2016 SAE-China Congress

CERN Document Server

2017-01-01

This proceedings volume gathers outstanding papers submitted to the 2016 SAE-China Congress, the majority of which are from China, the biggest car maker as well as most dynamic car market in the world. The book includes insights into the current challenges that the whole industry is currently facing, and it offers possible solutions to problems such as emission controls, environmental pollution, the energy shortage, traffic congestion and sustainable development. It also presents the latest technical achievements in the automotive industry. Many of the approaches it presents can help technicians to solve the practical problems that most affect their daily work.

Downstream element determines RNase Y cleavage of the saePQRS operon in Staphylococcus aureus.

Science.gov (United States)

Marincola, Gabriella; Wolz, Christiane

2017-06-02

In gram-positive bacteria, RNase J1, RNase J2 and RNase Y are thought to be major contributors to mRNA degradation and maturation. In Staphylococcus aureus, RNase Y activity is restricted to regulating the mRNA decay of only certain transcripts. Here the saePQRS operon was used as a model to analyze RNase Y specificity in living cells. A RNase Y cleavage site is located in an intergenic region between saeP and saeQ. This cleavage resulted in rapid degradation of the upstream fragment and stabilization of the downstream fragment. Thereby, the expression ratio of the different components of the operon was shifted towards saeRS, emphasizing the regulatory role of RNase Y activity. To assess cleavage specificity different regions surrounding the sae CS were cloned upstream of truncated gfp, and processing was analyzed in vivo using probes up- and downstream of CS. RNase Y cleavage was not determined by the cleavage site sequence. Instead a 24-bp double-stranded recognition structure was identified that was required to initiate cleavage 6 nt upstream. The results indicate that RNase Y activity is determined by secondary structure recognition determinants, which guide cleavage from a distance. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

76 FR 17757 - Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and...

Science.gov (United States)

2011-03-31

... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114.... Applicability (c) This AD applies to Thielert Aircraft Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE...) For TAE 125-02-99 and TAE 125-02-114 engines, Operation & Maintenance Manual OM-02-02, Version 2...

SaeRS Is Responsive to Cellular Respiratory Status and Regulates Fermentative Biofilm Formation in Staphylococcus aureus.

Science.gov (United States)

Mashruwala, Ameya A; Gries, Casey M; Scherr, Tyler D; Kielian, Tammy; Boyd, Jeffrey M

2017-08-01

Biofilms are multicellular communities of microorganisms living as a quorum rather than as individual cells. The bacterial human pathogen Staphylococcus aureus uses oxygen as a terminal electron acceptor during respiration. Infected human tissues are hypoxic or anoxic. We recently reported that impaired respiration elicits a p rogrammed c ell l ysis (PCL) phenomenon in S. aureus leading to the release of cellular polymers that are utilized to form biofilms. PCL is dependent upon the AtlA murein hydrolase and is regulated, in part, by the SrrAB two-component regulatory system (TCRS). In the current study, we report that the SaeRS TCRS also governs fermentative biofilm formation by positively influencing AtlA activity. The SaeRS-modulated factor fibronectin-binding protein A (FnBPA) also contributed to the fermentative biofilm formation phenotype. SaeRS-dependent biofilm formation occurred in response to changes in cellular respiratory status. Genetic evidence presented suggests that a high cellular titer of phosphorylated SaeR is required for biofilm formation. Epistasis analyses found that SaeRS and SrrAB influence biofilm formation independently of one another. Analyses using a mouse model of orthopedic implant-associated biofilm formation found that both SaeRS and SrrAB govern host colonization. Of these two TCRSs, SrrAB was the dominant system driving biofilm formation in vivo We propose a model wherein impaired cellular respiration stimulates SaeRS via an as yet undefined signal molecule(s), resulting in increasing expression of AtlA and FnBPA and biofilm formation. Copyright © 2017 American Society for Microbiology.

