a sleeve appear more intricate than the ones of walking over a rug on floor, both characterized as systems of uniaxially compressed soft film on stiff substrate. This can be explained by curvature effects. To investigate pattern transitions on a curved surface, we study a soft shell sliding on a rigid cylinder by experiments, computations and theoretical analyses. We reveal a novel postbuckling phenomenon involving multiple successive bifurcations: smooth-wrinkle-ridge-sagging transitions. The shell initially buckles into periodic axisymmetric wrinkles at the threshold and then a wrinkle-to-ridge transition occurs upon further axial compression. When the load increases to the third bifurcation, the amplitude of the ridge reaches its limit and the symmetry is broken with the ridge sagging into a recumbent fold. It is identified that hysteresis loops and the Maxwell equal-energy conditions are associated with the coexistence of wrinkle-ridge or ridge-sagging patterns. Such a bifurcation scenario is inherently general and independent of material constitutive models.
International Nuclear Information System (INIS)
Gallagher, John R.; Torian, Udana; McCraw, Dustin M.; Harris, Audray K.
2017-01-01
While nanoparticle vaccine technology is gaining interest due to the success of vaccines like those for the human papillomavirus that is based on viral capsid nanoparticles, little information is available on the disassembly and reassembly of viral surface glycoprotein-based nanoparticles. One such particle is the hepatitis B virus surface antigen (sAg) that exists as nanoparticles. Here we show, using biochemical analysis coupled with electron microscopy, that sAg nanoparticle disassembly requires both reducing agent to disrupt intermolecular disulfide bonds, and detergent to disrupt hydrophobic interactions that stabilize the nanoparticle. Particles were otherwise resistant to salt and urea, suggesting the driving mechanism of particle formation involves hydrophobic interactions. We reassembled isolated sAg protein into nanoparticles by detergent removal and reassembly resulted in a wider distribution of particle diameters. Knowledge of these driving forces of nanoparticle assembly and stability should facilitate construction of epitope-displaying nanoparticles that can be used as immunogens in vaccines.
Control and Testing of a Dynamic Voltage Restorer (DVR) at Medium Voltage Level
DEFF Research Database (Denmark)
Nielsen, John Godsk; Newman, Michael; Nielsen, Hans Ove
2004-01-01
power sensitive loads from voltage sags. This paper reports practical test results obtained on a medium voltage (10 kV) level using a DVR at a Distribution test facility in Kyndby, Denmark. The DVR was designed to protect a 400-kVA load from a 0.5-p.u. maximum voltage sag. The reported DVR verifies......The dynamic voltage restorer (DVR) has become popular as a cost effective solution for the protection of sensitive loads from voltage sags. Implementations of the DVR have been proposed at both a low voltage (LV) level, as well as a medium voltage (MV) level; and give an opportunity to protect high...... the use of a feed-forward and feed-back technique of the controller and it obtains both good transient and steady state responses. The effect of the DVR on the system is experimentally investigated under both faulted and non-faulted system states, for a variety of linear and non-linear loads. Variable...
Energy Technology Data Exchange (ETDEWEB)
Gallagher, John R.; Torian, Udana; McCraw, Dustin M.; Harris, Audray K., E-mail: harrisau@mail.nih.gov
2017-02-15
While nanoparticle vaccine technology is gaining interest due to the success of vaccines like those for the human papillomavirus that is based on viral capsid nanoparticles, little information is available on the disassembly and reassembly of viral surface glycoprotein-based nanoparticles. One such particle is the hepatitis B virus surface antigen (sAg) that exists as nanoparticles. Here we show, using biochemical analysis coupled with electron microscopy, that sAg nanoparticle disassembly requires both reducing agent to disrupt intermolecular disulfide bonds, and detergent to disrupt hydrophobic interactions that stabilize the nanoparticle. Particles were otherwise resistant to salt and urea, suggesting the driving mechanism of particle formation involves hydrophobic interactions. We reassembled isolated sAg protein into nanoparticles by detergent removal and reassembly resulted in a wider distribution of particle diameters. Knowledge of these driving forces of nanoparticle assembly and stability should facilitate construction of epitope-displaying nanoparticles that can be used as immunogens in vaccines.
Directory of Open Access Journals (Sweden)
Rachel M. de Lyra-Neves
2007-01-01
Full Text Available As observações ocorreram no período de dois anos, monitorando grupos marcados de sagüis durante oito horas por dia. Foram registrados seis tipos de eventos: predação de sagüis; predação de aves, disputa de área de forrageio e recurso alimentar; compartilhamento de área de forrageio e recurso alimentar; perseguição branda e utilização de ninho de ave como local de pernoite dos sagüis. Os eventos agrupados obtiveram diferenças significativas entre as estações do ano e os estratos ocupados.The observations cover a period of two years, monitoring groups of marked common marmosets in eight hour/day periods. Six types of events were recorded: marmoset predation; bird predation; foraging competition; food sharing; use of avian nest for nocturnal marmoset rest and mutual pursuit. All pooled events showed highly significant differences between season and vegetation strata.
Dubey, Jitender P; Trupkiewicz, John G; Verma, Shiv K; Mowery, Joseph D; Adedoyin, Gloria; Georoff, Tim; Grigg, Michael E
2017-11-30
The protozoan parasite Sarcocystis neurona is an important cause of disease in horses (equine protozoal myeloencephalitis, EPM) and marine mammals. Isolated reports of clinical EPM-like disease have been documented in a zebra, raccoon, domestic cat, domestic dog, ferret, skunk, mink, lynx, red panda and fisher. The predominant disease is encephalomyelitis associated with schizonts in neural tissues. Here, we report highly disseminated sarcocystosis, in many tissues of a captive White-nosed coati (Nasua narica molaris). The 14year old, neutered male coati was euthanized due to progressive weakness, lethargy, and inappetence. Schizonts, including free and intracellular merozoites were detected in many cell types, and differed morphologically from S. neurona schizonts in horses. Only a few sarcocysts were seen in skeletal muscle and the myocardium. Immunohistochemically, the protozoa reacted positively to S. neurona but not to Toxoplasma gondii antibodies. Severe inflammtory disease detected in the stomach, intestine, adrenal and thyroid glands, ciliary body of eye, and urinary bladder associated with schizonts in the coati has not been reported earlier in any host with EPM. Although, a few schizonts were found in the brain, encephalitis was minimal and not the cause of clinical signs. Multilocus PCR-DNA sequencing using DNA derived from the coati lung tissue identified an S. neurona infection using the 18S, 28S and ITS-1 markers, and a novel genotype using primer pairs against antigenic surface proteins (SnSAG3, SnSAG4, SnSAG1-5-6) and microsatellite markers (MS, SN7, SN9). Although the genotype was similar to the widely distributed Type VI strain, it possessed a novel allele at SnSAG5, and a different MS combination of repeats at SN7 and SN9. Whether this severe parasitism was related to the host or the parasite needs further investigation. Published by Elsevier B.V.
Akita, Hirotaka; Sasaki, Ryosuke; Yokoyama, Yusuke; Negishi, Kei; Matsunaga, Kayoko
2014-10-01
Bipolar radiofrequency (RF) technology is developed based on fractional thermolysis, and the literature concerning the efficacy of the rejuvenation and treatment of acne scars has been reported in Europe and the United States of America. Therefore, we examined bipolar RF treatment using fractional thermolysis to evaluate the efficacy and safety of the treatment of Asian photo-aging skin, particularly 'wrinkles' and 'sagging.' Ten Japanese women (mean age: 58.6, skin type III-IV) received three fractional bipolar RF treatments every 4-6 weeks. For the objective evaluation, we evaluated the improvement of the wrinkles on the forehead, lateral canthus (crow's feet) and lower eyelid, and the sagging of the nasolabial fold using digital photographs captured using Visia(™) . For the subjective evaluation, the participants were asked to describe the improvements observed in the wrinkles on the forehead, lateral canthus (crow's feet) and lower eyelid, and sagging nasolabial fold and to evaluate the level pain experienced using a 10-point VAS score. The objective evaluation in each category showed significant improvements in the wrinkles on the lateral canthus (crow's feet) and lower eyelid. As for the nasolabial fold, 60% of the subjects showed improvements, scoring from good to excellent (51-100% improvement), although there was a little improvement of the wrinkle on the forehead. Similar improvements were observed in the subjective evaluation. During each treatment, oedema and erythema were observed in all participants, but the oedema disappeared the following day in all cases. However, mild erythema persisted for an average of 3.1 days. Micro debris disappeared after an average of 5.2 days. The participants were satisfied, as we allowed them to apply make-up the next day. There were no other severe adverse reactions observed during the treatment. The 10-point VAS score was 3.8, and no participants dropped out due to discomfort. Little improvement was observed in
Power Quality Improvement Using an Enhanced Network-Side-Shunt-Connected Dynamic Voltage Restorer
Fereidouni, Alireza; Masoum, Mohammad A. S.; Moghbel, Moayed
2015-10-01
Among the four basic dynamic voltage restorer (DVR) topologies, the network-side shunt-connected DVR (NSSC-DVR) has a relatively poor performance and is investigated in this paper. A new configuration is proposed and implemented for NSSC-DVR to enhance its performance in compensating (un)symmetrical deep and long voltage sags and mitigate voltage harmonics. The enhanced NSSC-DVR model includes a three-phase half-bridge semi-controlled network-side-shunt-connected rectifier and a three-phase full-bridge series-connected inverter implemented with a back-to-back configuration through a bidirectional buck-boost converter. The network-side-shunt-connected rectifier is employed to inject/draw the required energy by NSSC-DVR to restore the load voltage to its pre-fault value under sag/swell conditions. The buck-boost converter is responsible for maintaining the DC-link voltage of the series-connected inverter at its designated value in order to improve the NSSC-DVR capability in compensating deep and long voltage sags/swells. The full-bridge series-connected inverter permits to compensate unbalance voltage sags containing zero-sequence component. The harmonic compensation of the load voltage is achieved by extracting harmonics from the distorted network voltage using an artificial neural network (ANN) method called adaptive linear neuron (Adaline) strategy. Detailed simulations are performed by SIMULINK/MATLAB software for six case studies to verify the highly robustness of the proposed NSSC-DVR model under various conditions.
Prevalence of antibodies to Sarcocystis neurona and Neospora hughesi in horses from Mexico.
Yeargan, Michelle R; Alvarado-Esquivel, Cosme; Dubey, Jitender P; Howe, Daniel K
2013-01-01
Equine protozoal myeloencephalitis (EPM) is a debilitating disease of horses caused by Sarcocystis neurona and Neospora hughesi. Sera from 495 horses in Durango State, Mexico were tested for anti-protozoal antibodies using enzyme-linked immunosorbent assays (ELISAs) based on major surface antigens of these two parasites. Antibodies to S. neurona were detected in 240 (48.5%) of the 495 horse sera tested with the rSnSAG2/4/3 trivalent ELISA. Multivariate analysis showed that exposure to S. neurona was associated with age, feeding grains and crops, and small herd size. Antibodies to N. hughesi were found in 15 (3.0%) of the 495 horse sera tested with the rNhSAG1 ELISA and confirmed by Western blot of N. hughesi tachyzoite antigen. This is the first report of S. neurona and N. hughesi exposure in horses in Mexico, and it affirms that EPM should be in the differential diagnosis for horses exhibiting signs of neurologic disease in this country. © M.R. Yeargan et al., published by EDP Sciences, 2013.
A 205 Hour Krypton Propellant Life Test of the SPT-100 Operating at 3 kW
2013-09-01
nominal xenon condition (1.35 kW), tests have validated the SPT -100 life time as exceeding 2.71 million N -s (equivalent to approximately 9,000 hours of...condition – If correlation between erosion and energy throughput holds, SPT may be able to endure • Long term life test would be required to validate Kr as...shift (to zero center of SPT at r = 0) • Small rotation to correct for linear stage sag DISTRIBUTION A: Approved for public release; distribution
Upadhyay, Rohit; Mishra, Hari Niwas
2016-04-01
The simultaneous optimization of a synergistic blend of oleoresin sage (SAG) and ascorbyl palmitate (AP) in sunflower oil (SO) was performed using central composite and rotatable design coupled with principal component analysis (PCA) and response surface methodology (RSM). The physicochemical parameters viz., peroxide value, anisidine value, free fatty acids, induction period, total polar matter, antioxidant capacity and conjugated diene value were considered as response variables. PCA reduced the original set of correlated responses to few uncorrelated principal components (PC). The PC1 (eigen value, 5.78; data variance explained, 82.53 %) was selected for optimization using RSM. The quadratic model adequately described the data (R (2) = 0. 91, p 0.05). The contour plot of PC 1 score indicated the optimal synergistic combination of 1289.19 and 218.06 ppm for SAG and AP, respectively. This combination of SAG and AP resulted in shelf life of 320 days at 25 °C estimated using linear shelf life prediction model. In conclusion, the versatility of PCA-RSM approach has resulted in an easy interpretation in multiple response optimizations. This approach can be considered as a useful guide to develop new oil blends stabilized with food additives from natural sources.
International Nuclear Information System (INIS)
Naus, D.J.; Oland, C.B.; Ellingwood, B.R.
1994-01-01
This report discusses the Structural Aging (SAG) Program which is being conducted at the Oak Ridge National Laboratory (ORNL) for the United States Nuclear Regulatory commission (USNRC). The SAG Program is addressing the aging management of safety-related concrete structures in nuclear power plants for the purpose of providing improved technical bases for their continued service. The program is organized into three technical tasks: Materials Property Data Base, Structural Component Assessment/Repair Technologies, and Quantitative Methodology for continued Service Determinations. Objectives and a summary of recent accomplishments under each of these tasks are presented
On-line Dynamic Security Assessment in Power Systems
DEFF Research Database (Denmark)
Weckesser, Johannes Tilman Gabriel
and solar radiation. Moreover, ongoing research suggests that demand response will be introduced to maintain power balance between generation and consumption at all times. Due to these changes the operating point of the power system will be less predictable and today’s stability and security assessment...... for early prediction of critical voltage sags is described. The method’s performance is compared to other prediction approaches. The results show that the proposed method succeeds in early, accurately and consistently predicting critically low voltage sags. An efficient on-line DSA not only identifies...
An update on the Structural Aging Program
International Nuclear Information System (INIS)
Naus, D.J.; Oland, C.B.; Ellingwood, B.; Mori, Y.; Arndt, E.G.
1992-01-01
The Structural Aging (SAG) Program is being conducted at the Oak Ridge National Laboratory (ORNL) for the Nuclear Regulatory Commission (NRC). The SAG Program is addressing the aging management of safety-related concrete structures in nuclear power plants for the purpose of providing improved technical bases for their continued service. The program is organized into four tasks: Program Management, Materials Property Data Base, Structural Component Assessment/Repair Technologies, and Quantitative Methodology for Continued Service Determinations. Objectives and a summary of accomplishments under each of these tasks are presented
Fronteras y oportunidades de integración: los recursos subterráneos de agua dulce en el Mercosur
Rodríguez Sarmiento, Silvia Paola
2014-01-01
El presente estudio de caso tiene como objetivo analizar la influencia del Sistema Acuífero Guaraní (SAG), en la agenda de integración del MERCOSUR. Se argumenta que el SAG al considerarse un espacio estratégico trasfronterizo, cuenta con un potencial desestabilizador, pero a la vez se configura como un potencial armonizador de la agenda de integración de MERCOSUR, analizando que esta característica promueve el fortalecimiento de los lazos de cooperación y el establecimiento de una dimensión...
International Nuclear Information System (INIS)
Naus, D.J.; Oland, C.B.; Ellingwood, B.
1993-01-01
The Structural Aging (SAG) Program is being conducted at the Oak Ridge National Laboratory (ORNL) for the United States Nuclear Regulatory Commission (USNRC). The SAG Program is addressing the aging management of safety-related concrete structures in nuclear power plants for the purpose of providing improved technical bases for their continued service. The program is organized into four tasks: Program Management, Materials Property Data Base, Structural Component Assessment/Repair Technologies, and Quantitative Methodology for Continued Service Determinations. Objectives and a summary of recent accomplishments under each of these tasks are presented
Directory of Open Access Journals (Sweden)
Stefan Wolfgang Grötzinger
2014-04-01
Full Text Available Reliable functional annotation of genomic data is the key-step in the discovery of novel enzymes. Intrinsic sequencing data quality problems of single amplified genomes (SAGs and poor homology of novel extremophile’s genomes pose significant challenges for the attribution of functions to the coding sequences identified. The anoxic deep-sea brine pools of the Red Sea are a promising source of novel enzymes with unique evolutionary adaptation. Sequencing data from Red Sea brine pool cultures and SAGs are annotated and stored in the INDIGO data warehouse. Low sequence homology of annotated genes (no similarity for 35% of these genes may translate into false positives when searching for specific functions. The Profile & Pattern Matching (PPM strategy described here was developed to eliminate false positive annotations of enzyme function before progressing to labor-intensive hyper-saline gene expression and characterization. It utilizes InterPro-derived Gene Ontology (GO-terms (which represent enzyme function profiles and annotated relevant PROSITE IDs (which are linked to an amino acid consensus pattern. The PPM algorithm was tested on 15 protein families, which were selected based on scientific and commercial potential. An initial list of 2,577 E.C. numbers was translated into 171 GO-terms and 49 consensus patterns. A subset of INDIGO-sequences consisting of 58 SAGs from six different taxons of bacteria and archaea were selected from 6 different brine pool environments. Those SAGs code for 74,516 genes, which were independently scanned for the GO-terms (profile filter and PROSITE IDs (pattern filter. Following stringent reliability filtering, the non-redundant hits (106 profile hits and 147 pattern hits are classified as reliable, if at least two relevant descriptors (GO-terms and/or consensus patterns are present. Scripts for annotation, as well as for the PPM algorithm, are available through the INDIGO website.
Energy Technology Data Exchange (ETDEWEB)
Guzman G, K. A.; Gallego D, E.; Lorente F, A.; Ibanez F, S. [Universidad Politecnica de Madrid, Departamento de Ingenieria Energetica, E.T.S. Ing. Industriales, Jose Gutierrez Abascal 2, 28006 Madrid (Spain); Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Mendez V, R. [CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Gonzalez, J. A., E-mail: karen.guzman.garcia@alumnos.upm.es [Universidad Politecnica de Madrid, Laboratorio de Ingenieria Nuclear, ETSI Caminos, Canales y Puertos, Ciudad Universitaria, C. Profesor Aranguren 3, 28040 Madrid (Spain)
2015-10-15
Using Monte Carlo methods with the code MCNPX, was estimated the response of a scintillation neutron detector of Zn S(Ag) with a mixture of {sup 10}B high enrichment. The detector consists of four plates of Poly (methyl methacrylate) (PMMA) and five layers of ∼0, 017 cm {sup 10}B+ZnS(Ag) in contact with PMMA. The naked detector response was calculated and with different thicknesses of high density polyethylene moderator, for 29 monoenergetic sources and for sources of {sup 241}AmBe and {sup 252}Cf of neutrons. In these calculations the reactions {sup 10}B(n,α){sup 7}Li and neutron fluence in the sensitive area of detector {sup 10}B+ZnS(Ag) were estimated. Measurements were performed in the Laboratory of Neutron Measurement to quantify detections in counts per second to a neutron source of {sup 252}Cf to 200 cm on the bench, modeling with MCNPX, these measures were compared to validate the model and the Zn S(Ag) efficiency of α detection was estimated. Calculations in the LPN-CIEMAT were realized. Starting from the validation new models were carried out with geometries that improve the detector response, trying reaching the detection of 2, 5 cps-ng of {sup 252}Cf comparable requirement for responding to the installed equipment of {sup 3}He in the radiation portal monitor. This type of detector can be considered an alternative to detectors of {sup 3}He for detecting special nuclear material. (Author)
Closed-Form Formula of the Transverse Dynamic Stiffness of a Shallowly Inclined Taut Cable
Directory of Open Access Journals (Sweden)
Dan-hui Dan
2014-01-01
Full Text Available The segmented vibration-governed equations and their general solutions for cables acted upon by intermediate transverse forces are derived by applying Hamilton’s principle. Including the effects of sagging, flexible stiffness, clamped boundary conditions, and inclination angle of the cable, the element-wise dynamic stiffness for each cable segment, split into segments having unique transverse forces, is derived. By using methods from the global stiffness assembly process of FEM, the global level of the cables’ dynamic equilibrium equation is obtained, and, as a result, the final closed-form formula of transverse dynamic stiffness is derived. Additionally, the corresponding analytic form, without considering sagging effects, is also obtained. Case studies are conducted on the aspects of accuracy, rationality of the distribution on the spatial field, and frequency domains of dynamic stiffness calculations. By comparison with the Guyan-based static FEM reduction method, it is shown that the result obtained from the proposed closed-form solution, which includes sagging effects, is exact and rational, thus creating a powerful tool in transverse vibration analysis.