17 CFR 210.12-25 - Supplementary profit and loss information.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Supplementary profit and loss... § 210.12-25 Supplementary profit and loss information. Column A—Item 1 Column B—Charged to investment... resulting from transactions with affiliates shall be stated separately. 2 State separately each category of...

A Point Mutation in the Sensor Histidine Kinase SaeS of Staphylococcus aureus Strain Newman Alters the Response to Biocide Exposure

NARCIS (Netherlands)

Schaefer, Daniel; Lam, Thien-Tri; Geiger, Tobias; Mainiero, Markus; Engelmann, Susanne; Hussain, Muzaffar; Bosserhoff, Armin; Frosch, Matthias; Bischoff, Markus; Wolz, Christiane; Reidl, Joachim; Sinha, Bhanu

2009-01-01

Staphylococcus aureus reacts to changing environmental conditions such as heat, pH, and chemicals through global regulators such as the sae (S. aureus exoprotein expression) two-component signaling system. Subinhibitory concentrations of some antibiotics were shown to increase virulence factor

Research on Optimization of Formula SAE Truss-Frame

Directory of Open Access Journals (Sweden)

Wang Yu

2017-01-01

Full Text Available The frame, as one of the basic components of a car, plays an important role of connecting components and withstanding various loads. The truss-frame is the commonest form of Formula SAE car in that it has many advantages, such as low cost, simple manufacture, high rigidity and high strength. The development of frame is reviewed. First, the key performance indicators and the mechanical state of the frame under different conditions are discussed. Second, a variety of optimization methods used in the design of frame are described. Finally, the test method of frame are introduced, with the experimental data and the finite element analysis of results being compared. Through analyzing and summarizing the development of the design, optimization and testing technology of the Formula SAE truss-frame, forecasting the future trends, the great theoretical reference is provided for the design and research of the follow-up frame.

Electrical Conduction of Ba(Ti0.99Fe0.01)O3-δ Ceramic at High Temperatures

Science.gov (United States)

Yu, Zi-De; Chen, Xiao-Ming

2018-03-01

BaTiO3 and Ba(Ti0.99Fe0.01)O3-δ ceramics with dense microstructure have been synthesized by a solid-state reaction method, and their electrical conduction investigated by broadband electrical impedance spectroscopy at frequencies from 0.05 Hz to 3 × 106 Hz and temperatures from 200°C to 400°C. Compared with BaTiO3, the real part of the permittivity and the phase-transition temperature of Ba(Ti0.99Fe0.01)O3-δ decreased. Relaxation peaks appeared in the curves of the imaginary part of the permittivity as a function of frequency. With increase in frequency, the peaks gradually shifted towards higher frequency and their height increased. Conductivity was closely related to frequency and temperature. Frequency-dependent conductivity was analyzed using the Jonscher double power law. Compared with BaTO3, Ba(Ti0.99Fe0.01)O3-δ exhibited high impedance at given frequency and temperature. Impedance Cole-Cole plots displayed two semicircles, which could be well fit using two parallel RC equivalent circuit models. The conductivity activation energy was found to be around 1 eV. For Ba(Ti0.99Fe0.01)O3-δ , the electrical modulus curve versus frequency displayed two peaks.

40 CFR 86.1729-99-86.1733-99 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 19 2010-07-01 2010-07-01 false [Reserved] 86.1729-99-86.1733-99 Section 86.1729-99-86.1733-99 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Light-Duty Trucks §§ 86.1729-99—86.1733-99 [Reserved] ...

40 CFR 86.1736-99-86.1769-99 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 19 2010-07-01 2010-07-01 false [Reserved] 86.1736-99-86.1769-99 Section 86.1736-99-86.1769-99 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Light-Duty Trucks §§ 86.1736-99—86.1769-99 [Reserved] ...

40 CFR 86.1718-99-86.1720-99 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 19 2010-07-01 2010-07-01 false [Reserved] 86.1718-99-86.1720-99 Section 86.1718-99-86.1720-99 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Light-Duty Trucks §§ 86.1718-99—86.1720-99 [Reserved] ...

Mre11-Sae2 and RPA Collaborate to Prevent Palindromic Gene Amplification.

Science.gov (United States)

Deng, Sarah K; Yin, Yi; Petes, Thomas D; Symington, Lorraine S

2015-11-05

Foldback priming at DNA double-stranded breaks is one mechanism proposed to initiate palindromic gene amplification, a common feature of cancer cells. Here, we show that small (5-9 bp) inverted repeats drive the formation of large palindromic duplications, the major class of chromosomal rearrangements recovered from yeast cells lacking Sae2 or the Mre11 nuclease. RPA dysfunction increased the frequency of palindromic duplications in Sae2 or Mre11 nuclease-deficient cells by ∼ 1,000-fold, consistent with intra-strand annealing to create a hairpin-capped chromosome that is subsequently replicated to form a dicentric isochromosome. The palindromic duplications were frequently associated with duplication of a second chromosome region bounded by a repeated sequence and a telomere, suggesting the dicentric chromosome breaks and repairs by recombination between dispersed repeats to acquire a telomere. We propose secondary structures within single-stranded DNA are potent instigators of genome instability, and RPA and Mre11-Sae2 play important roles in preventing their formation and propagation, respectively. Copyright © 2015 Elsevier Inc. All rights reserved.

USO DA SISTEMATIZAÇÃO DA ASSISTÊNCIA DE ENFERMAGEM (SAE: UMA FERRAMENTA PARA REALIZAÇÃO DA AUDITORIA DE QUALIDADE

Directory of Open Access Journals (Sweden)

Maria Izelta da Silva Santos

2013-04-01

Full Text Available Realizar uma revisao bibliografica acerca da Sistematização da Assistencia de Enfermagem (SAE como instrumento para auditoria de qualidade. Metodos: Foram revisados 12 artigos cientificos sobre auditoria e 10 artigos sobre SAE, bem como dois livros sobre os assuntos abordados. Esta revisao e de carater descritivo. Resultados: Por meio da pesquisa, tornou-se evidente a correlação da SAE com a auditoria. A SAE bem implementada pode contribuir para uma auditoria de qualidade.

Electric Vehicle Communications Standards Testing and Validation - Phase II: SAE J2931/1

Energy Technology Data Exchange (ETDEWEB)

Pratt, Richard M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gowri, Krishnan [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2013-01-15

Vehicle to grid communication standards enable interoperability among vehicles, charging stations and utility providers and provide the capability to implement charge management. Several standards initiatives by the Society of Automobile Engineers (SAE), International Standards Organization and International Electrotechnical Commission (ISO/IEC), and ZigBee/HomePlug Alliance are developing requirements for communication messages and protocols. Recent work by the Electric Power Research Institute (EPRI) in collaboration with SAE and automobile manufacturers has identified vehicle to grid communication performance requirements and developed a test plan as part of SAE J2931/1 committee work. This laboratory test plan was approved by the SAE J2931/1 committee and included test configurations, test methods, and performance requirements to verify reliability, robustness, repeatability, maximum communication distance, and authentication features of power line carrier (PLC) communication modules at the internet protocol layer level. The goal of the testing effort was to select a communication technology that would enable automobile manufacturers to begin the development and implementation process. The EPRI/Argonne National Laboratory (ANL)/Pacific Northwest National Laboratory (PNNL) testing teams divided the testing so that results for each test could be presented by two teams, performing the tests independently. The PNNL team performed narrowband PLC testing including the Texas Instruments (TI) Concerto, Ariane Controls AC-CPM1, and the MAXIM Tahoe 2 evaluation boards. The scope of testing was limited to measuring the vendor systems communication performance between Electric Vehicle Support Equipment (EVSE) and plug-in electric vehicles (PEV). The testing scope did not address PEV’s CAN bus to PLC or PLC to EVSE (Wi-Fi, cellular, PLC Mains, etc.) communication integration. In particular, no evaluation was performed to delineate the effort needed to translate the IPv6