Crystallographically uniform arrays of ordered (In)GaN nanocolumns
Energy Technology Data Exchange (ETDEWEB)
Gačević, Ž., E-mail: gacevic@isom.upm.es; Bengoechea-Encabo, A.; Albert, S.; Calleja, E. [ETSIT-ISOM, Universidad Politécnica de Madrid, Avda. Complutense s/n, 28040 Madrid (Spain); Torres-Pardo, A.; González-Calbet, J. M. [Dept. Química Inorgánica, Universidad Complutense, 28040 Madrid (Spain); CEI Campus Moncloa, UCM-UPM, Madrid (Spain)
2015-01-21
In this work, through a comparative study of self-assembled (SA) and selective area grown (SAG) (In)GaN nanocolumn (NC) ensembles, we first give a detailed insight into improved crystallographic uniformity (homogeneity of crystallographic tilts and twists) of the latter ones. The study, performed making use of: reflective high energy electron diffraction, X-ray diffraction and scanning electron microscopy, reveals that unlike their SA counterparts, the ensembles of SAG NCs show single epitaxial relationship to both sapphire(0001) and Si(111) underlying substrates. In the second part of the article, making use of X-ray diffraction, we directly show that the selective area growth leads to improved compositional uniformity of InGaN NC ensembles. This further leads to improved spectral purity of their luminescence, as confirmed by comparative macro-photoluminescence measurements performed on SA and SAG InGaN NC ensembles. An improved crystallographic uniformity of NC ensembles facilitates their integration into optoelectronic devices, whereas their improved compositional uniformity allows for their employment in single-color optoelectronic applications.
Astrobiology and the Human Exploration of Mars
Levine, Joel S.; Garvin, James B.; Drake, B. G.; Beaty, David
2010-01-01
In March 2007, the Mars Exploration Program Analysis Group (MEPAG) chartered the Human Exploration of Mars Science Analysis Group (HEM-SAG), co-chaired by J. B. Garvin and J. S. Levine and consisting of about 30 Mars scientists from the U.S. and Europe. HEM-SAG was one of a half dozen teams charted by NASA to consider the human exploration of Mars. Other teams included: Mars Entry, Descent and Landing, Human Health and Performance, Flight and Surface Systems, and Heliospheric/Astrophysics. The results of these Mars teams and the development of an architecture for the human exploration of Mars were summarized in two recent publications: Human Exploration of Mars Design Reference Architecture 5.0, NASA Special Publication-2009-566 (B. G. Drake, Editor), 100 pages, July 2009 and Human Exploration of Mars Design Reference Architecture 5.0, NASA Special Publication-2009-566 Addendum (B. G. Drake, Editor), 406 pages, July 2009. This presentation summarizes the HEM-SAG conclusions on astrobiology and the search for life on Mars by humans.
Stobiecki, Maciej; Matysiak-Kata, Iwona; Frański, Rafał; Skała, Jacek; Szopa, Jan
2003-03-01
Transgenic potato plants overexpressing and repressing enzymes of flavonoids biosynthesis were created and analyzed. The selected plants clearly showed the expected changes in anthocyanins synthesis level. Overexpression of a DNA encoding dihydroflavonol 4-reductase (DFR) in sense orientation resulted in an increase in tuber anthocyanins, a 4-fold increase in petunidin and pelargonidin derivatives. A significant decrease in anthocyanin level was observed when the plant was transformed with a corresponding antisense construct. The transformation of potato plants was also accompanied by significant changes in steroid alkaloid glycosides (SAG) level in transgenic potato tuber. The changes in SAGs content was not dependent on flavonoid composition in transgenic potato. However, in an extreme situation where the highest (DFR11) or the lowest (DFRa3) anthocyanin level was detected the positive correlation with steroid alkaloid content was clearly visible. It is suggested that the changes in SAGs content resulted from chromatin stressed upon transformation. A liquid chromatography/mass spectrometry (LC/MS) system with electrospray ionization was applied for profiling qualitative and quantitative changes of steroid alkaloid glycosides in tubers of twelve lines of transgenic potato plants. Except alpha-chaconine and alpha-solanine, in the extracts from dried tuber skin alpha-solamargine and alpha-solasonine, triglycosides of solasonine, were identified in minor amounts, triglycosides of solanidine dehydrodimers were also recognized.
Ma, Jingling; Li, Wuhui; Wang, Guangxin; Li, Yaqiong; Guo, Hongbo; Zhao, Zeliang; Li, Wei
2017-10-01
In order to study the effects of La2O3 content and rolling on microstructure and mechanical properties of Mo-La2O3 alloys, Mo-0.5% (1%) La2O3 alloys were prepared by liquid-solid doping technique, subsequently rolled either by a single-direction rolling or a cross-rolling. As a result, three different materials were prepared for this study. After being annealed at 1800 °C, the single-directionally rolled Mo-1% La2O3 alloy shows the best mechanical properties in terms of strength, hardness, and sagging deformation among the three materials. This is attributed to the observation that the alloy is only recovered with a microstructure of subgrains and dislocations. The single-directionally rolled Mo-0.5% La2O3 exhibits the worst mechanical property among the three materials. In this material, coarse grains, but no subgrains and dislocations, can be observed after annealing, indicating that it is fully recrystallized. For the cross-rolled Mo-1% La2O3 alloy, grains of dispersed sizes, but no dislocations, are visible after annealing, implying that this alloy is partially recrystallized. Accordingly, the mechanical property of this material is in between the other two materials. Thus, the mechanical properties of the three materials can be well understood based on OM, SEM, and TEM results. Overall, the single-directionally rolled Mo-1% La2O3 alloy possesses good mechanical properties and is more suitable for high-temperature applications.
International Nuclear Information System (INIS)
Kim, Tae Ryong; Sohn, Seok Man; Lee, Jun Shin; Lee, Sun Ki; Lee, Jong Po
2001-01-01
Sag of CT or liquid injection shutdown system tubes in pressurized heavy water reactor is known to occur due to irradiation creep and growth during plant operation. When the sag of CT is big enough, the CT tube possibly comes in contact with liquid injection shutdown system tube (LIN) crossing beneath the CT, which subsequently may prevent the safe operation. It is therefore necessary to check the gap between the two tubes in order to confirm no contacts when using a proper measure periodically during the plant life. An ultrasonic gap measuring probe assembly which can be fed through viewing port installed on the calandria was developed and utilized to measure the sags of both tubes in a pressurized heavy water reactor in Korea. It was found that the centerlines of CT and LIN can be precisely detected by ultrasonic wave. The gaps between two tubes were easily obtained from the relative distance of the measured centerline elevations of the tubes. But the measured gap data observed at the viewing port were actually not the data at the crossing point of CT and LIN. To get the actual gap between two tubes, mathematical modeling for the deflection curves of two tubes was used. The sags of CT and LIN tubes were also obtained by comparison of the present centerlines with the initial elevations at the beginning of plant operation. The gaps between two tubes in the unmeasurable regions were calculated based on the measurement data and the channel power distribution
International Nuclear Information System (INIS)
Hong-Bo, Liu; Ling-Juan, Zhao; Jiao-Qing, Pan; Hong-Liang, Zhu; Fan, Zhou; Bao-Jun, Wang; Wei, Wang
2008-01-01
We present the monolithic integration of a sampled-grating distributed Bragg reflector (SG-DBR) laser with a quantum-well electroabsorption modulator (QW-EAM) by combining ultra-low-pressure (55mbar) selective-area-growth (SAG) metal-organic chemical vapour deposition (MOCVD) and quantum-well intermixing (QWI) for the first time. The QW-EAM and the gain section can be grown simultaneously by using SAG MOCVD technology. Meanwhile, the QWI technology offers an abrupt band-gap change between two functional sections, which reduces internal absorption loss. The experimental results show that the threshold current Ith = 62 mA, and output power reaches 3.6mW. The wavelength tuning range covers 30nm, and all the corresponding side mode suppression ratios are over 30 dB. The extinction ratios at available wavelength channels can reach more than 14 dB with bias of -5 V
SAG2 locus genotyping of Toxoplasma gondii in meat products of ...
African Journals Online (AJOL)
Toxoplasmosis is an infection caused by Toxoplasma gondii, an intracellular obligate parasite. Its transmission is usually attributed to ingestion of undercooked or raw meat. The aim of this study was the detection and genotyping of T. gondii in meat products using the molecular method in East Azerbaijan. DNA was ...
1991-01-01
1988, 13] P. Dierckx, Computing 24 (1980) 349. Vacuum (1990) in press. [4] D.A.G Bruggeman. Annalen der Physik 5 ( 1935 ) 636. T4 Ill. THROUGHPUT...1986) 229try to determine damage depth profiles in ion-im- 11SAG rggan.nnPy2493)6 [121 S.A G Bruggemann, Ann Phys 24 ( 1935 ) 636 planted...34indefinite" point substrate semiconductors [3-7]. defects should reflect the distribution of lightly damaged We have previously reported the results of EPR
Chi, Mingliang; Cao, Pengli; Yu, Guoying; Zhu, Li; Wang, Yuejun; Wang, Chunbo
2003-12-01
Polypeptide from Chlamys farreri (PCF), a topical polypeptide isolated from Chlamys farreri, was used in this experiment aimed to investigate the photoprotective effect of PCF against chronic skin damage induced by ultraviolet A (UVA) and ultraviolet B (UVB) radiation. The chronic ultraviolet-irradiated guinea pig model was established, and visible changes in the skin including wrinkling, sagging and erythema were observed. Malondialdehyde (MDA) and antioxidant enzymes including superoxide dismutase (SOD) and glutathione peroxidase (GSH-px) in the dorsal skin were determined using biochemical methods. The results showed: (1) PCF (5 % and 20%) could greatly protect the dorsal skin of guinea pig against wrinkling, sagging and erythema induced by UV radiation in a concentration-dependent manner. (2) PCF could reduce MDA formation in the dorsal skin caused by UV irradiation, while increasing the activities of SOD and GSH-px. (3) The differences among the PCF groups and UV model group were significant ( Psolar UV spectrum photoprotection; and that the antioxidant property of PCF might play a role in photoprotection.
Structural Aging Program technical progress for period, January 1, 1992--December 31, 1992
International Nuclear Information System (INIS)
Naus, D.J.; Oland, C.B.
1993-07-01
The Structural Aging (SAG) Program is conducted for the Nuclear Regulatory Commission (NRC) by the Oak Ridge National Laboratory (ORNL). The program has the overall objective of preparing an expandable handbook or report which will provide potential structural safety issues and acceptance criteria for use by the NRC in nuclear power plant evaluations of continued service. Initial focus of the program is on concrete and concrete-related materials which comprise safety-related (Category I) structures in light-water reactor facilities. The SAG Program is organized into four tasks: Task S.1 -- Program Management, Task S.2 -- Materials Property Data Base, Task S.3 -- Structural Component Assessment/Repair Technology, and Task S.4 -- Quantitative Methodology for Continued Service Determinations. In meeting the individual objectives of these tasks resources are drawn from ORNL with subcontract support from universities and other research laboratories. This report provides an overview of principal developments in each of the four program tasks from January 1, 1992 to December 31, 1992. Planned activities under each of these tasks are also presented
Importance of tibial slope for stability of the posterior cruciate ligament deficient knee.
Giffin, J Robert; Stabile, Kathryne J; Zantop, Thore; Vogrin, Tracy M; Woo, Savio L-Y; Harner, Christopher D
2007-09-01
Previous studies have shown that increasing tibial slope can shift the resting position of the tibia anteriorly. As a result, sagittal osteotomies that alter slope have recently been proposed for treatment of posterior cruciate ligament (PCL) injuries. Increasing tibial slope with an osteotomy shifts the resting position anteriorly in a PCL-deficient knee, thereby partially reducing the posterior tibial "sag" associated with PCL injury. This shift in resting position from the increased slope causes a decrease in posterior tibial translation compared with the PCL-deficient knee in response to posterior tibial and axial compressive loads. Controlled laboratory study. Three knee conditions were tested with a robotic universal force-moment sensor testing system: intact, PCL-deficient, and PCL-deficient with increased tibial slope. Tibial slope was increased via a 5-mm anterior opening wedge osteotomy. Three external loading conditions were applied to each knee condition at 0 degrees, 30 degrees, 60 degrees, 90 degrees, and 120 degrees of knee flexion: (1) 134-N anterior-posterior (A-P) tibial load, (2) 200-N axial compressive load, and (3) combined 134-N A-P and 200-N axial loads. For each loading condition, kinematics of the intact knee were recorded for the remaining 5 degrees of freedom (ie, A-P, medial-lateral, and proximal-distal translations, internal-external and varus-valgus rotations). Posterior cruciate ligament deficiency resulted in a posterior shift of the tibial resting position to 8.4 +/- 2.6 mm at 90 degrees compared with the intact knee. After osteotomy, tibial slope increased from 9.2 degrees +/- 1.0 degrees in the intact knee to 13.8 degrees +/- 0.9 degrees. This increase in slope reduced the posterior sag of the PCL-deficient knee, shifting the resting position anteriorly to 4.0 +/- 2.0 mm at 90 degrees. Under a 200-N axial compressive load with the osteotomy, an additional increase in anterior tibial translation to 2.7 +/- 1.7 mm at 30 degrees was
DEFF Research Database (Denmark)
Ma, Ke; Blaabjerg, Frede
2016-01-01
This letter investigates the loss and thermal behaviors of a three-level neutral-point-clamped (3L-NPC) inverter undergoing moderate modulation index, which is typically presented during minor voltage sags of the power grid or speed changes of the electric machines. A series of new space vector m...
Lifescience Database Archive (English)
Full Text Available RASAAVETLEKTDAAIVEKSVN 86 Query: 348 TIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPY...WFNRDRFVLSAGHGCM 527 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPYWFNRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPM... = 9e-54 Identities = 93/100 (93%), Positives = 99/100 (99%) Frame = +3 Query: 327 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNRDRFVL 506 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRDRFVL Sbjct: ...15 LLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVL 74 Query: 507 SAG
KARAKTERISTIK KM. ZAISAN STAR AKIBAT PERUBAHAN MUATAN
Directory of Open Access Journals (Sweden)
Samuel Samuel
2014-02-01
Full Text Available KM. Zaisan Star yang semula merupakan kapal general cargo dimodifikasi menjadi kapal pengangkut kendaraan (vehicle carrier dengan penambahan geladak pada ruang muat dan diatas geladak utama. Penelitian ini bertujuan mengetahui nilai stabilitas dan kekuatan memanjang kapal dari 32 simulasi kondisi karena pengaruh pengisian geladak muat dan kondisi pelayaran kapal. Perhitungan dan analisa pada penelitian ini dilakukan dengan metode pendekatan rumus stabilitas dan kekuatan memanjang kapal yang terintegrasi pada perangkat lunak pekapalan yang mengacu standar IMO dan Rules BKI. Hasil analisa stabilitas menunjukkan nilai GZ terendah pada kondisi XXXI dengan 1,103 m sedangkan kriteria minimumnya 0,200 m. Nilai GM terendah pada kondisi XXXII dengan 1,160 m, sedangkan nilai minimumnya 0,150 m. Pada analisa kekuatan memanjang diperoleh nilai tegangan geladak kondisi air tenang 0,009 N/mm2, sagging 0,013 N/mm2 dan hogging 3,40 N/mm2 serta tegangan alas kondisi air tenang 0,020 N/mm2, sagging 0,029 N/mm2 dan hogging 7,825 N/mm2, nilai tersebut tidak melebihi nilai tegangan ijin kapal 188,815 N/mm2. Perhitungan modulus penampang menunjukkan nilai modulus penampang geladak 831,990 m3 dan alas 1913,974 m3, nilai tersebut memenuhi nilai modulus minimum kapal 0,1824 m3. Perhitungan momen inersia menunjukkan nilai momen inersia sebesar 2899,540 m4, nilai ini memenuhi nilai minimum momen inersia kapal 0,4103 m4.
Long term subsidence movements and behavior of subsidence-damaged structures
International Nuclear Information System (INIS)
Mahar, J.W.; Marino, G.G.
1999-01-01
Surface ground movement related to sag mine subsidence has been monitored above Illinois abandoned room and pillar coal workings for periods of more than 15 years. The long term movement related to a specific mine subsidence is typically small relative to the initial displacements but have caused crack and tilt damage in both repaired and unrepaired structures. Seasonal variations in ground surface elevations are superimposed on the downward movement related to mine subsidence. Thus it is necessary to measure long term subsidence movement at about the same time each year in order to minimize environmental factors. This paper presents long term monitoring data from five subsidence sags in central and southern Illinois. The abandoned coal mine workings are located at depths of 160 to 460 ft below the ground surface. measured residual mine subsidence ranges between 1.4 and 3.6 in. 4.4 to 15 years after mine failure. The magnitude of downward displacement is greater than settlement design values (1 in.) and are at rates (0.0004 to 0.0056 ft/month) that cause damage to structures. Most of the damage in unrepaired structures occurs along existing cracks and separations. In all five cases, the ground movements are continuing at residual rates. Sag subsidence movement in Illinois takes place for a minimum of five years after the damage is manifested at the ground surface. A classification of say development is provided based on the displacement-time data
Massive stars in the Sagittarius Dwarf Irregular Galaxy
Garcia, Miriam
2018-02-01
Low metallicity massive stars hold the key to interpret numerous processes in the past Universe including re-ionization, starburst galaxies, high-redshift supernovae, and γ-ray bursts. The Sagittarius Dwarf Irregular Galaxy [SagDIG, 12+log(O/H) = 7.37] represents an important landmark in the quest for analogues accessible with 10-m class telescopes. This Letter presents low-resolution spectroscopy executed with the Gran Telescopio Canarias that confirms that SagDIG hosts massive stars. The observations unveiled three OBA-type stars and one red supergiant candidate. Pending confirmation from high-resolution follow-up studies, these could be the most metal-poor massive stars of the Local Group.
Cordeiro de Souza, Luciana
2015-01-01
El Sistema Acuífero Guaraní (SAG) es una de las fuentes de aguas subterráneas más importantes de América Latina y abarca un área que comprende partes del territorio de cuatro países: Argentina, Brasil, Paraguay y Uruguay. Su mayor parte se halla en territorio brasileño, en ocho estados: Goiás, Mato Grosso, Mato Grosso do Sul, Minas Gerais, São Paulo, Paraná, Santa Catarina y Rio Grande do Sul. En la cartografía del SAG en el estado de São Paulo se han identificado sus zonas de aflorami...
Aging of concrete structures in nuclear power plants
International Nuclear Information System (INIS)
Naus, D.J.; Pland, C.B.; Arndt, E.G.
1991-01-01
The Structural Aging (SAG) Program, sponsored by the US Nuclear Regulatory Commission (USNRC) and conducted by the Oak Ridge National Laboratory (ORNL), had the overall objective of providing the USNRC with an improved basis for evaluating nuclear power plant structures for continued service. The program consists of three technical tasks: materials property data base, structural component assessment/repair technology, and quantitative methodology for continued service determinations. Major accomplishments under the SAG Program during the first two years of its planned five-year duration have included: development of a Structural Materials Information Center and formulation of a Structural Aging Assessment Methodology for Concrete Structures in Nuclear Power Plants. 9 refs
The costs, challenges, and rewards of management.
Hartfield, J E
1988-01-01
Until recent years, the designation of physicians as managers in medical complexes generally followed three criteria, professionally known as "SAG Factors"--Seniority, Accountability, and Gullibility. Within the scope of these salient features, little room for creative career design or targeting was possible. Given the unprogrammed and largely unprepared conscription of many physicians into early management roles, it is worth noting with pride the frequency with which these early, however "sagging," pioneers rose to the occasion. There is also competent support for the idea that good managers are born, not made, as the plethora of maximally degreed and minimally talented MBAs running loose in corporate ranks today attests.
ALSAT-2A power subsystem behavior during launch, early operation, and in-orbit test
Larbi, N.; Attaba, M.; Beaufume, E.
2012-09-01
In 2006, Algerian Space Agency (ASAL) decided to design and built two optical Earth observation satellites. The first one, ALSAT-2A, was integrated and tested as a training and cooperation program with EADS Astrium. The second satellite ALSAT-2B will be integrated by ASAL engineers in the Satellite Development Center (CDS) at Oran in Algeria. On 12th July 2010, Algeria has launched ALSAT-2A onboard an Indian rocket PSLV-C15 from the Sriharikota launch base, Chennaï. ALSAT-2A is the first Earth observation satellite of the AstroSat-100 family; the design is based on the Myriade platform and comprising the first flight model of the New Astrosat Observation Modular Instrument (NAOMI). This Instrument offers a 2.5m ground resolution for the PAN channel and a 10m ground resolution for four multi-spectral channels which provides high imaging quality. The operations are performed from ALSAT-2 ground segment located in Ouargla (Algeria) and after the test phase ALSAT-2A provides successful images. ALSAT-2A electrical power subsystem (EPS) is composed of a Solar Array Generator (SAG ), a Li-ion battery dedicated to power storage and energy source during eclipse or high consumption phases and a Power Conditioning and Distribution Unit (PCDU). This paper focuses primarily on ALSAT-2A electrical power subsystem behavior during Launch and Early OPeration (LEOP) as well as In Orbit Test (IOT). The telemetry data related to the SAG voltage, current and temperature will be analyzed in addition to battery temperature, voltage, charge and discharge current. These parameters will be studied in function of satellite power consumption.
Expanding the substantial interactome of NEMO using protein microarrays.
LENUS (Irish Health Repository)
Fenner, Beau J
2010-01-01
Signal transduction by the NF-kappaB pathway is a key regulator of a host of cellular responses to extracellular and intracellular messages. The NEMO adaptor protein lies at the top of this pathway and serves as a molecular conduit, connecting signals transmitted from upstream sensors to the downstream NF-kappaB transcription factor and subsequent gene activation. The position of NEMO within this pathway makes it an attractive target from which to search for new proteins that link NF-kappaB signaling to additional pathways and upstream effectors. In this work, we have used protein microarrays to identify novel NEMO interactors. A total of 112 protein interactors were identified, with the most statistically significant hit being the canonical NEMO interactor IKKbeta, with IKKalpha also being identified. Of the novel interactors, more than 30% were kinases, while at least 25% were involved in signal transduction. Binding of NEMO to several interactors, including CALB1, CDK2, SAG, SENP2 and SYT1, was confirmed using GST pulldown assays and coimmunoprecipitation, validating the initial screening approach. Overexpression of CALB1, CDK2 and SAG was found to stimulate transcriptional activation by NF-kappaB, while SYT1 overexpression repressed TNFalpha-dependent NF-kappaB transcriptional activation in human embryonic kidney cells. Corresponding with this finding, RNA silencing of CDK2, SAG and SENP2 reduced NF-kappaB transcriptional activation, supporting a positive role for these proteins in the NF-kappaB pathway. The identification of a host of new NEMO interactors opens up new research opportunities to improve understanding of this essential cell signaling pathway.
DEFF Research Database (Denmark)
Langsted, Lars Bo; Jakobsen, Søren Sandfeld
2014-01-01
Artiklen behandler ud fra en retsdogmatisk metode nogle af de grundlæggende problemstillinger, regler, principper og hensynsafvejninger, der gælder, når staten eller private virksomheder vil gennemføre overvågning af borgerne og dermed gøre indgreb i retten til privatlivets fred. Særlig fokus er ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. ASHIS KUMAR NANDI. Articles written in Journal of Biosciences. Volume 38 Issue 3 September 2013 pp 583-592 Articles. Down-regulation of OsSAG12-1 results in enhanced senescence and pathogen-induced cell death in transgenic rice plants · Subaran Singh Mrunmay Kumar ...
Ether lipid vesicle-based antigens impart protection against experimental listeriosis
Directory of Open Access Journals (Sweden)
Ansari MA
2012-06-01
Full Text Available Mairaj Ahmed Ansari,1 Swaleha Zubair,2 Saba Tufail,1 Ejaj Ahmad,1 Mohsin Raza Khan,1 Zainuddin Quadri,1 Mohammad Owais,11Interdisciplinary Biotechnology Unit, 2Women's College, Aligarh Muslim University, Aligarh, UP, IndiaBackground: Incidence of food-borne infections from Listeria monocytogenes, a parasite that has adapted intracellular residence to avoid antibody onslaught, has increased dramatically in the past few years. The apparent lack of an effective vaccine that is capable of evoking the desired cytotoxic T cell response to obliterate this intracellular pathogen has encouraged the investigation of alternate prophylactic strategies. It should also be noted that Archaebacteria (Archae lipid-based adjuvants enhance the efficacy of subunit vaccines. In the present study, the adjuvant properties of archaeosomes (liposomes prepared from total polar lipids of archaebacteria, Halobacterium salinarum combined with immunogenic culture supernatant antigens of L. monocytogenes have been exploited in designing a vaccine candidate against experimental listeriosis in murine model.Methods: Archaeosome-entrapped secretory protein antigens (SAgs of L. monocytogenes were evaluated for their immunological responses and tendency to deplete bacterial burden in BALB/c mice challenged with sublethal listerial infection. Various immunological studies involving cytokine profiling, lymphocyte proliferation assay, detection of various surface markers (by flowcytometric analysis, and antibody isotypes (by enzyme-linked immunosorbent assay were used for establishing the vaccine potential of archaeosome-entrapped secretory proteins.Results: Immunization schedule involving archaeosome-encapsulated SAgs resulted in upregulation of Th1 cytokine production along with boosted memory in BALB/c mice. It also showed protective effect by reducing listerial burden in various vital organs (liver and spleen of the infected mice. However, the soluble form of the antigens (SAgs
Grötzinger, Stefan W.; Alam, Intikhab; Ba Alawi, Wail; Bajic, Vladimir B.; Stingl, Ulrich; Eppinger, Jörg
2014-01-01
Reliable functional annotation of genomic data is the key-step in the discovery of novel enzymes. Intrinsic sequencing data quality problems of single amplified genomes (SAGs) and poor homology of novel extremophile's genomes pose significant challenges for the attribution of functions to the coding sequences identified. The anoxic deep-sea brine pools of the Red Sea are a promising source of novel enzymes with unique evolutionary adaptation. Sequencing data from Red Sea brine pool cultures and SAGs are annotated and stored in the Integrated Data Warehouse of Microbial Genomes (INDIGO) data warehouse. Low sequence homology of annotated genes (no similarity for 35% of these genes) may translate into false positives when searching for specific functions. The Profile and Pattern Matching (PPM) strategy described here was developed to eliminate false positive annotations of enzyme function before progressing to labor-intensive hyper-saline gene expression and characterization. It utilizes InterPro-derived Gene Ontology (GO)-terms (which represent enzyme function profiles) and annotated relevant PROSITE IDs (which are linked to an amino acid consensus pattern). The PPM algorithm was tested on 15 protein families, which were selected based on scientific and commercial potential. An initial list of 2577 enzyme commission (E.C.) numbers was translated into 171 GO-terms and 49 consensus patterns. A subset of INDIGO-sequences consisting of 58 SAGs from six different taxons of bacteria and archaea were selected from six different brine pool environments. Those SAGs code for 74,516 genes, which were independently scanned for the GO-terms (profile filter) and PROSITE IDs (pattern filter). Following stringent reliability filtering, the non-redundant hits (106 profile hits and 147 pattern hits) are classified as reliable, if at least two relevant descriptors (GO-terms and/or consensus patterns) are present. Scripts for annotation, as well as for the PPM algorithm, are available
Directory of Open Access Journals (Sweden)
Augusto Hauber Gamero
2002-01-01
Full Text Available A necessidade de regulamentação no sistema agroindustrial (SAG da borracha natural no Brasil é evidente. Desde a metade do século, quando o país passou a importar esse produto, vários esforços governamentais vêm sendo definidos, objetivando o desenvolvimento sustentável do setor da produção agrícola nacional de borracha. No ano de 1997, criou-se uma política de subvenção direta à produção. Dada a estrutura desse SAG, associada à conjuntura do mercado internacional e a uma regulamentação falha do governo federal, começaram a surgir indícios de abuso de poder de mercado pela indústria pneumática instalada no país, principal consumidora do produto. Utilizando o arcabouço teórico da organização industrial, neste artigo se procurou levantar evidências nesse sentido.The need for regulation of Brazil’s natural rubber agro-industrial system (SAG is evident. Since the middle of the 20th century, when the country began importing rubber, many governmental efforts have been made to promote the sustainable development of Brazil’s natural rubber productive sector. In 1997, the Brazilian government created a direct subvention policy to assist rubber producers. Given the structure of Brazil’s SAG, the international rubber market, and imperfect regulation by the Federal Government, it would not be unexpected to find signs that Brazil’s largest natural rubber consumer, the domestic tire industry, has begun to abusively exercise its market power. Using the theoretical structure of Industrial Organization, this paper tries to show evidences of this abuse.
Directory of Open Access Journals (Sweden)
Olivia eMason
2014-07-01
Full Text Available During the Deepwater Horizon (DWH oil spill in the Gulf of Mexico a deep-sea hydrocarbon plume developed resulting in a rapid succession of bacteria. Colwellia eventually supplanted Oceanospirillales, which dominated the plume early in the spill. These successional changes may have resulted, in part, from the changing composition and abundance of hydrocarbons over time. Colwellia abundance peaked when gaseous and simple aromatic hydrocarbons increased, yet the metabolic pathway used by Colwellia in hydrocarbon disposition is unknown. Here we used single-cell genomics to gain insights into the genome properties of a Colwellia enriched during the DWH deep-sea plume. A single amplified genome (SAG of a Colwellia cell isolated from a DWH plume, closely related (avg. 98% 16S rRNA gene similarity to other plume Colwellia, was sequenced and annotated. The SAG was similar to the sequenced isolate Colwellia psychrerythraea 34H (84% avg. nucleotide identity. Both had genes for denitrification, chemotaxis and motility, adaptations to cold environments, and a suite of nutrient acquisition genes. The Colwellia SAG may be capable of gaseous and aromatic hydrocarbon degradation, which contrasts with a DWH plume Oceanospirillales SAG genome which encoded non-gaseous n-alkane and cycloalkane degradation. The disparate hydrocarbon degradation pathways are consistent with hydrocarbons that were abundant at different times in the deep-sea plume; first, non-gaseous n-alkanes and cycloalkanes that could be degraded by Oceanospirillales, followed by gaseous, and simple aromatic hydrocarbons that may have been degraded by Colwellia. These insights into the genomic properties of a Colwellia species, which were supported by existing metagenomic sequence data from the plume and DWH contaminated sediments, help further our understanding of the successional changes in the dominant microbial players in the plume over the course of the DWH spill.
Grötzinger, Stefan W.
2014-04-07
Reliable functional annotation of genomic data is the key-step in the discovery of novel enzymes. Intrinsic sequencing data quality problems of single amplified genomes (SAGs) and poor homology of novel extremophile\\'s genomes pose significant challenges for the attribution of functions to the coding sequences identified. The anoxic deep-sea brine pools of the Red Sea are a promising source of novel enzymes with unique evolutionary adaptation. Sequencing data from Red Sea brine pool cultures and SAGs are annotated and stored in the Integrated Data Warehouse of Microbial Genomes (INDIGO) data warehouse. Low sequence homology of annotated genes (no similarity for 35% of these genes) may translate into false positives when searching for specific functions. The Profile and Pattern Matching (PPM) strategy described here was developed to eliminate false positive annotations of enzyme function before progressing to labor-intensive hyper-saline gene expression and characterization. It utilizes InterPro-derived Gene Ontology (GO)-terms (which represent enzyme function profiles) and annotated relevant PROSITE IDs (which are linked to an amino acid consensus pattern). The PPM algorithm was tested on 15 protein families, which were selected based on scientific and commercial potential. An initial list of 2577 enzyme commission (E.C.) numbers was translated into 171 GO-terms and 49 consensus patterns. A subset of INDIGO-sequences consisting of 58 SAGs from six different taxons of bacteria and archaea were selected from six different brine pool environments. Those SAGs code for 74,516 genes, which were independently scanned for the GO-terms (profile filter) and PROSITE IDs (pattern filter). Following stringent reliability filtering, the non-redundant hits (106 profile hits and 147 pattern hits) are classified as reliable, if at least two relevant descriptors (GO-terms and/or consensus patterns) are present. Scripts for annotation, as well as for the PPM algorithm, are available
Tarabees, Elhamy A.; Tewksbury, Barbara J.; Mehrtens, Charlotte J.; Younis, Abdellatif
2017-12-01
Recent work with high resolution satellite imagery has revealed a network of narrow synclines developed during the Oligocene or Miocene over tens of thousands of square kilometers in Eocene limestone of the Thebes Group in the Western Desert of Egypt. The synclines are non-tectonic, and their scale and geometry strongly resemble sag synclines in Qatar that were produced by dissolution of subsurface evaporites and resulting sag of overlying layers. Evaporite dissolution cannot explain the Egypt synclines, because subsurface evaporites of any significance have never been reported in this part of Egypt. In this study, we use audio-magnetotelluric surveys to illuminate the subsurface under the synclines in order to constrain possible models for their formation. We suspected karst dissolution at depth, and, given a modern water table depth of over 400 m, we expected that dry fracture networks and void spaces under the synclines might result in higher electrical resistivities than surrounding coherent limestone. We also anticipated a significant change from high to low resistivity at the contact between the Thebes Group and the underlying Esna Shale at depths of 400 m or more. Instead, we found localized low resistivity zones extending from about 50-100 m below the surface to depths of more than 400 m that are strongly correlated with synclines. We suggest that these localized low resistivity zones are filled with artesian groundwater that has insufficient hydraulic head to rise to the modern topographic surface and that is localized in subsurface voids and collapse breccias produced by dissolution. Sag of overlying limestone layers is a reasonable model for syncline formation but, given the Oligocene/Miocene age of the synclines, dissolution and sag would be unrelated to young groundwater processes.
International Nuclear Information System (INIS)
Mavroidis, P; Boci, N; Kostopoulos, S; Ninos, C; Glotsos, D; Oikonomou, G; Bakas, A; Roka, V; Cavouras, D; Lavdas, E; Sakkas, G; Tsagkalis, A; Chatzivasileiou, V; Batsikas, G; Papanikolaou, N; Stathakis, S
2015-01-01
Purpose: The aim of this present study is to increase bandwidth (BW) and echo train length (ETL) in Proton Density Turbo Spin Echo (PD TSE) sequences with and without fat saturation (FS) as well as in Turbo Inversion Recovery Magnitude sequences (TIRM) in order to assess whether these sequences are capable of reducing susceptibility artifacts. Methods: We compared 1) TIRM coronal (COR) with the same sequence with increased both BW and ETL 2) Conventional PD TSE sagittal (SAG) with FS with an increased BW 3) Conventional PD TSE SAG without FS with an increased BW 4) Conventional PD TSE SAG without FS with increased both BW and ETL. A quantitative analysis was performed to measure the extent of the susceptibility artifacts. Furthermore, a qualitative analysis was performed by two radiologists in order to evaluate the susceptibility artifacts, image distortion and fat suppression. The depiction of cartilage, menisci, muscles, tendons and bone marrow were also qualitatively analyzed. Results: The quantitative analysis found that the modified TIRM sequence is significantly superior to the conventional one regarding the extent of the susceptibility artifacts. In the qualitative analysis, the modified TIRM sequence was superior to the corresponding conventional one in eight characteristics out of ten that were analyzed. The modified PD TSE with FS was superior to the corresponding conventional one regarding the susceptibility artifacts, image distortion and depiction of bone marrow and cartilage while achieving effective fat saturation. The modified PD TSE sequence without FS with a high (H) BW was found to be superior corresponding to the conventional one in the case of cartilage. Conclusion: Consequently, TIRM sequence with an increased BW and ETL is proposed for producing images of high quality and modified PD TSE with H BW for smaller metals, especially when FS is used
Low Voltage Ride-Through Capability Solutions for Permanent Magnet Synchronous Wind Generators
Directory of Open Access Journals (Sweden)
Victor F. Mendes
2016-01-01
Full Text Available Due to the increasing number of wind power plants, several countries have modified their grid codes to include specific requirements for the connection of this technology to the power system. One of the requirements is the ride-through fault capability (RTFC, i.e., the system capability to sustain operation during voltage sags. In this sense, the present paper intends to investigate the behavior of a full-converter wind generator with a permanent magnet synchronous machine during symmetrical and asymmetrical voltage sags. Two solutions to improve the low voltage ride-through capability (LVRT of this technology are analyzed: discharging resistors (brake chopper and resonant controllers (RCs. The design and limitations of these solutions and the others proposed in the literature are discussed. Experimental results in a 34 kW test bench, which represents a scaled prototype of a real 2 MW wind conversion system, are presented.
Characterizing high-temperature deformation of internally heated nuclear fuel element simulators
Energy Technology Data Exchange (ETDEWEB)
Belov, A.I.; Fong, R.W.L.; Leitch, B.W.; Nitheanandan, T.; Williams, A., E-mail: alexander.belov@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada)
2016-06-15
The sag behaviour of a simulated nuclear fuel element during high-temperature transients has been investigated in an experiment utilizing an internal indirect heating method. The major motivation of the experiment was to improve understanding of the dominant mechanisms underlying the element thermo-mechanical response under loss-of-coolant accident conditions and to obtain accurate experimental data to support development of 3-D computational fuel element models. The experiment was conducted using an electrically heated CANDU fuel element simulator. Three consecutive thermal cycles with peak temperatures up to ≈1000 {sup o}C were applied to the element. The element sag deflections and sheath temperatures were measured. On heating up to 600 {sup o}C, only minor lateral deflections of the element were observed. Further heating to above 700 {sup o}C resulted in an element multi-rate creep and significant permanent bow. Post-test visual and X-ray examinations revealed a pronounced necking of the sheath at the pellet-to-pellet interface locations. A wall thickness reduction was detected in the necked region that is interpreted as a sheath longitudinal strain localization effect. The sheath cross-sectioning showed signs of a 'hard' pellet-cladding interaction due to the applied cycles. A 3-D model of the experiment was generated using the ANSYS finite element code. As a fully coupled thermal mechanical simulation is computationally expensive, it was deemed sufficient to use the measured sheath temperatures as a boundary condition, and thus an uncoupled mechanical simulation only was conducted. The ANSYS simulation results match the experiment sag observations well up to the point at which the fuel element started cooling down. (author)
Optical design and performance analysis of a 25 m class telescope with a segmented spherical primary
DEFF Research Database (Denmark)
Owner-Petersen, Mette
1996-01-01
The basic design and an analysis of the performance possibilities of a 25 m class optical telescope are presented here. The configuration consists of a 28 m segmented spherical primary M1 followed by three highly aspherical corrective mirrors M2, M3 and M4 which also deviate from cartesian shape...... sag and windbuffeting. Several types of aspherical figuring of M2, M3 and M4 all resulting in a field performance better than characterized by a RMS spotradius smaller than 0.1 arcseconds within a full FOV of 21 arcminutes are presented....