Kogeja vormistamine eesti keeles : nihkeid SAE perifeerias / Mati Erelt, Helle Metslang

Index Scriptorium Estoniae

Erelt, Mati, 1941-

2008-01-01

Vaadeldakse kogeja vormistamist ning alternatiivsete mallide kasutust ajakirjanduskeeles ajavahemikul 1995-2005. Püütakse välja selgitada toimunud muutused ja nende põhjused. SAE - Euroopa keskmine standard

Kogeja vormistamine eesti keeles : nihkeid SAE perifeerias / Mati Erelt, Helle Metslang

Index Scriptorium Estoniae

Erelt, Mati, 1941-

2008-01-01

Artiklis vaadeldakse kogeja vormistamist ning alternatiivsete mallide kasutust ajakirjanduskeeles ajavahemikul 1995-2005 eesmärgiga välja selgitada toimunud muutused ning nende põhjused. SAE - Euroopa keskmine standard

sae is essential for expression of the staphylococcal adhesins Eap and Emp.

Science.gov (United States)

Harraghy, Niamh; Kormanec, Jan; Wolz, Christiane; Homerova, Dagmar; Goerke, Christiane; Ohlsen, Knut; Qazi, Saara; Hill, Philip; Herrmann, Mathias

2005-06-01

Eap and Emp are two Staphylococcus aureus adhesins initially described as extracellular matrix binding proteins. Eap has since emerged as being important in adherence to and invasion of eukaryotic cells, as well as being described as an immunomodulator and virulence factor in chronic infections. This paper describes the mapping of the transcription start point of the eap and emp promoters. Moreover, using reporter-gene assays and real-time PCR in defined regulatory mutants, environmental conditions and global regulators affecting expression of eap and emp were investigated. Marked differences were found in expression of eap and emp between strain Newman and the 8325 derivatives SH1000 and 8325-4. Moreover, both genes were repressed in the presence of glucose. Analysis of expression of both genes in various regulatory mutants revealed that sarA and agr were involved in their regulation, but the data suggested that there were additional regulators of both genes. In a sae mutant, expression of both genes was severely repressed. sae expression was also reduced in the presence of glucose, suggesting that repression of eap and emp in glucose-containing medium may, in part, be a consequence of a decrease in expression of sae.

A model for fracture toughness evaluation of the carburized layer for SAE 5115 steel

OpenAIRE

Sandor, Leonardo Taborda; Ferreira, Itamar

2006-01-01

The purpose of this work is to propose a model for evaluating the fracture toughness along the SAE 5115 steel carburized layer. Due to the small thickness of those layers, it is impossible to machine specimens from those layer in accordance with standards. For simulating the microstructures of the carburized layer in order to get samples for tensile and the fracture toughness testing, specimens of SAE 5115, 5140, 5160, and 52100 steels have been machined, assuming the local influence just the...

40 CFR 152.406 - Submission of supplementary data.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Submission of supplementary data. 152.406 Section 152.406 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Registration Fees § 152.406 Submission of...

The SaeR/S gene regulatory system induces a pro-inflammatory cytokine response during Staphylococcus aureus infection.

Directory of Open Access Journals (Sweden)

Robert L Watkins

Full Text Available Community-associated methicillin-resistant Staphylococcus aureus accounts for a large portion of the increased staphylococcal disease incidence and can cause illness ranging from mild skin infections to rapidly fatal sepsis syndromes. Currently, we have limited understanding of S. aureus-derived mechanisms contributing to bacterial pathogenesis and host inflammation during staphylococcal disease. Herein, we characterize an influential role for the saeR/S two-component gene regulatory system in mediating cytokine induction using mouse models of S. aureus pathogenesis. Invasive S. aureus infection induced the production of localized and systemic pro-inflammatory cytokines, including tumor necrosis factor alpha (TNF-α, interferon gamma (IFN-γ, interleukin (IL-6 and IL-2. In contrast, mice infected with an isogenic saeR/S deletion mutant demonstrated significantly reduced pro-inflammatory cytokine levels. Additionally, secreted factors influenced by saeR/S elicited pro-inflammatory cytokines in human blood ex vivo. Our study further demonstrated robust saeR/S-mediated IFN-γ production during both invasive and subcutaneous skin infections. Results also indicated a critical role for saeR/S in promoting bacterial survival and enhancing host mortality during S. aureus peritonitis. Taken together, this study provides insight into specific mechanisms used by S. aureus during staphylococcal disease and characterizes a relationship between a bacterial global regulator of virulence and the production of pro-inflammatory mediators.

Smoking-Attributable Mortality, Morbidity, and Economic Costs (SAMMEC) - Smoking-Attributable Expenditures (SAE)

Data.gov (United States)

U.S. Department of Health & Human Services — 2005-2009. SAMMEC - Smoking-Attributable Mortality, Morbidity, and Economic Costs. Smoking-attributable expenditures (SAEs) are excess health care expenditures...

Effect of hydrogen charging on the stability of SAE 10B22 steel surface in alkaline solutions

International Nuclear Information System (INIS)

Modiano, S.; Carreno, J.A.; Fugivara, C.S.; Benedetti, A.V.; Mattos, O.R.

2005-01-01

The influence of hydrogen charging into a quenched and tempered boron steel membrane electrode (SAE 10B22) was studied using borate buffer (pH 8.4) and NaOH solutions (pH 12.7), with or without the addition of 0.01 M EDTA. At the hydrogen input side, hydrogen charging influenced cyclic voltammograms increasing the anodic charge of iron(II) hydroxide formation, and decreasing the donor density of passive films. These results suggest that the hydrogen ingress caused instability of metallic surface, increasing the surface area activity

14 CFR 99.1 - Applicability.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Applicability. 99.1 Section 99.1... AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.1 Applicability. (a) This... Identification Zone (ADIZ) designated in subpart B. (b) Except for §§ 99.7, 99.13, and 99.15 this subpart does...

Small area estimation (SAE) model: Case study of poverty in West Java Province

Science.gov (United States)

Suhartini, Titin; Sadik, Kusman; Indahwati

2016-02-01

This paper showed the comparative of direct estimation and indirect/Small Area Estimation (SAE) model. Model selection included resolve multicollinearity problem in auxiliary variable, such as choosing only variable non-multicollinearity and implemented principal component (PC). Concern parameters in this paper were the proportion of agricultural venture poor households and agricultural poor households area level in West Java Province. The approach for estimating these parameters could be performed based on direct estimation and SAE. The problem of direct estimation, three area even zero and could not be conducted by directly estimation, because small sample size. The proportion of agricultural venture poor households showed 19.22% and agricultural poor households showed 46.79%. The best model from agricultural venture poor households by choosing only variable non-multicollinearity and the best model from agricultural poor households by implemented PC. The best estimator showed SAE better then direct estimation both of the proportion of agricultural venture poor households and agricultural poor households area level in West Java Province. The solution overcame small sample size and obtained estimation for small area was implemented small area estimation method for evidence higher accuracy and better precision improved direct estimator.

Spectroscopy of deep doping levels in Cd{sub 0.99}Mn{sub 0.01}Te:Ga; Spektroskopia glebokich poziomow domieszkowych w Cd{sub 0.99}Mn{sub 0.01}Te:Ga

Energy Technology Data Exchange (ETDEWEB)

Szatkowski, J.; Placzek-Popko, E.; Sieranski, K. [Politechnika Wroclawska, Wroclaw (Poland); Bieg, B. [Wyzsza Szkola Morska, Szczecin (Poland)

1997-12-01

The investigation results of deep energy levels in Cd{sub 0.99}Mn{sub 0.01}Te (n-type) doped with gallium have been presented. Deep level transient spectroscopy (DLTS) measurements have been carried out in temperature range 80-420 K. The results show five types of electron traps. The activation energy of trapping levels and electron trapping cross-sections have been determined for observed traps. 2 refs, 3 figs, 1 tab.