Improved control system of the thyristor flicker suppressor for the KEK 12-GeV PS
International Nuclear Information System (INIS)
Matsumoto, S.; Baba, H.; Mikawa, K.; Sato, H.; Sueno, T.
1983-01-01
Thyristor control system of the 20 MVar flicker suppressor has been improved essentially. The previous feed forward (FF) loop with each single phase reactive current detector of the MR magnet power supply was exchanged to the present by both FF- and NFB-loops. The FF-loops consists of a three phase reactive power detector of the MPS and a forcing pattern generator on the fast but steady line voltage flicker, sag and surge. The NFB-loops control by the slow parts of the flicker and the unbalanced line voltages. These detectors of the reactive power, the voltage flicker and the unbalance have been developed. Sampled voltage flicker data with 12 bit ADC are processed by Z-80A micro computer system and the forcing pattern is generated by the system through 12 bit DAC into the loop. A typical voltage flicker including sag and surge has been reduced within + or - 1.5%, about 1/3 compared to the previous, at 66 kV primary line
International Nuclear Information System (INIS)
Al-Mossawy, Mohammed Idrees; Demiral, Birol; Raja, D M Anwar
2013-01-01
Foam is used in enhanced oil recovery to improve the sweep efficiency by controlling the gas mobility. The surfactant-alternating-gas (SAG) foam process is used as an alternative to the water-alternating-gas (WAG) injection. In the WAG technique, the high mobility and the low density of the gas lead the gas to flow in channels through the high permeability zones of the reservoir and to rise to the top of the reservoir by gravity segregation. As a result, the sweep efficiency decreases and there will be more residual oil in the reservoir. The foam can trap the gas in liquid films and reduces the gas mobility. The fractional-flow method describes the physics of immiscible displacements in porous media. Finding the water fractional flow theoretically or experimentally as a function of the water saturation represents the heart of this method. The relative permeability function is the conventional way to derive the fractional-flow function. This study presents an improved relative permeability model to derive the fractional-flow functions for WAG and SAG foam core-floods. The SAG flow regimes are characterized into weak foam, strong foam without a shock front and strong foam with a shock front. (paper)
COS2025: Extending the Lifetime of the FUV channel of the Cosmic Origins Spectrograph to 2025
Rafelski, Marc; De Rosa, Gisella; Fischer, William J.; Fix, Mees; Fox, Andrew; Indriolo, Nick; James, Bethan; Magness, Camellia; Oliveira, Cristina M.; Penton, Steven V.; Plesha, Rachel; Roman-Duval, Julia; Sahnow, David J.; Sankrit, Ravi; Snyder, Elaine M.; Taylor, Joanna M.; White, James
2018-01-01
The Hubble Space Telescope's Cosmic Origins Spectrograph (COS) Far-Ultraviolet (FUV) microchannel plate detector's efficiency at converting incoming photons into detectable events decreases with usage. This depletion of the detector's gain (i.e. gain sag) results in unusable regions of the COS/FUV detector. In order to mitigate this gain sag, a number of strategies have been employed over the past 8 years of operations, ranging from moving to different lifetime positions, to managing the high voltage to extract a smaller amount of charge, to re-distributing the cenwave usage so that Ly-alpha does not produce a gain-sag hole in a given location. We are now at a point where none of the strategies above will, without any other changes, allow us to continue operating the COS/FUV detector to 2025. To address this a new COS2025 policy was developed, with the goal of retaining full science capability of COS/FUV to 2025. We present an overview of the COS2025 policy, which places restrictions on the G130M cenwaves allowed at Lifetime Position 4 (LP4). We also present a tool which allows users to visualize the COS/FUV wavelength ranges to help users prepare their proposals in the light of the restrictions on the G130M cenwaves.
Performance Comparison of Grid-Faulty Control Schemes for Inverter-Based Industrial Microgrids
Directory of Open Access Journals (Sweden)
Antonio Camacho
2017-12-01
Full Text Available Several control schemes specifically designed to operate inverter-based industrial microgrids during voltage sags have been recently proposed. This paper first classifies these control schemes in three categories and then performs a comparative analysis of them. Representative control schemes of each category are selected, described and used to identify the main features and performance of the considered category. The comparison is based on the evaluation of several indexes, which measure the power quality of the installation and utility grid during voltage sags, including voltage regulation, reactive current injection and transient response. The paper includes selected simulation results from a 500 kVA industrial microgrid to validate the expected features of the considered control schemes. Finally, in view of the obtained results, the paper proposes an alternative solution to cope with voltage sags, which includes the use of a static compensator in parallel with the microgrid. The novelty of this proposal is the suitable selection of the control schemes for both the microgrid and the static compensator. The superior performance of the proposal is confirmed by the analysis of the quality indexes. Its practical limitations are also revealed, showing that the topic studied in this paper is still open for further research.
7 CFR 1755.506 - Aerial wire services
2010-01-01
... ANSI/IEEE C2-1997, NESC, or local laws or ordinances, whichever are the most stringent. The National... maximum practicable sag consistent with the required ground clearance and good construction practices. In..., sufficient slack shall be provided so that each aerial service wire shall reach any binding post position as...
New approaches to provide ride-through for critical loads in electric power distribution systems
Montero-Hernandez, Oscar C.
2001-07-01
The extensive use of electronic circuits has enabled modernization, automation, miniaturization, high quality, low cost, and other achievements regarding electric loads in the last decades. However, modern electronic circuits and systems are extremely sensitive to disturbances from the electric power supply. In fact, the rate at which these disturbances happen is considerable as has been documented in recent years. In response to the power quality concerns presented previously, this dissertation is proposing new approaches to provide ride-through for critical loads during voltage disturbances with emphasis on voltage sags. In this dissertation, a new approach based on an AC-DC-AC system is proposed to provide ride-through for critical loads connected in buildings and/or an industrial system. In this approach, a three-phase IGBT inverter with a built in Dc-link voltage regulator is suitably controlled along with static by-pass switches to provide continuous power to critical loads. During a disturbance, the input utility source is disconnected and the power from the inverter is connected to the load. The remaining voltage in the AC supply is converted to DC and compensated before being applied to the inverter and the load. After detecting normal utility conditions, power from the utility is restored to the critical load. In order to achieve an extended ride-through capability a second approach is introduced. In this case, the Dc-link voltage regulator is performed by a DC-DC Buck-Boost converter. This new approach has the capability to mitigate voltage variations below and above the nominal value. In the third approach presented in this dissertation, a three-phase AC to AC boost converter is investigated. This converter provides a boosting action for the utility input voltages, right before they are applied to the load. The proposed Pulse Width Modulation (PWM) control strategy ensures independent control of each phase and compensates for both single-phase or poly
SU-E-T-459: Impact of Source Position and Traveling Time On HDR Skin Surface Applicator Dosimetry
International Nuclear Information System (INIS)
Jeong, J; Barker, C; Zaider, M; Cohen, G
2015-01-01
Purpose: Observed dosimetric discrepancy between measured and treatment planning system (TPS) predicted values, during applicator commissioning, were traced to source position uncertainty in the applicator. We quantify the dosimetric impact of this geometric uncertainty, and of the source traveling time inside the applicator, and propose corrections for clinical use. Methods: We measured the dose profiles from the Varian Leipzig-style (horizontal) HDR skin applicator, using EBT3 film, photon diode, and optically stimulated luminescence dosimeter (OSLD) and three different GammaMed HDR afterloders. The dose profiles and depth dose of each aperture were measured at several depths (up to about 10 mm, depending on the dosimeter). The measured dose profiles were compared with Acuros calculated profiles in BrachyVision TPS. For the impact of the source position, EBT3 film measurements were performed with applicator, facing-down and facing-up orientations. The dose with and without source traveling was measured with diode detector using HDR timer and electrometer timer, respectively. Results: Depth doses measured using the three dosimeters were in good agreement, but were consistently higher than the Acuros dose calculations. Measurements with the applicator facing-up were significantly lower than those in the facing-down position with maximum difference of about 18% at the surface, due to source sag inside the applicator. Based on the inverse-square law, the effective source sag was evaluated to be about 0.5 mm from the planned position. The additional dose from the source traveling was about 2.8% for 30 seconds with 10 Ci source, decreasing with increased dwelling time and decreased source activity. Conclusion: Due to the short source-to-surface distance of the applicator, the small source sag inside the applicator has significant dosimetric impact, which should be considered before the clinical use of the applicator. Investigation of the effect for other applicators
Improvement of power quality using distributed generation
Energy Technology Data Exchange (ETDEWEB)
Moreno-Munoz, A.; Lopez-Rodriguez, M.A.; Flores-Arias, J.M.; Bellido-Outerino, F.J. [Universidad de Cordoba, Departamento A.C., Electronica y T.E., Escuela Politecnica Superior, Campus de Rabanales, E-14071 Cordoba (Spain); de-la-Rosa, J.J.G. [Universidad de Cadiz, Area de Electronica, Dpto. ISA, TE y Electronica, Escuela Politecnica Superior Avda, Ramon Puyol, S/N, E-11202-Algeciras-Cadiz (Spain); Ruiz-de-Adana, M. [Universidad de Cordoba, Departamento de Quimica Fisica y Termodinamica Aplicada, Campus de Rabanales, E-14071 Cordoba (Spain)
2010-12-15
This paper addresses how Distributed Generation (DG), particularly when configured in Combined Heat and Power (CHP) mode, can become a powerful reliability solution in highlight automated factories, especially when integrated with complimentary Power Quality (PQ) measures. The paper presents results from the PQ audit conducted at a highly automated plant over last year. It was found that the main problems for the equipment installed were voltage sags. Among all categories of electrical disturbances, the voltage sag (dip) and momentary interruption are the nemeses of the automated industrial process. The paper analyzes the capabilities of modern electronic power supplies and the convenience of embedded solution. Finally it is addressed the role of the DG/CHP on the reliability of digital factories. (author)
A Case Study Of Turkish Transmission System For VoltageDips
DEFF Research Database (Denmark)
Inan, E.; Alboyaci, B.; Bak, Claus Leth
2009-01-01
Power quality problems usually appear in the form of voltage sags, transients and harmonics. From these three broad categories of power quality problems, voltage dips account the most disturbances experienced by industrial customers. Voltage dips generally refer to instantaneous short-duration vo......Power quality problems usually appear in the form of voltage sags, transients and harmonics. From these three broad categories of power quality problems, voltage dips account the most disturbances experienced by industrial customers. Voltage dips generally refer to instantaneous short...... analysis of voltage dip performance of the whole transmission system, is used to compare with results constructed fault statics from SIMPOW DIPS analysis program real data. SIMPOW DIPS software enables to calculate dip frequency for all busses and lines....
7 CFR 42.112 - Defects of containers: Tables IV, V, VI, and VII.
2010-01-01
... Chip in glass 202 Stone (unmelted material) in glass 203 Pits in surface of glass 204 Sagging surface... permitted. Table VII—Flexible Containers (Plastic, Cello, Paper, Textile, etc.) Defects Categories Critical...
Genotyping of Toxoplasma Gondii Isolates from Soil Samples in Tehran, Iran
Directory of Open Access Journals (Sweden)
M Tavalla
2013-06-01
Full Text Available Background: The protozoan parasite Toxoplasma gondii can infect any warm blooded nucleated cells. One of the ways for human infection is ingestion of oocysts directly from soil or via infected fruits or vegetables. To survey the potential role of T. gondii oocyst in soil samples, the present study was conducted in Tehran City, Iran.Methods: A total of 150 soil samples were collected around rubbish dumps, children's play ground, parks and public places. Oocysts recovery was performed by sodium nitrate flotation method on soil samples. For molecular detection, PCR reaction targeting B1 gene was performed and then, the positive results were confirmed using repetitive 529 bp DNA fragment in other PCR reaction. Finally, the positive samples were genotyped at the SAG2 locus.Results: Toxoplasma DNA was found in 13 soil samples. After genotyping and RFLP analysis in SAG2 locus, nine positive samples were revealed type III, one positive sample was type I whereas three samples revealed mixed infection (type, I & III.Conclusion: The predominant genotype in Tehran soil samples is type III.
Mn2O7: Eksplosionsfarlig - men ikke lunefuld
DEFF Research Database (Denmark)
Johansen, Jørgen Stage; Berg, Rolf W.
2004-01-01
Artiklen »En lunefuld blanding« i Dansk Kemi, maj 2004 har tilsyneladende ført Flemming Winthers tankevirksom-hed i mange retninger. De faglige overvejelser om eksplo-sionsrisiko og det kreative bidrag til affaldshåndtering lyder spændende, mens de polemiske bemærkninger om nulrisi-ko-samfundet, ......-ko-samfundet, uddannelse, økonomi og sprogopfattelse er bemærkelsesværdige for en person, der samtidig efterlyser en mere videnskabelig tilgang til den konkrete sag. http://www.lab-link.dk/lablink/gfx.nsf/Files/Dak08.pdf/$file/Dak08.pdf....
Nurul Misbah, Mohammad; Setyawan, Dony; Murti Dananjaya, Wisnu
2018-03-01
This research aims to determine the longitudinal strength of passenger ship which was converted from Landing Craft Tank with 54 m of length as stated by BKI (Biro Klasifikasi Indonesia / Indonesian Classification Bureau). Verification of strength value is done to 4 (four) loading conditions which are (1) empty load condition during sagging wave, (2) empty load condition during hogging wave, (3) full load condition during sagging wave and (4) full load condition during hogging wave. Analysis is done using Finite Element Analysis (FEA) software by modeling the entire part of passenger ship and its loading condition. The back and upfront part of ship centerline were used as the boundary condition. From that analysis it can be concluded that the maximum stress for load condition (1) is 72,393 MPa, 74,792 MPa for load condition (2), 129,92 MPa for load condition (3), and 132,4 MPa for load condition (4). Longitudinal strength of passenger ship fulfilled the criteria of empty load condition having smaller stress value than allowable stress which is 90 MPa, and during full load condition with smaller stress value than allowable stress which is 150 MPa. Analysis on longitudinal strength comparison with entire ship plate thickness variation of ± 2 mm from initial plate was also done during this research. From this research it can be concluded that plate thickness reduction causes the value of longitudinal strength to decrease, while plate thickness addition causes the value of longitudinal strength to increase.
Da abort ikke var en sag for kvinden
DEFF Research Database (Denmark)
Schultz, Annette Østergaard
2013-01-01
Case fra tiden før 1973, hvor der ikke var fri abort i Danmark. Sagen er fundet i Mødrehjælpens arkiv og giver som andre sager indblik i kvindens situation. Led i serien: Nyt i arkivet.......Case fra tiden før 1973, hvor der ikke var fri abort i Danmark. Sagen er fundet i Mødrehjælpens arkiv og giver som andre sager indblik i kvindens situation. Led i serien: Nyt i arkivet....
Staphylococcal superantigens stimulate immortalized human adipocytes to produce chemokines.
Directory of Open Access Journals (Sweden)
Bao G Vu
Full Text Available BACKGROUND: Human adipocytes may have significant functions in wound healing and the development of diabetes through production of pro-inflammatory cytokines after stimulation by gram-negative bacterial endotoxin. Diabetic foot ulcers are most often associated with staphylococcal infections. Adipocyte responses in the area of the wound may play a role in persistence and pathology. We studied the effect of staphylococcal superantigens (SAgs on immortalized human adipocytes, alone and in the presence of bacterial endotoxin or staphylococcal α-toxin. METHODOLOGY/PRINCIPAL FINDINGS: Primary non-diabetic and diabetic human preadipocytes were immortalized by the reverse transcriptase component of telomerase (TERT and the E6/E7 genes of human papillomavirus. The immortal cells were demonstrated to have properties of non-immortalized pre-adipocytes and could be differentiated into mature and functional adipocytes. Differentiated adipocytes exposed to staphylococcal SAgs produced robust levels of cytokines IL-6 and IL-8, but there were no significant differences in levels between the non-diabetic and diabetic cells. Cytokine production was increased by co-incubation of adipocytes with SAgs and endotoxin together. In contrast, α-toxin alone was cytotoxic at high concentrations, but, at sub-cytotoxic doses, did not stimulate production of IL-6 and IL-8. CONCLUSIONS/SIGNIFICANCE: Endotoxin has been proposed to contribute to diabetes through enhanced insulin resistance after chronic exposure and stimulation of adipocytes to produce cytokines. Our data indicate staphylococcal SAgs TSST-1 and SEB alone and in combination with bacterial endotoxin also stimulate adipocytes to produce cytokines and thus may contribute to the inflammatory response found in chronic diabetic ulcers and in the systemic inflammation that is associated with the development and persistence of diabetes. The immortal human pre-adipocytes reported here will be useful for studies to
Communication and Attitude Revision
1992-01-01
Conference on Aritificial Intelligence , (1989) 1074- 1079 3. Clark, H., Marshal, C.: Definite reference and mutual knowledge. In Joshi, A., Sag, I.. and...21st Annual Meeting of the ACL (1983) 57-63 9. Konolige, K.: On the relation between default and autoepistemic logic. Artificial Intelligence 35(3...reasoning. Artificial Intelligence 13 (1980) 81-132 16. Richmond Thomason. Accommodation, meaning, and implicature. In Cohen, P., Morgan, J., and
International Nuclear Information System (INIS)
Naus, D.J.; Marchbanks, M.F.; Oland, C.B.; Arndt, E.G.
1989-01-01
The Structural Aging (SAG) Program is carried out by the Oak Ridge National Laboratory (ORNL) under sponsorship of the United States Nuclear Regulatory Commission (USNRC). The Program has evolved from preliminary studies conducted to evaluate the long-term environmental challenges to light-water reactor safety-related concrete civil structures. An important conclusion of these studies was that a damage methodology, which can provide a quantitative measure of a concrete structure's durability with respect to potential future requirements, needs to be developed. Under the SAG Program, this issue is being addressed through: establishment of a structural materials information center, evaluation of structural component assessment and repair technologies, and development of a quantitative methodology for structural aging determinations. Progress to date of each of these activities is presented as well as future plans. 7 refs., 5 figs
Directory of Open Access Journals (Sweden)
Carlos Henryque de Souza e Silva
2012-05-01
Full Text Available The aim of this work was to evaluate the utility of ELISA-based testing of total IgG (IgGt antibodies and its subclasses (IgG1, IgG2, IgG3 and IgG4 against soluble (STAg and recombinant (rSAG1 and rMIC3 antigens of Toxoplasma gondii for diagnosing congenital toxoplasmosis. Sera from 217 newborns initially testing positive for specific IgM in filter paper dried blood spots were tested for specific IgM and IgG by ELFA-VIDAS®. Congenital toxoplasmosis was confirmed in 175 and ruled out in 42 infants. The validity of the ELISA tests was determined using the persistence of IgG antibodies (ELFA-VIDAS® kit at the end of 12 months, which is considered the reference test for the diagnosis of congenital toxoplasmosis. The frequency of positivity with IgGt against STAg, rSAG1 and rMIC3 was found in 97.2%, 96.3% and 80.2%, respectively, of the newborns with confirmed congenital toxoplasmosis. IgG1 reacted with all three antigens, while IgG3 and IgG4 reacted preferentially with rMIC3. Higher mean values of reactivity (sample optical density/cut-off were found for all subclasses when using rMIC3. All of the antigens showed high sensitivity and low specificity in detecting anti-T. gondii IgGt and IgG1 and low sensitivity and high specificity in detecting IgG3 and IgG4. In conclusion, the combined detection of IgG antibody subclasses against recombinant toxoplasmic antigens may be useful for the early diagnosis of congenital toxoplasmosis.
Grö tzinger, Stefan W.; Alam, Intikhab; Ba Alawi, Wail; Bajic, Vladimir B.; Stingl, Ulrich; Eppinger, Jö rg
2014-01-01
Reliable functional annotation of genomic data is the key-step in the discovery of novel enzymes. Intrinsic sequencing data quality problems of single amplified genomes (SAGs) and poor homology of novel extremophile's genomes pose significant
Advanced Manufacture of Reflectors
Energy Technology Data Exchange (ETDEWEB)
Angel, Roger [Univ. of Arizona, Tucson, AZ (United States)
2014-12-17
The main project objective has been to develop an advanced gravity sag method for molding large glass solar reflectors with either line or point focus, and with long or short focal length. The method involves taking standard sized squares of glass, 1.65 m x 1.65 m, and shaping them by gravity sag into precision steel molds. The method is designed for high volume manufacture when incorporated into a production line with separate pre-heating and cooling. The performance objectives for the self-supporting glass mirrors made by this project include mirror optical accuracy of 2 mrad root mean square (RMS), requiring surface slope errors less than 1 mrad rms, a target not met by current production of solar reflectors. Our objective also included development of new methods for rapidly shaping glass mirrors and coating them for higher reflectivity and soil resistance. Reflectivity of 95% for a glass mirror with anti-soil coating was targeted, compared to the present ~94% with no anti-soil coating. Our mirror cost objective is ~$20/m2 in 2020, a significant reduction compared to the present ~$35/m2 for solar trough mirrors produced for trough solar plants.
Utility Test Results of a 2-Megawatt, 10-Second Reserve-Power System
Energy Technology Data Exchange (ETDEWEB)
BALL,GREG J.; NORRIS,BENJAMIN L.
1999-10-01
This report documents the 1996 evaluation by Pacific Gas and Electric Company of an advanced reserve-power system capable of supporting 2 MW of load for 10 seconds. The system, developed under a DOE Cooperative Agreement with AC Battery Corporation of East Troy, Wisconsin, contains battery storage that enables industrial facilities to ''ride through'' momentary outages. The evaluation consisted of tests of system performance using a wide variety of load types and operating conditions. The tests, which included simulated utility outages and voltage sags, demonstrated that the system could provide continuous power during utility outages and other disturbances and that it was compatible with a variety of load types found at industrial customer sites.
... keep your back straight. Using your front leg, push back into the starting position. Repeat on the other ... your back sag. Press into your arms to push yourself back up. If it is too hard to do ...
Steam foam studies in the presence of residual oil
Energy Technology Data Exchange (ETDEWEB)
Hutchinson, D.A.; Demiral, B.; Castanier, L.M.
1992-05-01
The lack of understanding regarding foam flow in porous media necessitates further research. This paper reports on going work at Stanford University aimed at increasing our understanding in the particular area of steam foams. The behavior of steam foam is investigated with a one dimensional (6 ft. {times} 2.15 in.) sandpack under residual oil conditions of approximately 12 percent. The strength of the in-situ generated foam, indicated by pressure drops, is significantly affected by injection procedure, slug size, and steam quality. The surfactant concentration effect is minor in the range studied. In the presence of residual oil the simultaneous injection of steam and surfactant fails to generate foam in the model even though the same procedure generates a strong foam in the absence of oil. Nevertheless when surfactant is injected as a slug ahead of the steam using a surfactant alternating (SAG) procedure, foam is generated. The suggested reason for the success of SAG is the increased phase mixing that results from steam continually having to reestablish a path through a slug of surfactant solution.
Microscopic analysis and simulation of check-mark stain on the galvanized steel strip
So, Hongyun; Yoon, Hyun Gi; Chung, Myung Kyoon
2010-11-01
When galvanized steel strip is produced through a continuous hot-dip galvanizing process, the thickness of adhered zinc film is controlled by plane impinging air gas jet referred to as "air-knife system". In such a gas-jet wiping process, stain of check-mark or sag line shape frequently appears. The check-mark defect is caused by non-uniform zinc coating and the oblique patterns such as "W", "V" or "X" on the coated surface. The present paper presents a cause and analysis of the check-mark formation and a numerical simulation of sag lines by using the numerical data produced by Large Eddy Simulation (LES) of the three-dimensional compressible turbulent flow field around the air-knife system. It was found that there is alternating plane-wise vortices near the impinging stagnation region and such alternating vortices move almost periodically to the right and to the left sides on the stagnation line due to the jet flow instability. Meanwhile, in order to simulate the check-mark formation, a novel perturbation model has been developed to predict the variation of coating thickness along the transverse direction. Finally, the three-dimensional zinc coating surface was obtained by the present perturbation model. It was found that the sag line formation is determined by the combination of the instantaneous coating thickness distribution along the transverse direction near the stagnation line and the feed speed of the steel strip.
Directory of Open Access Journals (Sweden)
Yanli Huang
2016-12-01
Full Text Available Since the weight of overburden is sustained by both the backfill body and the unmined solid coal in coal mining with compacted backfilling (CMCB panels, the stress and deformation characteristics of the surrounding rocks in coal mining are radically changed. The overburden movement control mechanism by coordinating with backfill body and shield in CMCB was studied systematically in this paper. Based on the analysis of deformational and structural characteristics of surrounding rock in CMCB panels, the methods of theoretical analysis, numerical simulation and engineering test are employed. The results show that the fracture of the main roof is mainly controlled by the filling ratio φ and is non-correlated to the shield supporting pressure p. However, p has a significant control effect on the deflection of roof within the shield canopy length, and adversely affects the filling ratio. With the increase of the filling ratio of the gob, the maximum sagging of the immediate and the main roofs, the peak front and the influence range of the abutment pressures are gradually reduced. Correspondingly, the stable period of internal pressure of backfill body in the gob is shortened. Engineering practice shows that the sagging of the gob roof, the distribution of the abutment pressure, the distribution of the internal pressure in the backfill body, and the ground surface sagging results obtained by the in-situ measurement are approximately corresponding to the theoretical analysis and numerical simulation results.
Optimized dispatch of wind farms with power control capability for power system restoration
DEFF Research Database (Denmark)
Xie, Yunyun; Liu, Changsheng; Wu, Qiuwei
2017-01-01
As the power control technology of wind farms develops, the output power of wind farms can be constant, which makes it possible for wind farms to participate in power system restoration. However, due to the uncertainty of wind energy, the actual output power can’t reach a constant dispatch power...... in all time intervals, resulting in uncertain power sags which may induce the frequency of the system being restored to go outside the security limits. Therefore, it is necessary to optimize the dispatch of wind farms participating in power system restoration. Considering that the probability...... distribution function (PDF) of transient power sags is hard to obtain, a robust optimization model is proposed in this paper, which can maximize the output power of wind farms participating in power system restoration. Simulation results demonstrate that the security constraints of the restored system can...
Approximate Series Solutions for Nonlinear Free Vibration of Suspended Cables
Directory of Open Access Journals (Sweden)
Yaobing Zhao
2014-01-01
Full Text Available This paper presents approximate series solutions for nonlinear free vibration of suspended cables via the Lindstedt-Poincare method and homotopy analysis method, respectively. Firstly, taking into account the geometric nonlinearity of the suspended cable as well as the quasi-static assumption, a mathematical model is presented. Secondly, two analytical methods are introduced to obtain the approximate series solutions in the case of nonlinear free vibration. Moreover, small and large sag-to-span ratios and initial conditions are chosen to study the nonlinear dynamic responses by these two analytical methods. The numerical results indicate that frequency amplitude relationships obtained with different analytical approaches exhibit some quantitative and qualitative differences in the cases of motions, mode shapes, and particular sag-to-span ratios. Finally, a detailed comparison of the differences in the displacement fields and cable axial total tensions is made.
Flexible voltage support control for three-phase distributed generation inverters under grid fault
DEFF Research Database (Denmark)
Camacho, Antonio; Castilla, Miguel; Miret, Jaume
2013-01-01
Operators describe the behavior of the energy source, regulating voltage limits and reactive power injection to remain connected and support the grid under fault. On the basis that different kinds of voltage sags require different voltage support strategies, a flexible control scheme for three phase grid...... connected inverters is proposed. In three phase balanced voltage sags, the inverter should inject reactive power in order to raise the voltage in all phases. In one or two phase faults, the main concern of the distributed generation inverter is to equalize voltages by reducing the negative symmetric...... sequence and clear the phase jump. Due to system limitations, a balance between these two extreme policies is mandatory. Thus, over-voltage and undervoltage can be avoided, and the proposed control scheme prevents disconnection while achieving the desired voltage support service. The main contribution...
Grö tzinger, Stefan W.; Karan, Ram; Strillinger, Eva; Bader, Stefan; Frank, Annika; Al Rowaihi, Israa; Akal, Anastassja; Wackerow, Wiebke; Archer, John A.C.; Rueping, Magnus; Weuster-Botz, Dirk; Groll, Michael; Eppinger, Jö rg; Arold, Stefan T.
2017-01-01
Because only 0.01% of prokaryotic genospecies can be cultured and in situ observations are often impracticable, culture-independent methods are required to understand microbial life and harness potential applications of microbes. Here, we report a methodology for the production of proteins with desired functions based on single amplified genomes (SAGs) from unculturable species. We use this method to resurrect an alcohol dehydrogenase (ADH/D1) from an uncharacterized halo-thermophilic archaeon collected from a brine pool at the bottom of the Red Sea. Our crystal structure of 5,6-dihydroxy NADPH-bound ADH/D1 combined with biochemical analyses reveal the molecular features of its halo-thermophily, its unique habitat adaptations, and its possible reaction mechanism for atypical oxygen activation. Our strategy offers a general guide for using SAGs as a source for scientific and industrial investigations of ‘microbial dark matter’.
Strain change and creep behavior of STACIR/AW power line with heat exposure
Energy Technology Data Exchange (ETDEWEB)
Kim, B.G.; Park, S.D.; Kim, S.S.; Lee, H.W. [Overhead Conductor Research Lab., Korea Electrotechnology Research Inst., Changwon (Korea)
2005-07-01
As a way to expand electric capacity in power line with hovering of electric power demand, STACIR/AW (super thermal-resistant Al alloy conductors Al-clad Invar-reinforced) overhead conductor which cans double ampacity has been developed. The STACIR/AW power line is mechanically composite stranded wire composed of INVAR/AW stranded wire as core for sag control and heat-resistant aluminum alloy for delivering doubled electric current. Recently, in order to ensure stable line operation and to predict its span of life, the changes of thermal properties for STACIR/AW have been investigated. In the present work, the changes of strain with temperature and the creep behavior as important factors in sag control will be presented. The transition temperature of STACIR/AW 410 sqmm was estimated approximately 130 C and the creep rates were decreased with temperatures. (orig.)
Grötzinger, Stefan W.
2017-11-30
Because only 0.01% of prokaryotic genospecies can be cultured and in situ observations are often impracticable, culture-independent methods are required to understand microbial life and harness potential applications of microbes. Here, we report a methodology for the production of proteins with desired functions based on single amplified genomes (SAGs) from unculturable species. We use this method to resurrect an alcohol dehydrogenase (ADH/D1) from an uncharacterized halo-thermophilic archaeon collected from a brine pool at the bottom of the Red Sea. Our crystal structure of 5,6-dihydroxy NADPH-bound ADH/D1 combined with biochemical analyses reveal the molecular features of its halo-thermophily, its unique habitat adaptations, and its possible reaction mechanism for atypical oxygen activation. Our strategy offers a general guide for using SAGs as a source for scientific and industrial investigations of ‘microbial dark matter’.
DEFF Research Database (Denmark)
Yang, Yongheng; Hadjidemetriou, Lenos; Blaabjerg, Frede
2015-01-01
Grid-connected renewables are increasingly developed in recent years, e.g. wind turbine systems and photovoltaic systems. Synchronization of the injected current with the grid is mandatory. However, grid disturbances like voltage sags, harmonics, and frequency deviations may occur during operatio...
Jansen, H.G.P.; Pender, J.; Damon, A.; Schipper, R.A.
2006-01-01
The survey was a research collaboration between International Food Policy Research Institute (IFPRI), Wageningen University and Research Center (WUR), and the National Program for Sustainable Rural Development (PRONADERS) of the Honduran Ministry of Agriculture and Livestock (SAG).The data were
Design and control of single-phase dynamic voltage restorer
Indian Academy of Sciences (India)
Amit Meena
... voltage sag and swell. Modelling of the DVR and its controller design is included in ..... simulation study of DVR is accomplished in MATLAB/. Simulink. Parameters of ..... During this process, the PWM signals generated by the DSP are not as ...
Veevers, J. J.
2013-12-01
A robust geochronology based on U-Pb zircon ages in Australia (n = 158) and Europe (n = 376) provides a rigorous test of (1) the model of a climatic-tectonic cycle of a single continent (Pangea) and ocean (Panthalassa) with an icehouse climate alternating with many continents and oceans with a greenhouse climate, and (2) the idea of coeval (320 to 300 Ma) right-lateral shear events in Eastern Australia and Europe followed by earliest Permian (~ 300 Ma) extension. During Pangean assembly, stress from the oblique collision of Laurussia and Gondwanaland bent the oroclines in Iberia, drove the intense shortening in Central Australia and terminal megakinking in the Lachlan orogen, and possibly drove the bending of oroclines in Eastern Australia. Extension I (~ 300 Ma, Carboniferous/Permian) followed the first outburst of self-induced (monsoonal) heat from the newly assembled Pangea, and generated fresh accommodation space for globally synchronous sedimentary successions, including the glacial base and succeeding coals of the Gondwana facies. Extension was relieved by sags on (isotropic) cratons and rifts on (anisotropic) fold belts with voluminous volcanics. In Europe, the Variscan orogen was cut into right-lateral magmatic rifts and the craton sagged to accumulate magmatic basins; likewise, the convergent margin of Eastern Australia was cut into a long magmatic rift and the cratonic foreland covered by the Gondwana facies. The end-Permian (251 Ma) sea-level drawdown, climate warming, and severe biotic extinction, with no obvious tectonic cause, were responsible for the Early-Middle Triassic coal gap. A second outburst of heat drove Extension II (235 Ma, Carnian, Late Triassic), expressed as rifts and sags that accumulated a second set of coal-bearing strata. At this time of its largest extent, Pangea underwent incipient breakup by rifting of the Atlantic Margins of North America, Morocco, and Western Europe that developed into 190 Ma drifting.
Gaudino, Mario; Alexander, John H; Bakaeen, Faisal G; Ballman, Karla; Barili, Fabio; Calafiore, Antonio Maria; Davierwala, Piroze; Goldman, Steven; Kappetein, Peter; Lorusso, Roberto; Mylotte, Darren; Pagano, Domenico; Ruel, Marc; Schwann, Thomas; Suma, Hisayoshi; Taggart, David P; Tranbaugh, Robert F; Fremes, Stephen
2017-12-01
The primary hypothesis of the ROMA trial is that in patients undergoing primary isolated non-emergent coronary artery bypass grafting, the use of 2 or more arterial grafts compared with a single arterial graft (SAG) is associated with a reduction in the composite outcome of death from any cause, any stroke, post-discharge myocardial infarction and/or repeat revascularization. The secondary hypothesis is that in these patients, the use of 2 or more arterial grafts compared with a SAG is associated with improved survival. The ROMA trial is a prospective, unblinded, randomized event-driven multicentre trial comprising at least 4300 subjects. Patients younger than 70 years with left main and/or multivessel disease will be randomized to a SAG or multiple arterial grafts to the left coronary system in a 1:1 fashion. Permuted block randomization stratified by the centre and the type of second arterial graft will be used. The primary outcome will be a composite of death from any cause, any stroke, post-discharge myocardial infarction and/or repeat revascularization. The secondary outcome will be all-cause mortality. The primary safety outcome will be a composite of death from any cause, any stroke and any myocardial infarction. In all patients, 1 internal thoracic artery will be anastomosed to the left anterior descending coronary artery. For patients randomized to the SAG group, saphenous vein grafts will be used for all non-left anterior descending target vessels. For patients randomized to the multiple arterial graft group, the main target vessel of the lateral wall will be grafted with either a radial artery or a second internal thoracic artery. Additional grafts for the multiple arterial graft group can be saphenous veins or supplemental arterial conduits. To detect a 20% relative reduction in the primary outcome, with 90% power at 5% alpha and assuming a time-to-event analysis, the sample size must include 845 events (and 3650 patients). To detect a 20% relative
Directory of Open Access Journals (Sweden)
Giuseppina La Face
2011-04-01
Full Text Available «Musica Docta» è una rivista digitale peer reviewed di Pedagogia e Didattica della musica: la promuovono il Dipartimento di Musica e Spettacolo dell’Università di Bologna e l’Associazione culturale «Il Saggiatore musicale / SagGEM».
Transgenic plants with altered senescence characteristics
Amasino, Richard M.; Gan, Susheng; Noh, Yoo-Sun
2002-03-19
The identification of senescence-specific promoters from plants is described. Using information from the first senescence-specific promoter, SAG12 from Arabidopsis, other homologous promoters from another plant have been identified. Such promoters may be used to delay senescence in commercially important plants.
DEFF Research Database (Denmark)
Jacobsen, Kurt
Om den sovjetiske leder Vladimir Iljitj Lenins (1870-1924) opvækst, liv og politiske karriere. Hvordan han ofrer alt på den revolulionære sags alter og hvordan Stalin senere udnyttede Lenins mytiske eftermæle til at sikre sig magten....
Measurement and analysis of active synchrotron mirrors under operating conditions
Sutter, John P.; Alcock, Simon G.; Sawhney, Kawal
2013-05-01
At the Diamond Light Source, in situ slope error measurements using the pencil-beam method have enabled X-ray mirror surfaces to be examined in their beamline environment. A surface corrugation common to several bimorph mirrors and the removal of that corrugation by repolishing were both confirmed using this method. In the same way, mirrors curved in a controlled way with bending actuators and sag compensators could also be optimized. Fits to the elastic bending of ideal beams using the Euler-Bernoulli model have been performed on the slope errors of a mechanically bent mirror in order to distinguish bender curvatures from gravitational distortion and to calculate the compensating force that most reduces the latter effect. A successful improvement of the sag compensation mechanism of a vertically focusing mirror was also achieved, aided by a previously tested method for optimizing the settings of a mirror's actuators using pencil-beam scans.