Fabrication of Polycrystalline Lanthanum Manganite (La0.99 Mn0.01 O3) Powder and Fibres by Electrospinning Method

International Nuclear Information System (INIS)

Yin Yin Win; That Htar Lwin; Than Than Win; Yin Maung Maung; Ko Ko Kyaw Soe

2011-12-01

Lanthanum manganite (La0.99 Mn0.01 O3) powder have been prepared by using pyrolysis methods. Lanthanum manganite fibres were successfully fabricated by electro-spinning utilizing precursors. Polycrystalline perovskite structure lanthanum manganite powder and fibres showed that the grain size and crystal grain increased significantly with the increase in calcination temperature. A variety of techniques (SEM, FT-IR and TG-DTA) were employed to study the morphology and fibre quality, crystal structure, and thermal analysis of La0.99 Mn0.01 O3 specimen respectively.

Microstructural characterization of an AISI-SAE 4140 steel without nitridation and nitrided; Caracterizacion microestructural de un acero AISI-SAE 4140 sin nitrurar y nitrurado

Energy Technology Data Exchange (ETDEWEB)

Medina F, A.; Naquid G, C. [Gerencia de Ciencia de Materiales, Depto. de Sintesis y Caracterizacion de Materiales, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

2000-07-01

It was micro structurally characterized an AISI-SAE 4140 steel before and after of nitridation through the nitridation process by plasma post-unloading microwaves through Optical microscopy (OM), Scanning electron microscopy (SEM) by means of secondary electrons and retrodispersed, X-ray diffraction (XRD), Energy dispersion spectra (EDS) and mapping of elements. (Author)

CARACTHERIZATION OF MECHANICAL PROPERTIES ON SAE 4140 STEEL AFTER DIFFERENT TREATMENTS OF QUENCHING AND TEMPERING

OpenAIRE

LUIS PAULO PIRES GONCALVES RIBEIRO

2006-01-01

Os aços de alta resistência e baixa liga (ARBL) pertencem a uma classe de aços que desperta o interesse de pesquisadores da área metal-mecânica. A pesquisa teve como objetivos estudar a influência dos tratamentos térmicos de têmpera e revenido sobre as propriedades do aço SAE 4140 e avaliar o comportamento do aço SAE 4140 quando submetido ao revenido na faixa de temperatura característica da fragilização. Inicialmente, o material foi tratado termicamente sob di...

Spectroscopy of deep doping levels in Cd0.99Mn0.01Te:Ga

International Nuclear Information System (INIS)

Szatkowski, J.; Placzek-Popko, E.; Sieranski, K.; Bieg, B.

1997-01-01

The investigation results of deep energy levels in Cd 0.99 Mn 0.01 Te (n-type) doped with gallium have been presented. Deep level transient spectroscopy (DLTS) measurements have been carried out in temperature range 80-420 K. The results show five types of electron traps. The activation energy of trapping levels and electron trapping cross-sections have been determined for observed traps. 2 refs, 3 figs, 1 tab

Flexible Design and Operation of a Smart Charging Microgrid (Briefing Charts)

Science.gov (United States)

2014-04-08

release; distribution unlimited 13. SUPPLEMENTARY NOTES Briefing Charts for SAE World Congress 2014 14. ABSTRACT A microgrid is a controllable ...UNCLASSIFIED Distribution Statement A: Approved for Public Release Flexible Design and Operation of a Smart Charging Microgrid Annette G... control number. 1. REPORT DATE 08 APR 2014 2. REPORT TYPE Briefing Charts 3. DATES COVERED 08-01-2014 to 09-03-2014 4. TITLE AND SUBTITLE

SAE for the prediction of road traffic status from taxicab operating data and bus smart card data

Science.gov (United States)

Zhengfeng, Huang; Pengjun, Zheng; Wenjun, Xu; Gang, Ren

Road traffic status is significant for trip decision and traffic management, and thus should be predicted accurately. A contribution is that we consider multi-modal data for traffic status prediction than only using single source data. With the substantial data from Ningbo Passenger Transport Management Sector (NPTMS), we wished to determine whether it was possible to develop Stacked Autoencoders (SAEs) for accurately predicting road traffic status from taxicab operating data and bus smart card data. We show that SAE performed better than linear regression model and Back Propagation (BP) neural network for determining the relationship between road traffic status and those factors. In a 26-month data experiment using SAE, we show that it is possible to develop highly accurate predictions (91% test accuracy) of road traffic status from daily taxicab operating data and bus smart card data.