Measurement and analysis of active synchrotron mirrors under operating conditions
International Nuclear Information System (INIS)
Sutter, John P.; Alcock, Simon G.; Sawhney, Kawal
2013-01-01
At the Diamond Light Source, in situ slope error measurements using the pencil-beam method have enabled X-ray mirror surfaces to be examined in their beamline environment. A surface corrugation common to several bimorph mirrors and the removal of that corrugation by repolishing were both confirmed using this method. In the same way, mirrors curved in a controlled way with bending actuators and sag compensators could also be optimized. Fits to the elastic bending of ideal beams using the Euler–Bernoulli model have been performed on the slope errors of a mechanically bent mirror in order to distinguish bender curvatures from gravitational distortion and to calculate the compensating force that most reduces the latter effect. A successful improvement of the sag compensation mechanism of a vertically focusing mirror was also achieved, aided by a previously tested method for optimizing the settings of a mirror's actuators using pencil-beam scans
A Petunia Homeodomain-Leucine Zipper Protein, PhHD-Zip, Plays an Important Role in Flower Senescence
Chang, Xiaoxiao; Donnelly, Linda; Sun, Daoyang; Rao, Jingping; Reid, Michael S.; Jiang, Cai-Zhong
2014-01-01
Flower senescence is initiated by developmental and environmental signals, and regulated by gene transcription. A homeodomain-leucine zipper transcription factor, PhHD-Zip, is up-regulated during petunia flower senescence. Virus-induced gene silencing of PhHD-Zip extended flower life by 20% both in unpollinated and pollinated flowers. Silencing PhHD-Zip also dramatically reduced ethylene production and the abundance of transcripts of genes involved in ethylene (ACS, ACO), and ABA (NCED) biosynthesis. Abundance of transcripts of senescence-related genes (SAG12, SAG29) was also dramatically reduced in the silenced flowers. Over-expression of PhHD-Zip accelerated petunia flower senescence. Furthermore, PhHD-Zip transcript abundance in petunia flowers was increased by application of hormones (ethylene, ABA) and abiotic stresses (dehydration, NaCl and cold). Our results suggest that PhHD-Zip plays an important role in regulating petunia flower senescence. PMID:24551088
A dulal-functional medium voltage level DVR to limit downstream fault currents
DEFF Research Database (Denmark)
Blaabjerg, Frede; Li, Yun Wei; Vilathgamuwa, D. Mahinda
2007-01-01
on the other parallel feeders connected to PCC. Furthermore, if not controlled properly, the DVR might also contribute to this PCC voltage sag in the process of compensating the missing voltage, thus further worsening the fault situation. To limit the flow of large line currents, and therefore restore the PCC...... situations. Controlling the DVR as a virtual inductor would also ensure zero real power absorption during the DVR compensation and thus minimize the stress in the dc link. Finally, the proposed fault current limiting algorithm has been tested in Matlab/Simulink simulation and experimentally on a medium......The dynamic voltage restorer (DVR) is a modern custom power device used in power distribution networks to protect consumers from sudden sags (and swells) in grid voltage. Implemented at medium voltage level, the DVR can be used to protect a group of medium voltage or low voltage consumers. However...
Modeling and simulation of dynamic voltage restorer in power system
International Nuclear Information System (INIS)
Abdel Aziz, M.A.A.M.
2012-01-01
There are many loads subjected to several Power Quality Problems such as voltage sags/swells, unbalance, harmonics distortion, and short interruption. These loads encompass a wide range of equipment which are very sensitive to voltage disturbances. The Dynamic Voltage Restorer (DVR) has recently been introduced to protect sensitive loads from voltage sags and other voltage disturbances in addition to this, it mitigates current harmonics distortion. It is a series connected power electronic based device. It is considered as one of the most efficient and effective solutions. Its appeal includes smaller size and fast dynamic response to disturbances. This work describes a proposal of the DVR to improve power quality distribution (medium voltage) system. The control of the compensation voltage and harmonics cancellation in the DVR is based on Adaptive Noise Canceling (ANC) technique. Simulation results carried out by PSCAD/EMTDC to investigate the performance of the proposed method.
Kotenev, A. V.; Kotenev, V. I.; Kochetkov, V. V.; Elkin, D. A.
2018-01-01
For the purpose of reactive power control error reduction and decrease of the voltage sags in the electric power system caused by the asynchronous motors started the mathematical model of the load bus was developed. The model was built up of the sub-models of the following elements: a transformer, a transmission line, a synchronous and an asynchronous loads and a capacitor bank load, and represents the automatic reactive power control system taking into account electromagnetic processes of the asynchronous motors started and reactive power changing of the electric power system elements caused by the voltage fluctuation. The active power/time and reactive power/time characteristics based on the recommended procedure of the equivalent electric circuit parameters calculation were obtained. The derived automatic reactive power control system was shown to eliminate the voltage sags in the electric power system caused by the asynchronous motors started.
Chang, Xiaoxiao; Donnelly, Linda; Sun, Daoyang; Rao, Jingping; Reid, Michael S; Jiang, Cai-Zhong
2014-01-01
Flower senescence is initiated by developmental and environmental signals, and regulated by gene transcription. A homeodomain-leucine zipper transcription factor, PhHD-Zip, is up-regulated during petunia flower senescence. Virus-induced gene silencing of PhHD-Zip extended flower life by 20% both in unpollinated and pollinated flowers. Silencing PhHD-Zip also dramatically reduced ethylene production and the abundance of transcripts of genes involved in ethylene (ACS, ACO), and ABA (NCED) biosynthesis. Abundance of transcripts of senescence-related genes (SAG12, SAG29) was also dramatically reduced in the silenced flowers. Over-expression of PhHD-Zip accelerated petunia flower senescence. Furthermore, PhHD-Zip transcript abundance in petunia flowers was increased by application of hormones (ethylene, ABA) and abiotic stresses (dehydration, NaCl and cold). Our results suggest that PhHD-Zip plays an important role in regulating petunia flower senescence.
Directory of Open Access Journals (Sweden)
Xiaoxiao Chang
Full Text Available Flower senescence is initiated by developmental and environmental signals, and regulated by gene transcription. A homeodomain-leucine zipper transcription factor, PhHD-Zip, is up-regulated during petunia flower senescence. Virus-induced gene silencing of PhHD-Zip extended flower life by 20% both in unpollinated and pollinated flowers. Silencing PhHD-Zip also dramatically reduced ethylene production and the abundance of transcripts of genes involved in ethylene (ACS, ACO, and ABA (NCED biosynthesis. Abundance of transcripts of senescence-related genes (SAG12, SAG29 was also dramatically reduced in the silenced flowers. Over-expression of PhHD-Zip accelerated petunia flower senescence. Furthermore, PhHD-Zip transcript abundance in petunia flowers was increased by application of hormones (ethylene, ABA and abiotic stresses (dehydration, NaCl and cold. Our results suggest that PhHD-Zip plays an important role in regulating petunia flower senescence.
A dynamic voltage restorer (DVR) with selective harmonic compensation at medium voltage level
DEFF Research Database (Denmark)
Newman, M.J.; Holmes, D.G.; Nielsen, J.G.
2005-01-01
Dynamic voltage restorers (DVRs) are now becoming more established in industry to reduce the impact of voltage sags to sensitive loads. However, DVRs spend most of their time in standby mode, since voltage sags occur very infrequently, and hence their utilization is low. In principle, it would...... be advantageous if the series-connected inverter of a DVR could also be used to compensate for any steady-state load voltage harmonics, since this would increase the power quality "value-added" benefits to the grid system. However, before this can be done, consideration must be given to the control of steady......-state power through the DVR, the increased losses, and the low modulation depths at which the scheme must operate to achieve acceptable harmonic compensation performance. This paper presents a selective harmonic feedback control strategy that can be easily added to medium-voltage DVR systems to provide...
Directory of Open Access Journals (Sweden)
Ries J Langley
2017-09-01
Full Text Available Staphylococcus aureus is an opportunistic pathogen that produces many virulence factors. Two major families of which are the staphylococcal superantigens (SAgs and the Staphylococcal Superantigen-Like (SSL exoproteins. The former are immunomodulatory toxins that induce a Vβ-specific activation of T cells, while the latter are immune evasion molecules that interfere with a wide range of innate immune defences. The superantigenic properties of Staphylococcal enterotoxin-like X (SElX have recently been established. We now reveal that SElX also possesses functional characteristics of the SSLs. A region of SElX displays high homology to the sialyl-lactosamine (sLacNac-specific binding site present in a sub-family of SSLs. By analysing the interaction of SElX with sLacNac-containing glycans we show that SElX has an equivalent specificity and host cell binding range to the SSLs. Mutation of key amino acids in this conserved region affects the ability of SElX to bind to cells of myeloid origin and significantly reduces its ability to protect S. aureus from destruction in a whole blood killing (WBK assay. Like the SSLs, SElX is up-regulated early during infection and is under the control of the S. aureus exotoxin expression (Sae two component gene regulatory system. Additionally, the structure of SElX in complex with the sLacNac-containing tetrasaccharide sialyl Lewis X (sLeX reveals that SElX is a unique single-domain SAg. In summary, SElX is an 'SSL-like' SAg.
Manne/mange - to sider af samme sag
DEFF Research Database (Denmark)
Jensen, Anette
2009-01-01
At pronominet og adjektivet mange udtales forskelligt i danske dialekter er vist ikke ukendt for de fleste danske dialektologer. Artikelen gør nærmere rede for hvordan lydformerne fordeler sig geografisk på de to hovedformer som er -ng-formen mange og -n-formen manne med varianter, og derefter ser...
Mitigation of voltage sag using DVR under feedback and ...
African Journals Online (AJOL)
The paper deals with Dynamic Voltage Restorer (DVR) that aims at the integration of series active filter with minimum VA handling. The DVR not only regulates the voltage at load end but also acts as series active filter. The scheme of DVR is modeled and simulated with MATLAB/Simulink under feedback and feedforward ...
Effects of PSAG12-IPT gene expression on development and senescence in transgenic Lettuce
McCabe, M.S.; Garratt, L.C.; Schepers, F.; Jordi, W.J.R.M.; Stoopen, G.M.; Davelaar, E.; Rhijn, van J.H.A.; Power, J.B.; Davey, M.R.
2001-01-01
An ipt gene under control of the senescence-specific SAG12 promoter from Arabidopsis (PSAG12-IPT) significantly delayed developmental and postharvest leaf senescence in mature heads of transgenic lettuce (Lactuca sativa L. cv Evola) homozygous for the transgene. Apart from retardation of leaf
2013-09-18
... certain subsistence uses. In addition, we must prescribe regulations that include permissible methods of... the Navy to convene a Scientific Advisory Group (SAG) to analyze different types of monitoring and... following areas: Atlantic Ocean: Southeast Shoal-Grand Banks, Canada; Grand Manan Basin Right Whale...
Usage of Cable Bolts for Gateroad Maintenance in Soft Rocks
Directory of Open Access Journals (Sweden)
Iurii Khalymendyk
2014-01-01
Originality/value: 1. There are no regulations and state standards in regard to cable bolt installation parameters in the mines of Ukraine, consequently the usage of cable bolts for gateroad maintenance required preliminary testing under geological conditions at the Western Donbass mines with soft enclosing rocks. 2. Combining levelling with observations using extensometers allowed for the detection of the rock layers' uniform sagging zone in the roof of the gateroad.
Severe core damage experiments and analysis for CANDU applications
International Nuclear Information System (INIS)
Mathew, P.M.; White, A.J.; Snell, V.G.; Bonechi, M.
2003-01-01
AECL uses the MAAP CANDU code to calculate the progression of a severe core damage accident in a CANDU reactor to support Level 2 Probabilistic Safety Assessment and Severe Accident Management activities. Experimental data are required to ensure that the core damage models used in MAAP CANDU code are adequate. In SMiRT 16, details of single channel experiments were presented to elucidate the mechanisms of core debris formation. This paper presents the progress made in severe core damage experiments since then using single channels in an inert atmosphere and results of the model development work to support the experiments. The core disassembly experiments are conducted with one-fifth scale channels made of Zr-2.5wt%Nb containing twelve simulated fuel bundles in an inert atmosphere. The reference fuel channel geometry consists of a pressure tube/calandria tube composite, with the pressure tube ballooned into circumferential contact with the calandria tube. Experimental results from single channel tests showed the development of time-dependent sag when the reference channel temperature exceeded 850 degC. The test results also showed significant strain localization in the gap at the bundle junctions along the bottom side of the channel, thus suggesting creep to be the main deformation mechanism for debris formation. An ABAQUS finite element model using two-dimensional beam elements with circular cross-section was developed to explain the experimental findings. A comparison of the calculated central sag (at mid-span), the axial displacement at the free end of the channel and the post-test sag profile showed good agreement with the experiments, when strain localization was included in the model, suggesting such a simple modelling approach would be adequate to explain the test findings. The results of the tests are important not only in the context of the validation of the analytical tools and models adopted by AECL for the severe accident analysis of CANDU reactors but
Directory of Open Access Journals (Sweden)
Adilson Ben da Costa
2010-01-01
Full Text Available O objetivo principal deste estudo foi avaliar a qualidade das águas subterrâneas em áreas de preservação permanente (SistemaAqüífero Guarani – SAG da Bacia Hidrográfica do Rio Pardo, RS, Brasil, através de variáveis físicas, químicas emicrobiológicas, tendo como base a resolução nº 396 do Conselho Nacional do Meio Ambiente – CONAMA. Nove pontos decoleta foram distribuídos ao longo da bacia, nos quais as águas subterrâneas foram classificadas quanto aos íons de maiorocorrência quantitativa através do diagrama de Piper. Os resultados indicaram que a maioria dos poços avaliados enquadraram-sena Classe 4 de usos da água, correspondendo a águas de usos menos restritivos. Entretanto, deve-se considerar que os aquíferos seapresentam em diferentes contextos geológicos, e que possuem características físicas, químicas e biológicas intrínsecas, comvariações hidrogeoquímicas, sendo necessário que as suas classes de qualidade sejam pautadas nessas especificidades, como seobservou no diagrama de Piper, onde as amostras P1, P2, P3, P5 e P9 classificaram-se como bicarbonatadas cálcicas, as águas dospontos P4, P6, P7 como bicarbonatadas sódicas e P8 se classificou como sulfatada. Verificou-se que a qualidade das águas depoços com profundidade inferior a 6 m está mais vulnerável devido a alterações antrópicas em função da concentração de nitrato,coliformes totais e termotolerantes, enquanto que a qualidade das águas de poços mais profundos depende basicamente de suascaracterísticas hidrogeológicas e hidrogeoquímicas naturais, em função das variáveis sulfato e sódio. Contudo, tambémapresentaram contaminação por atividade antrópica, principalmente pela variável nitrato.Abstract The aim of this research was to evaluate thequality of groundwater in areas of permanent preservation(Guarani Aquifer System – GAS in the Rio PardoHydrographical Basin, RS, Brazil, using physical, chemicaland
Ngugi, David
2014-08-08
The bottom of the Red Sea harbors over 25 deep hypersaline anoxic basins that are geochemically distinct and characterized by vertical gradients of extreme physicochemical conditions. Because of strong changes in density, particulate and microbial debris get entrapped in the brine-seawater interface (BSI), resulting in increased dissolved organic carbon, reduced dissolved oxygen toward the brines and enhanced microbial activities in the BSI. These features coupled with the deep-sea prevalence of ammonia-oxidizing archaea (AOA) in the global ocean make the BSI a suitable environment for studying the osmotic adaptations and ecology of these important players in the marine nitrogen cycle. Using phylogenomic-based approaches, we show that the local archaeal community of five different BSI habitats (with up to 18.2% salinity) is composed mostly of a single, highly abundant Nitrosopumilus-like phylotype that is phylogenetically distinct from the bathypelagic thaumarchaea; ammonia-oxidizing bacteria were absent. The composite genome of this novel Nitrosopumilus-like subpopulation (RSA3) co-assembled from multiple single-cell amplified genomes (SAGs) from one such BSI habitat further revealed that it shares ∼54% of its predicted genomic inventory with sequenced Nitrosopumilus species. RSA3 also carries several, albeit variable gene sets that further illuminate the phylogenetic diversity and metabolic plasticity of this genus. Specifically, it encodes for a putative proline-glutamate \\'switch\\' with a potential role in osmotolerance and indirect impact on carbon and energy flows. Metagenomic fragment recruitment analyses against the composite RSA3 genome, Nitrosopumilus maritimus, and SAGs of mesopelagic thaumarchaea also reiterate the divergence of the BSI genotypes from other AOA.
Ngugi, David; Blom, Jochen; Alam, Intikhab; Rashid, Mamoon; Ba Alawi, Wail; Zhang, Guishan; Hikmawan, Tyas I.; Guan, Yue; Antunes, Andre; Siam, Rania; El-Dorry, Hamza A A; Bajic, Vladimir B.; Stingl, Ulrich
2014-01-01
The bottom of the Red Sea harbors over 25 deep hypersaline anoxic basins that are geochemically distinct and characterized by vertical gradients of extreme physicochemical conditions. Because of strong changes in density, particulate and microbial debris get entrapped in the brine-seawater interface (BSI), resulting in increased dissolved organic carbon, reduced dissolved oxygen toward the brines and enhanced microbial activities in the BSI. These features coupled with the deep-sea prevalence of ammonia-oxidizing archaea (AOA) in the global ocean make the BSI a suitable environment for studying the osmotic adaptations and ecology of these important players in the marine nitrogen cycle. Using phylogenomic-based approaches, we show that the local archaeal community of five different BSI habitats (with up to 18.2% salinity) is composed mostly of a single, highly abundant Nitrosopumilus-like phylotype that is phylogenetically distinct from the bathypelagic thaumarchaea; ammonia-oxidizing bacteria were absent. The composite genome of this novel Nitrosopumilus-like subpopulation (RSA3) co-assembled from multiple single-cell amplified genomes (SAGs) from one such BSI habitat further revealed that it shares ∼54% of its predicted genomic inventory with sequenced Nitrosopumilus species. RSA3 also carries several, albeit variable gene sets that further illuminate the phylogenetic diversity and metabolic plasticity of this genus. Specifically, it encodes for a putative proline-glutamate 'switch' with a potential role in osmotolerance and indirect impact on carbon and energy flows. Metagenomic fragment recruitment analyses against the composite RSA3 genome, Nitrosopumilus maritimus, and SAGs of mesopelagic thaumarchaea also reiterate the divergence of the BSI genotypes from other AOA.
Kamanda Ngugi, David; Blom, Jochen; Alam, Intikhab; Rashid, Mamoon; Ba-Alawi, Wail; Zhang, Guishan; Hikmawan, Tyas; Guan, Yue; Antunes, Andre; Siam, Rania; El Dorry, Hamza; Bajic, Vladimir; Stingl, Ulrich
2015-02-01
The bottom of the Red Sea harbors over 25 deep hypersaline anoxic basins that are geochemically distinct and characterized by vertical gradients of extreme physicochemical conditions. Because of strong changes in density, particulate and microbial debris get entrapped in the brine-seawater interface (BSI), resulting in increased dissolved organic carbon, reduced dissolved oxygen toward the brines and enhanced microbial activities in the BSI. These features coupled with the deep-sea prevalence of ammonia-oxidizing archaea (AOA) in the global ocean make the BSI a suitable environment for studying the osmotic adaptations and ecology of these important players in the marine nitrogen cycle. Using phylogenomic-based approaches, we show that the local archaeal community of five different BSI habitats (with up to 18.2% salinity) is composed mostly of a single, highly abundant Nitrosopumilus-like phylotype that is phylogenetically distinct from the bathypelagic thaumarchaea; ammonia-oxidizing bacteria were absent. The composite genome of this novel Nitrosopumilus-like subpopulation (RSA3) co-assembled from multiple single-cell amplified genomes (SAGs) from one such BSI habitat further revealed that it shares ∼54% of its predicted genomic inventory with sequenced Nitrosopumilus species. RSA3 also carries several, albeit variable gene sets that further illuminate the phylogenetic diversity and metabolic plasticity of this genus. Specifically, it encodes for a putative proline-glutamate 'switch' with a potential role in osmotolerance and indirect impact on carbon and energy flows. Metagenomic fragment recruitment analyses against the composite RSA3 genome, Nitrosopumilus maritimus, and SAGs of mesopelagic thaumarchaea also reiterate the divergence of the BSI genotypes from other AOA.
Application of Microtremor Array Analysis to Estimate the Bedrock Depth in the Beijing Plain area
Xu, P.; Ling, S.; Liu, J.; Su, W.
2013-12-01
records using the SPAC method, and (2) inversion to establish the S-wave velocity structure. Our inversion results show a thick Cenozoic sedimentation in the Fengtai Sag. The bedrock depth is 1510 m at C04-1 and 1575 m at D04-1. In contrast, the Cenozoic sediments are only 193 m thick at E12-1 and 236 m thick at E12-3, indicating very thin Cenozoic sedimentation in the Laiguangying High structural unit. The bedrock at the Houshayu Sag with a depth of 691 m at E16-1 and 875 m at F16-1, respectively, seems to fall somewhere in the middle. The difference between the bedrock depth at the Fengtai Sag and that at the Laiguangying High is as high as 1300 m. This was interpreted as a resulting of a slip along the Taiyanggong fault. On the other hand, the Nankou-Sunhe faulting resulted in a bedrock depth difference of approximately 500 m between the Laiguangying High and Houshayu Sag to the northeast. These results of the bedrock surface depth and its difference in various tectonic units in the Beijing plain area outlined by this article are consistent with both the existing geological data and previous interpretations. The information is deemed very useful for understanding the geological structures, regional tectonics and practical geotechnical problems involved in civil geological engineering in and around Beijing City.
International Nuclear Information System (INIS)
Uz-Zaman, Taher; Ignatowicz, Leszek; Sarkar, Nurul H.
2003-01-01
The mouse mammary tumor viruses (MMTVs) that induce mammary adenocarcinomas in mice are transmitted from mother to offspring through milk. MMTV infection results in the deletion of specific T cells as a consequence of interaction between the MMTV-encoded superantigen (Sag) and specific Vβ chains of the T cell receptor. The specificity and kinetics of T cell deletion for a number of highly oncogenic MMTVs, such as C3H- and GR-MMTVs, have been studied in great detail. Some work has also been done with the MMTVs expressed in two substrains of RIII mice, BR6 and RIIIS/J, but the nature of the interaction between T cells and the virus(es) that the parental RIII-strain of mice express has not been investigated. Since RIII mice (designated henceforth as RIII/Sa) have a very high incidence (90-98%) of mammary tumors, and they have been extensively used in studies of the biology of mammary tumor development, we have presently determined the pattern of Vβ-T cell deletion caused by RIII/Sa-MMTV-Sag(s) during viral infection. T cells were isolated from lymph nodes and thymus of young RIII/Sa mice, as well as from BALB/c (BALB/cfRIII/Sa), C57BL (C57BLfRIII/Sa), and RIIIS/J (RIIIS/JfRIII/Sa) mice after they were infected with RIII/Sa-MMTV(s) by foster nursing. The composition of the T cells was analyzed by FACS using a panel of monoclonal antibodies specific to a variety of Vβs. Our results show that milk-borne RIII/Sa-MMTV(s) infection leads to the deletion of CD4 + Vβ-2, and to a lesser extent Vβ-8 bearing peripheral and central T cells in RIII/Sa, RIIIS/J, BALB/c, and C57BL mice. Our results are in contrast to the findings that C3H-, GR-, and BR6-MMTVs delete Vβ-14- and/or Vβ-15-specific T cells
Benussi, L.; Bertani, M.; Bianco, S.; Fabbri, F. L.; Gianotti, P.; Giardoni, M.; Ghezzo, A.; Guaraldo, C.; Lanaro, A.; Locchi, P.; Lu, J.; Lucherini, V.; Mecozzi, A.; Pace, E.; Passamonti, L.; Qaisar, N.; Ricciardi, A.; Sarwar, S.; Serdyouk, V.; Trasatti, L.; Volkov, A.; Zia, A.
1998-12-01
An array of 2424 2.6 m-long, 15 mm-diameter mylar straw tubes, arranged in two axial and four stereo layers, has been assembled. The array covers a cylindrical tracking surface of 18 m 2 and provides coordinate measurement in the drift direction and along the wire. A correction of the systematic effects which are introduced by gravitational sag and electrostatics, thus dominating the detector performance especially with long straws, allows to determine wire position from drift-time distribution. The correction has been applied to reach a space resolution of 40 μm with DME, 100 μm with Ar+C 2H 6, and 100-200 μm with CO 2. Such a resolution is the best ever obtained for straws of these dimensions. A study of the gas leakage for the straw system has been performed, and results are reported. The array is being commissioned as a subdetector of the FINUDA spectrometer, and tracking performances are being studied with cosmic rays.
International Nuclear Information System (INIS)
Benussi, L.; Bertani, M.; Bianco, S.; Fabbri, F.L.; Gianotti, P.; Giardoni, M.; Ghezzo, A.; Guaraldo, C.; Lanaro, A.; Locchi, P.; Lu, J.; Lucherini, V.; Mecozzi, A.; Pace, E.; Passamonti, L.; Qaisar, N.; Ricciardi, A.; Sarwar, S.; Serdyouk, V.; Trasatti, L.; Volkov, A.; Zia, A.
1998-01-01
An array of 2424 2.6 m-long, 15 mm-diameter mylar straw tubes, arranged in two axial and four stereo layers, has been assembled. The array covers a cylindrical tracking surface of 18 m 2 and provides coordinate measurement in the drift direction and along the wire. An under-standing of the systematic effects which are introduced by gravitational sag and electrostatics, thus dominating the detector performance especially with long straws, allows to determine wire position from drift-time distribution. The correction has been applied to reach a space resolution of 40 μm with DME, 100 μm with Ar + C 2 H 6 , and 100-200 μm with CO 2 . Such a resolution is the best ever obtained for straws of these dimensions. A study of the gas leakage for the straw system has been performed, and results are reported. The array is being commissioned as a subdetector of the FINUDA spectrometer, and tracking performances are being studied with cosmic rays. (author)
7 CFR 319.37-5 - Special foreign inspection and certification requirements.
2010-01-01
... collected from the wild; and articles solely for food, analytical, or manufacturing purposes) from a country..., China, Colombia, Croatia, Ecuador, Iceland, Japan, Korea, Liechtenstein, Macedonia, Malaysia, Mexico... were grown have been sampled by SAG once per growing season at a rate to detect 1 percent contamination...
A flexible low-voltage ride-through operation for the distributed generation converters
DEFF Research Database (Denmark)
Chen, Hsin-Chih; Lee, Chia-Tse; Cheng, Po-Tai
2013-01-01
With more and more distributed energy resources (DERs) are installed in the utility grid, the utility requires the DER generation system to remain grid-connected and injects reactive and active power to support grid voltage during voltage sags. In this paper, a positive- and negative-sequence cur...
7 CFR 1755.902 - Minimum performance Specification for fiber optic cables.
2010-01-01
... installation provided by the end user, the manufacturer must provide a cable design with sag and tension tables... cables. 1755.902 Section 1755.902 Agriculture Regulations of the Department of Agriculture (Continued... optic cables. (a) Scope. This section is intended for cable manufacturers, Agency borrowers, and...
Baker, John; Wargo, Michael J.; Beaty, David
2013-01-01
The Mars Program Planning Group (MPPG) was an agency wide effort, chartered in March 2012 by the NASA Associate Administrator for Science, in collaboration with NASA's Associate Administrator for Human Exploration and Operations, the Chief Scientist, and the Chief Technologist. NASA tasked the MPPG to develop foundations for a program-level architecture for robotic exploration of Mars that is consistent with the President's challenge of sending humans to the Mars system in the decade of the 2030s and responsive to the primary scientific goals of the 2011 NRC Decadal Survey for Planetary Science. The Mars Exploration Program Analysis Group (MEPAG) also sponsored a Precursor measurement Strategy Analysis Group (P-SAG) to revisit prior assessments of required precursor measurements for the human exploration of Mars. This paper will discuss the key results of the MPPG and P-SAG efforts to update and refine our understanding of the Strategic Knowledge Gaps (SKGs) required to successfully conduct human Mars missions.
Directory of Open Access Journals (Sweden)
Margo P
2009-11-01
Full Text Available Dynamic Voltage Restorer (DVR is a power electronics device to protect sensitive load when voltage sag occurs. Commonly, sensitive loads are electronic-based devices which generate harmonics. The magnitude and phase of compensated voltage in DVR depend on grounding system and type of fault. If the system is floating, the zero sequence components do not appear on the load side. Meanwhile, in a neutral grounded system, voltage sag is extremely affected by zero sequence components. A blocking transformer is commonly installed in series with DVR to reduce the effect of zero sequence components. This paper proposes a new DVR control scheme that is capable of eliminating the blocking transformer and reducing harmonic distortion. The system uses fuzzy polar controller to replace the conventional PI or FL controller that is commonly used. By taking into account the zero sequence components in the controller design, the effects of zero sequence components can be compensated. Simulated results show the effectiveness of the proposed DVR controller
Saroj, Sunil D; Holmer, Linda; Berengueras, Júlia M; Jonsson, Ann-Beth
2017-03-17
Streptococcus pyogenes an adapted human pathogen asymptomatically colonizes the nasopharynx, among other polymicrobial communities. However, information on the events leading to the colonization and expression of virulence markers subject to interspecies and host-bacteria interactions are limited. The interference of acyl homoserine lactones (AHLs) with the hemolytic activity and viability of S. pyogenes M6 S165 was examined. AHLs, with fatty acid side chains ≥12 carbon atoms, inhibited hemolytic activity by downregulating the expression of the sag operon involved in the production of streptolysin S. Inhibitory AHLs upregulated the expression of transcriptional regulator LuxR. Electrophoretic mobility shift assays revealed the interaction of LuxR with the region upstream of sagA. AHL-mediated bactericidal activity observed at higher concentrations (mM range) was an energy-dependent process, constrained by the requirement of glucose and iron. Ferrichrome transporter FtsABCD facilitated transport of AHLs across the streptococcal membrane. The study demonstrates a previously unreported role for AHLs in S. pyogenes virulence.
Reversible Holmes' tremor due to spontaneous intracranial hypotension.
Iyer, Rajesh Shankar; Wattamwar, Pandurang; Thomas, Bejoy
2017-07-27
Holmes' tremor is a low-frequency hand tremor and has varying amplitude at different phases of motion. It is usually unilateral and does not respond satisfactorily to drugs and thus considered irreversible. Structural lesions in the thalamus and brainstem or cerebellum are usually responsible for Holmes' tremor. We present a 23-year-old woman who presented with unilateral Holmes' tremor. She also had hypersomnolence and headache in the sitting posture. Her brain imaging showed brain sagging and deep brain swelling due to spontaneous intracranial hypotension (SIH). She was managed conservatively and had a total clinical and radiological recovery. The brain sagging with the consequent distortion of the midbrain and diencephalon was responsible for this clinical presentation. SIH may be considered as one of the reversible causes of Holmes' tremor. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Ayadi, A.; Lacrampe, M.-F.; Krawczak, P.
2018-05-01
This paper focuses on the potential use of stereo-DIC in thermoforming conditions to monitor large deformations of softened thermoplastic sheets posteriori to the sagging phenomenon. The study concerns HIPS sheets which are softened by the radiative heat-transfer mode then stretched by inflation of compressed-air for 1.5 s to form a large and quasi-spherical dome of 250 mm in diameter. While the bubble-inflation operation leads to large deformations of the softened sheet, it shows transitional geometrical instabilities due to the initial surface sagging. When the temperature-induced surface deformations are inaccessible by the stereoscopic system during the heating operation, the geometrical instabilities limit the identification of the reference of displacements which affects the accuracy of results based on image-correlation computations. To compare between the principal strains assessed from bubble-inflation tests conducted at different thermal conditions, a method for filtering these instabilities is developed in this study.
Economic consequences of post-kala-azar dermal leishmaniasis in a rural Bangladeshi community.
Ozaki, Masayo; Islam, Shamim; Rahman, Kazi Mizanur; Rahman, Anisur; Luby, Stephen P; Bern, Caryn
2011-09-01
Post-kala-azar dermal leishmaniasis (PKDL) is a complication of visceral leishmaniasis. Bangladesh national treatment guidelines during the study period called for 120 intramuscular injections of sodium antimony gluconate (SAG). We assessed care-seeking behavior, diagnosis and treatment costs, and coping strategies among 134 PKDL patients; 56 (42%) patients had been treated with SAG, and 78 (58%) remained untreated. The median direct cost per patient treated was US$367 (interquartile range [IQR] = 90-284), more than two times the estimated per capita annual income for the study population. The most common coping strategy was to take a loan; the median amount borrowed was US$98 (IQR = 71-150), with a median interest of US$32 (IQR = 16-95). Households lost a median of 123 work-days per patient treated. The current regimen for PKDL imposes a significant financial burden, reinforcing the link between poverty and visceral leishmaniasis. More practical shorter-course regimens for PKDL are urgently needed to achieve national and regional visceral leishmaniasis elimination goals.
Energy efficiency criteria in uninterruptible power supply selection
International Nuclear Information System (INIS)
Moreno-Munoz, A.; Rosa, Juan Jose Gonzalez de la; Flores-Arias, J.M.; Bellido-Outerino, F.J.; Gil-de-Castro, A.
2011-01-01
With the generalized use of microelectronic devices, server computers and other susceptible equipment, the subject related to power quality (PQ) and its relationship to vulnerability of high performance plants are becoming an increasing concern to the industry. This paper addresses how uninterruptible power supply (UPS), particularly when configured in distributed DC mode, can become an energy efficient (EE) solution in high-tech buildings, especially when integrated with complimentary PQ measures. The paper is based on PQ audits conducted at different high-tech industries over the last years. It was found that the main problems for the equipment installed were voltage sags (or dips). Among all categories of electrical disturbances, voltage sags and momentary interruptions are the nemeses of the automated industrial process. The paper analyzes the capabilities of modern electronic power supplies and the convenience of embedded solution. Finally it is addresses the role of the Standards on the protection of electronic equipment and the implications for the final costumer.
Directory of Open Access Journals (Sweden)
Zineb Lakhrif
2018-02-01
Full Text Available Toxoplasmosis is a major public health problem and the development of a human vaccine is of high priority. Efficient vaccination against Toxoplasma gondii requires both a mucosal and systemic Th1 immune response. Moreover, dendritic cells play a critical role in orchestrating the innate immune functions and driving specific adaptive immunity to T. gondii. In this study, we explore an original vaccination strategy that combines administration via mucosal and systemic routes of fusion proteins able to target the major T. gondii surface antigen SAG1 to DCs using an antibody fragment single-chain fragment variable (scFv directed against DEC205 endocytic receptor. Our results show that SAG1 targeting to DCs by scFv via intranasal and subcutaneous administration improved protection against chronic T. gondii infection. A marked reduction in brain parasite burden is observed when compared with the intranasal or the subcutaneous route alone. DC targeting improved both local and systemic humoral and cellular immune responses and potentiated more specifically the Th1 response profile by more efficient production of IFN-γ, interleukin-2, IgG2a, and nasal IgA. This study provides evidence of the potential of DC targeting for the development of new vaccines against a range of Apicomplexa parasites.
Tulip-form variable-curvature mirrors: interferometry and field compensation
Lemaitre, Gerard R.; Mazzanti, Silvio; Ferrari, Marc
1998-07-01
Active Optics methods are now capable to provide variable curvature mirrors (VCMs) having controlled sags in the focal range from f/(infinity) to f/2.5. Those development have been carried out by the authors for the optical path equalizer dedicated to each Mersenne focus of the VLTI. The basic principle is to use VCMs as cat's eye mirrors in each delay line in order to achieve field compensations at the recombined Mersenne focii. During the VLTI development phase, cycloid form VCMs controlled by air pressure have been performed with a 10(superscript -4) mirror sag resolution. The cycloid form has been selected for the VLTi delay lines. However, other analytical solutions from circular plates elasticity theory have been found. Two thickness distributions lead to tulip form VCMs controlled by a central force. One of them, using a lineic reaction at the edge is the object of this paper. Active optics design, construction features, test and experimental He-Ne interferograms obtained with 16mm boundary aperture and 10mm clear aperture are presented. The mean aspect-ratio of the tulip from VCM is d/t(subscript 0.5) approximately equals 60, providing a focal zoom range from f/(infinity) to f/2.5. The experiment is carried out form f/(infinity) to f/5.
Directory of Open Access Journals (Sweden)
Marilyn Hernández-Medina
2008-09-01
Full Text Available Se realizó la evaluación de las propiedades fisicoquímicas y funcionales de almidones de tubérculos: makal (Xanthosoma yucatanensis, camote (Ipomea batata, yuca (Manihot esculenta Crantz y sagú (Marantha arundinacea. El tamaño promedio de los gránulos de almidón varió de 10,6 a 16,5 µm. La amilosa fue de 23,6, 19,6, 17,0 y 22,7%, para el makal, camote, yuca y sagú. Las temperaturas de gelatinización fueron de 78,4, 61,3, 65,2 y 74,9 °C, respectivamente. El almidón de yuca fue el que presentó mayor poder de hinchamiento y solubilidad. La viscosidad máxima fue para el almidón de yuca. El almidón de camote presentó la mayor claridad de gel (51,8% y el de makal, la menor (10,9%. El almidón de yuca fue el más elástico (36,2%. Los almidones de makal y de sagú pueden ser utilizados en productos que requieren altas temperaturas de procesamiento. Los almidones de camote y de yuca pueden ser incluidos en sistemas alimenticios como espesantes, estabilizantes y gelificantes en alimentos refrigerados y congelados.Foram avaliadas as propriedades físico-químicas e funcionais de amidos dos seguintes tubérculos: makal (Xanthosoma yucatanensis, batata-doce (Ipomea batata, mandioca (Manihot esculenta Crantz e araruta (Marantha arundinacea. O tamanho médio dos grânulos de amido variou de 10,6 a 16,5 µm. A amilose foi de 23,6, 19,6, 17,0 e 22,7%, para makal, batata-doce, mandioca e araruta. As temperaturas de gelatinização foram de 78,4, 61,3, 65,2 e 74,9 °C, respectivamente. O amido de mandioca foi o que apresentou maior poder de inchamento e solubilidade. A viscosidade máxima foi para o amido de mandioca. O amido de batata-doce apresentou a maior claridade de gel (51,8% e o amido de makal, a menor (10,9%. O amido de mandioca foi o mais elástico (36,2%. Os amidos de makal e de araruta podem ser utilizados em produtos que requerem altas temperaturas de processamento. Os amidos de batata-doce e de mandioca podem ser incluídos em
Paleoseismic record obtained by coring a sag-pond along the North Anatolian Fault (Turkey
Directory of Open Access Journals (Sweden)
Aurelia Hubert-Ferrari
2013-01-01
Full Text Available Shallow lakes along minor structural bends or discontinuities of strike-slip faults are not usually paleoseismological target sites. In the present study, we show that a 2-m-deep, 700-m-long lake that is cross-cut by the North Anatolian Fault contains a reliable paleoseimological record that can be obtained through coring. The North Anatolian Fault is a major strike-slip fault in Turkey, and it last ruptured across the Aşağıtepecik Lake in 1939, with a slip of about 6 m. Seismic lines still show remains of the fault rupture in the form of minor scarps across the lake. Collected short cores show a set of sedimentary sequences. Each sequence is composed of similar organic-rich sedimentary units. The lower unit is dark and fibrous, and is similar to the present sedimentation at the top of the core. The upper unit is disturbed and has anomalous organic matter content, grain size and mineralogy. It is interpreted as an earthquake-induced sedimentary event. The 2.5-m-long AT2007LG core comprises four sequences, and four sedimentary events. Radiogenic 210Pb and 137Cs data obtained previously imply that the shallowest event 1 was triggered by the 1939 M = 7.9 Erzincan earthquake. Radiocarbon dating and correlation to a reference varved record suggest that events 2 and 4 were initiated by the 1668 and 1254 historical earthquakes. Event 3 does not correspond to a large historical earthquake on the North Anatolian Fault.
Status and Performance Updates for the Cosmic Origins Spectrograph
Snyder, Elaine M.; De Rosa, Gisella; Fischer, William J.; Fix, Mees; Fox, Andrew; Indriolo, Nick; James, Bethan; Oliveira, Cristina M.; Penton, Steven V.; Plesha, Rachel; Rafelski, Marc; Roman-Duval, Julia; Sahnow, David J.; Sankrit, Ravi; Taylor, Joanna M.; White, James
2018-01-01
The Hubble Space Telescope's Cosmic Origins Spectrograph (COS) moved the spectra on the FUV detector from Lifetime Position 3 (LP3) to a new pristine location, LP4, in October 2017. The spectra were shifted in the cross-dispersion direction by -2.5" (roughly -31 pixels) from LP3, or -5" (roughly -62 pixels) from the original LP1. This move mitigates the adverse effects of gain sag on the spectral quality and accuracy of COS FUV observations. Here, we present updates regarding the calibration of FUV data at LP4, including the flat fields, flux calibrations, and spectral resolution. We also present updates on the time-dependent sensitivities and dark rates of both the NUV and FUV detectors.
Energy Technology Data Exchange (ETDEWEB)
Hildmann, Christian
2016-12-09
In Germany and in Europe it is due to the ''Energiewende'' necessary to transmit more electrical energy with existing overhead transmission lines. One possible technical solution to reach this aim is the use of high temperature low sag conductors (HTLS-conductors). Compared to the common Aluminium Conductor Steel Reinforced (ACSR), HTLS-conductors have higher rated currents and rated temperatures. Thus the electrical connections for HTLS-conductors are stressed to higher temperatures too. These components are most important for the safe and reliable operation of an overhead transmission line. Besides other connection technologies, hexagonal compression connections with ordinary transmission line conductors have proven themselves since decades. From the literature, mostly empirical studies with electrical tests for compression connections are known. The electrical contact behaviour, i.e. the quality of the electrical contact after assembly, of these connections has been investigated insufficiently. This work presents and enhances an electrical model of compression connections, so that the electrical contact behaviour can be determined more accurate. Based on this, principal considerations on the current distribution in the compression connection and its influence on the connection resistance are presented. As a result from the theoretical and the experimental work, recommendations for the design of hexagonal compression connections for transmission line conductors were developed. Furthermore it is known from the functional principle of compression type connections, that the electrical contact behaviour can be influenced from their form fit, force fit and cold welding. In particular the forces in compression connections have been calculated up to now by approximation. The known analytical calculations simplify the geometry and material behaviour and do not consider the correct mechanical load during assembly. For these reasons the joining process
Pringsheim's living legacy: CCALA, CCAP, SAG and UTEX culture collections of algae
Czech Academy of Sciences Publication Activity Database
Day, J. G.; Lukavský, Jaromír; Friedl, T.; Brand, J. J.; Campbell, CH. N.; Lorenz, M.; Elster, Josef
2004-01-01
Roč. 79, 1-2 (2004), s. 27-37 ISSN 0029-5035 R&D Projects: GA AV ČR KSK6005114 Keywords : cyanobacteria * algae * Pringsheim * algal collections Subject RIV: EF - Botanics Impact factor: 0.594, year: 2004
Electrically conductive polymer concrete coatings
Fontana, Jack J.; Elling, David; Reams, Walter
1990-01-01
A sprayable electrically conductive polymer concrete coating for vertical d overhead applications is described. The coating is permeable yet has low electrical resistivity (<10 ohm-cm), good bond strength to concrete substrates, and good weatherability. A preferred formulation contains about 60 wt % calcined coke breeze, 40 wt % vinyl ester with 3.5 wt % modified bentonite clay. Such formulations apply evenly and provide enough rigidity for vertical or overhead structures so there is no drip or sag.
2015-03-01
142+00 to 144+00. These areas are located approximately 1,000 feet south of Rosa Parks Way and the photos show sags and sinkholes on the landside...sloughing and slides, lost sod, displaced riprap, and sinkhole development to portions of the right and left descending banks of Salt Creek. 1.4 AUTHORITY... sinkhole development. The proposed project repairs include reshaping the levee banks back to a 3:1 slope and replacing lost bank material with compacted
International Nuclear Information System (INIS)
Ignatowicz, S.
1990-01-01
A 40 or 60 krad dose of gamma radiation reduce slightly sexual activity of the males but male activity is greatly reduced as the radiation dose increases from 60 to 120 krad. Females of the mold mite, Tyrophagus, putrescentiae (Schrank), molested by males present at a 3:1 or 5:1 ratio live shorter than females kept with one male. The SAG test can be applied to compare sexual activity of males treated with different dosage of gamma irradiation
Review: Gp-340/DMBT1 in mucosal innate immunity
DEFF Research Database (Denmark)
Madsen, Jens; Mollenhauer, Jan; Holmskov, Uffe
2010-01-01
) is secreted into broncho-alveolar surface lining fluid whereas DMBT(SAG) is present in the saliva. The two molecules were shown to be identical and both interact with and agglutinate several Gram-negative and Gram-positive bacteria including Streptococcus mutans, a bacterium responsible for caries in the oral...
Thread-Lift Sutures : Still in the Lift? A Systematic Review of the Literature
Gulbitti, Haydar Aslan; Colebunders, Britt; Pirayesh, Ali; Bertossi, Dario; van der Lei, Berend
Background: In 2006, Villa et al. published a review article concerning the use of thread-lift sutures and concluded that the technique was still in its infancy but had great potential to become a useful and effective procedure for nonsurgical lifting of sagged facial tissues. As 11 years have
Thread-Lift Sutures : Still in the Lift? A Systematic Review of the Literature
Gülbitti, Haydar Aslan; Colebunders, Britt; Pirayesh, Ali; Bertossi, Dario; van der Lei, Berend
2018-01-01
BACKGROUND: In 2006, Villa et al. published a review article concerning the use of thread-lift sutures and concluded that the technique was still in its infancy but had great potential to become a useful and effective procedure for nonsurgical lifting of sagged facial tissues. As 11 years have
Investigating Navy Officer Retention Using Data Farming
2015-09-01
runs on Microsoft Access . Contractors from SAG Corporation translated the code into Visual Basic for Applications ( VBA ), bringing several benefits...18 b. Accessions ............................................................. 18 c. Promotions...Strategic Actions Group SEED Simulation Experiments & Efficient Design URL Unrestricted Line VBA Visual Basic for Applications VV&A Verification
DEFF Research Database (Denmark)
Semenova, Elizaveta; Kulkova, Irina; Kadkhodazadeh, Shima
2014-01-01
. In order to extract the QD benefits for the longer telecommunication wavelength range the technology of QD fabrication should be developed for InP based materials. In our work, we take advantage of both QD fabrication methods Stranski-Krastanow (SK) and selective area growth (SAG) employing block copolymer...
Numerical analysis using state space method for vibration control of ...
African Journals Online (AJOL)
ATHARVA
carried out for two cases namely car moving on sagged bridges and car ... the vibrations of steel moment resisting frame in reinforced cement concrete buildings. ... active or semi-active dampers rolled into one (Spencer Jr. and Soong, 1999). ... implementation cost, low power consumption, ease of control, simple design ...
Triana, Benjamin
2016-01-01
This ethnography documents how the message of sustainability was interpreted and communicated through a sustainable agricultural (SAG) program at an American higher education institution. The ethnography documents the evolution of the program as the program tackled obstacles and accomplished its goals during the initial phases of the program's…
The structural and functional role of myelin fast-migrating cerebrosides
DEFF Research Database (Denmark)
Podbielska, Maria; Levery, Steven B; Hogan, Edward L
2011-01-01
A family of neutral glycosphingolipids containing a 3-O-acetyl-sphingosine galactosylceramide (3-SAG) has been characterized. Seven new derivatives of galactosylceramide (GalCer), designated as fast-migrating cerebrosides (FMCs) by TLC retention factor, have been identified. The simplest compounds...... myelin lipid biomarkers coappear with GalCer during myelinogenesis and disappear along with GalCer in de- or dys-myelinating disorders. Myelin lipid antigens, including FMCs, are keys to myelin biology, opening the possibility of new and novel immune modulatory tools for treatment of autoimmune diseases...
SU-E-T-20: A Correlation Study of 2D and 3D Gamma Passing Rates for Prostate IMRT Plans
International Nuclear Information System (INIS)
Zhang, D; Wang, B; Ma, C; Deng, X
2015-01-01
Purpose: To investigate the correlation between the two-dimensional gamma passing rate (2D %GP) and three-dimensional gamma passing rate (3D %GP) in prostate IMRT quality assurance. Methods: Eleven prostate IMRT plans were randomly selected from the clinical database and were used to obtain dose distributions in the phantom and patient. Three types of delivery errors (MLC bank sag errors, central MLC errors and monitor unit errors) were intentionally introduced to modify the clinical plans through an in-house Matlab program. This resulted in 187 modified plans. The 2D %GP and 3D %GP were analyzed using different dose-difference and distance-toagreement (1%-1mm, 2%-2mm and 3%-3mm) and 20% dose threshold. The 2D %GP and 3D %GP were then compared not only for the whole region, but also for the PTVs and critical structures using the statistical Pearson’s correlation coefficient (γ). Results: For different delivery errors, the average comparison of 2D %GP and 3D %GP showed different conclusions. The statistical correlation coefficients between 2D %GP and 3D %GP for the whole dose distribution showed that except for 3%/3mm criterion, 2D %GP and 3D %GP of 1%/1mm criterion and 2%/2mm criterion had strong correlations (Pearson’s γ value >0.8). Compared with the whole region, the correlations of 2D %GP and 3D %GP for PTV were better (the γ value for 1%/1mm, 2%/2mm and 3%/3mm criterion was 0.959, 0.931 and 0.855, respectively). However for the rectum, there was no correlation between 2D %GP and 3D %GP. Conclusion: For prostate IMRT, the correlation between 2D %GP and 3D %GP for the PTV is better than that for normal structures. The lower dose-difference and DTA criterion shows less difference between 2D %GP and 3D %GP. Other factors such as the dosimeter characteristics and TPS algorithm bias may also influence the correlation between 2D %GP and 3D %GP
Transformer inrush current reduction through sequential energization for wind farm applications
Energy Technology Data Exchange (ETDEWEB)
Abdulsalam, S.; Xu, W. [Alberta Univ., Edmonton, AB (Canada)
2008-07-01
Wind power is considered as one of the fastest growing technologies in the power industry. The electrical configuration of a wind farm consists of long spans of medium voltage collector feeders. Each wind generator is connected to the collector circuit/feeder through either a pad mount oil filled, or a nacelle-mounted dry type transformer. All collector feeders connect to a single collector substation where the connection to the high-voltage transmission is established through a step up transformer. With a large number of wind generators per feeder, large inrush current will flow due to simultaneous transformer energization which can cause high voltage sag at the point of common coupling. Wind farms are generally located in unpopulated remote areas where no access to strong network connection is feasible. It is common to have the PCC on a relatively weak location on the sub-transmission/distribution network. In order to meet interconnection standards requirements, the amount of voltage sag due to the energization of a number of transformers needs to be evaluated. This paper presented an effective solution to the mitigation of inrush currents and associated voltage sag for wind farm applications. The paper presented a diagram of a typical configuration of a wind farm electrical distribution system and also described the analytical methodologies for the evaluation of inrush current level together with simulation results. A simplified analysis and sizing criteria for the associated neutral resistor size was presented. It was concluded that the scheme could significantly reduce inrush current level when a large number of transformers are simultaneously energized. The presented application eliminates the need to sectionalize feeders, thereby simplifying them for the energization process. 6 refs., 5 figs.
International Nuclear Information System (INIS)
Watabe, Takuya; Okazaki, Osamu; Michihata, Tetsuo; Hara, Toshihiko; Harumi, Kenichi; Akutsu, Yasushi; Yamanaka, Hideyuki; Katagiri, Takashi.
1994-01-01
To determine the relationship between ST depression pattern and coronary blood volume in exercise induced myocardial ischemia, exercise-induced ST changes on ECG and regional myocardial blood flow (RMBF) on positron emission computed tomography (PET) were examined. The subjects were 41 patients with myocardial infarction and 30 with angina pectoris, consisting of 55 men and 16 women. Five normal men served as controls. In the group of ST depression, maximum PRP and age were significantly high, and patients with multiple vessel disease accounted for 63.6%. RMBF, as shown on PET, increased by 10% or more after exercise in 71.1% in the group of non ST change and in the control group. In 60.6% of the patients having ST depression, there was a decrease in RMBF or an unfavorable increase in RMBF. Among 33 patients in the group of ST depression, 17 had a sagging type. Of these 17, 12 (70.6%) showed a decrease of RMBF or an unfavorable increase in RMBF, and 10 had triple vessel disease. Sixteen patients had a horizontal type, 8 of whom (50.0%) had a decrease or unfavorable increase in RMBF. These findings suggest that a decrease or unfavorable increase (an increased rate of 10% or less) may be involved in the occurrence of ST depression induced by exercise. In particular, patients with a sagging type ST depression should be monitored during exercise because many of these patients may have triple vessel disease and a decrease or unfavorable increase in RMBF. (N.K.)
Energy Technology Data Exchange (ETDEWEB)
Gamble, Kyle A., E-mail: Kyle.Gamble@inl.gov [Royal Military College of Canada, Chemistry and Chemical Engineering, 13 General Crerar Crescent, Kingston, Ontario, Canada K7K 7B4 (Canada); Williams, Anthony F., E-mail: Tony.Williams@cnl.ca [Canadian Nuclear Laboratories, Fuel and Fuel Channel Safety, 1 Plant Road, Chalk River, Ontario, Canada K0J 1J0 (Canada); Chan, Paul K., E-mail: Paul.Chan@rmc.ca [Royal Military College of Canada, Chemistry and Chemical Engineering, 13 General Crerar Crescent, Kingston, Ontario, Canada K7K 7B4 (Canada); Wowk, Diane, E-mail: Diane.Wowk@rmc.ca [Royal Military College of Canada, Mechanical and Aerospace Engineering, 13 General Crerar Crescent, Kingston, Ontario, Canada K7K 7B4 (Canada)
2015-11-15
Highlights: • This is the first demonstration of using the MOOSE framework for modeling CANDU fuel. • Glued and frictionless contact algorithms behave as expected for 2D and 3D cases. • MOOSE accepts and correctly interprets functions of arbitrary form. • 3D deformation calculations accurately compare against analytical solutions. • MOOSE is a viable simulation tool for modeling accident reactor conditions. - Abstract: Horizontally oriented fuel bundles, such as those in CANada Deuterium Uranium (CANDU) reactors present unique modeling challenges. After long irradiation times or during severe transients the fuel elements can laterally deform out of plane due to processes known as bow and sag. Bowing is a thermally driven process that causes the fuel elements to laterally deform when a temperature gradient develops across the diameter of the element. Sagging is a coupled mechanical and thermal process caused by deformation of the fuel pin due to creep mechanisms of the sheathing after long irradiation times and or high temperatures. These out-of-plane deformations can lead to reduced coolant flow and a reduction in coolability of the fuel bundle. In extreme cases element-to-element or element-to-pressure tube contact could occur leading to reduced coolant flow in the subchannels or pressure tube rupture leading to a loss of coolant accident. This paper evaluates the capability of the Multiphysics Object-Oriented Simulation Environment (MOOSE) framework developed at the Idaho National Laboratory to model these deformation mechanisms. The material model capabilities of MOOSE and its ability to simulate contact are also investigated.
International Nuclear Information System (INIS)
García-Triviño, Pablo; Gil-Mena, Antonio José; Llorens-Iborra, Francisco; García-Vázquez, Carlos Andrés; Fernández-Ramírez, Luis M.; Jurado, Francisco
2015-01-01
Highlights: • Three PSO-based PI controllers for a grid-connected inverter were presented. • Two online PSO-based PI controllers were compared with an offline PSO-tuned PI. • The HRES and the inverter were evaluated under power changes and grid voltage sags. • Online ITAE-based PSO reduced ITAE (current THD) by 15.24% (5.32%) versus offline one. - Abstract: This paper is focused on the study of particle swarm optimization (PSO)-based PI controllers for the power control of a grid-connected inverter supplied from a hybrid renewable energy system. It is composed of two renewable energy sources (wind turbine and photovoltaic – PV – solar panels) and two energy storage systems (battery and hydrogen system, integrated by fuel cell and electrolyzer). Three PSO-based PI controllers are implemented: (1) conventional PI controller with offline tuning by PSO algorithm based on the integral time absolute error (ITAE) index; (2) PI controllers with online self-tuning by PSO algorithm based on the error; and (3) PI controllers with online self-tuning by PSO algorithm based on the ITAE index. To evaluate and compare the three controllers, the hybrid renewable energy system and the grid-connected inverter are simulated under changes in the active and reactive power values, as well as under a grid voltage sag. The results show that the online PSO-based PI controllers that optimize the ITAE index achieves the best response
2013-10-16
right) eartips The purpose of this study was to integrate the HGU-56/P and HGU-55/P flight helmets with PACE to measure the noise attenuation and...55/P flight helmet integrated with PACE 2.0 METHODS 2.1 Subjects Twenty paid volunteer subjects (9 male, 11 female) participated in the study ...Pan Pad Pat Path Pack Pass Buff Bus But Bug Buck Bun Sat Sag Sass Sack Sad Sap Run Sun Bun Gun Fun Nun 8 Distribution A: Approved for
A Descriptive Overview of Japanese Shipbuilding Surface Preparation and Coating Methods
1982-09-01
INORGANIC SHOP PRIMER I Materials I Weight BASE PASTE Total Alkyl-silicate Catalyst Alcohol Special organic resin Tinting pigment Anti-sagging agent... Alcohol Zinc powder 32.0 2.0 6.0 0.5 8.0 40.0 100.0 Shop Primer Composition (Courtesy of Chugoku Marine Paints 51 Limited) 4.2.1 Shop Primer...at a pH of 10 is added to minimize the oxydizing reactions which lead to salt formation and adhesion failure. “Galvanite” is the trade name for the
... or sun damage, you might also consider a skin-resurfacing procedure. A face-lift can be done in combination with some other cosmetic procedures, such as a brow lift or eyelid surgery. Why it's done As you get older, your facial skin changes — sagging and becoming loose. This can make ...
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging or...
A control strategy based on UTT and I CosΘ theory of three-phase ...
African Journals Online (AJOL)
The performance of the implemented control algorithm is evaluated in terms of power-factor correction; load balancing, neutral source current mitigation and mitigation of voltage and current harmonics, voltage sag and swell and voltage dips in a three-phase four-wire distribution system for different combination of linear and ...
Semi-Analytic Galaxies - I. Synthesis of environmental and star-forming regulation mechanisms
Cora, Sofía A.; Vega-Martínez, Cristian A.; Hough, Tomás; Ruiz, Andrés N.; Orsi, Álvaro; Muñoz Arancibia, Alejandra M.; Gargiulo, Ignacio D.; Collacchioni, Florencia; Padilla, Nelson D.; Gottlöber, Stefan; Yepes, Gustavo
2018-05-01
We present results from the semi-analytic model of galaxy formation SAG applied on the MULTIDARK simulation MDPL2. SAG features an updated supernova (SN) feedback scheme and a robust modelling of the environmental effects on satellite galaxies. This incorporates a gradual starvation of the hot gas halo driven by the action of ram pressure stripping (RPS), that can affect the cold gas disc, and tidal stripping (TS), which can act on all baryonic components. Galaxy orbits of orphan satellites are integrated providing adequate positions and velocities for the estimation of RPS and TS. The star formation history and stellar mass assembly of galaxies are sensitive to the redshift dependence implemented in the SN feedback model. We discuss a variant of our model that allows to reconcile the predicted star formation rate density at z ≳ 3 with the observed one, at the expense of an excess in the faint end of the stellar mass function at z = 2. The fractions of passive galaxies as a function of stellar mass, halo mass and the halo-centric distances are consistent with observational measurements. The model also reproduces the evolution of the main sequence of star forming central and satellite galaxies. The similarity between them is a result of the gradual starvation of the hot gas halo suffered by satellites, in which RPS plays a dominant role. RPS of the cold gas does not affect the fraction of quenched satellites but it contributes to reach the right atomic hydrogen gas content for more massive satellites (M⋆ ≳ 1010 M⊙).