14 CFR 99.12 - [Reserved

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false [Reserved] 99.12 Section 99.12 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.12 [Reserved] ...

14 CFR 99.41 - General.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false General. 99.41 Section 99.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC Designated Air Defense Identification Zones § 99...

14 CFR 99.3 - Definitions.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Definitions. 99.3 Section 99.3 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.3 Definitions. Aeronautical facility...

Retained Austenite in SAE 52100 Steel Post Magnetic Processing and Heat Treatment

Energy Technology Data Exchange (ETDEWEB)

Pappas, Nathaniel R [ORNL; Watkins, Thomas R [ORNL; Cavin, Odis Burl [ORNL; Jaramillo, Roger A [ORNL; Ludtka, Gerard Michael [ORNL

2007-01-01

Steel is an iron-carbon alloy that contains up to 2% carbon by weight. Understanding which phases of iron and carbon form as a function of temperature and percent carbon is important in order to process/manufacture steel with desired properties. Austenite is the face center cubic (fcc) phase of iron that exists between 912 and 1394 C. When hot steel is rapidly quenched in a medium (typically oil or water), austenite transforms into martensite. The goal of the study is to determine the effect of applying a magnetic field on the amount of retained austenite present at room temperature after quenching. Samples of SAE 52100 steel were heat treated then subjected to a magnetic field of varying strength and time, while samples of SAE 1045 steel were heat treated then subjected to a magnetic field of varying strength for a fixed time while being tempered. X-ray diffraction was used to collect quantitative data corresponding to the amount of each phase present post processing. The percentage of retained austenite was then calculated using the American Society of Testing and Materials standard for determining the amount of retained austenite for randomly oriented samples and was plotted as a function of magnetic field intensity, magnetic field apply time, and magnetic field wait time after quenching to determine what relationships exist with the amount of retained austenite present. In the SAE 52100 steel samples, stronger field strengths resulted in lower percentages of retained austenite for fixed apply times. The results were inconclusive when applying a fixed magnetic field strength for varying amounts of time. When applying a magnetic field after waiting a specific amount of time after quenching, the analyses indicate that shorter wait times result in less retained austenite. The SAE 1045 results were inconclusive. The samples showed no retained austenite regardless of magnetic field strength, indicating that tempering removed the retained austenite. It is apparent

Tritium stripping in a nitrogen glove box using palladium/zeolite and SAES St 198 trademark

International Nuclear Information System (INIS)

Klien, J.E.; Wermer, J.R.

1995-01-01

Glove box clean-up experiments were conducted in a nitrogen glove box using palladium deposited on zeolite (Pd/z) and a SAES St 198 trademark getter as tritium stripping materials. Protium/deuterium samples spiked with tritium were released into a 620 liter glove box to simulate tritium releases in a 10,500 liter glove box. The Pd/z and the SAES St 198 trademark stripper beds produced a reduction in tritium activity of approximately two to three orders of magnitude and glove box clean-up was limited by a persistent background tritium activity level. Attempts to significantly reduce the glove box activity to lower levels without purging were unsuccessful

40 CFR Appendix D to Subpart B of... - SAE J2810 Standard for Recovery Only Equipment for HFC-134a Refrigerant

Science.gov (United States)

2010-07-01

... removed from, motor vehicle air-conditioning systems. 1. Scope The purpose of this SAE Standard is to... 700 Standard or allow for recycling of the recovered refrigerant to SAE J2788 specifications by using... (R-134a) Recovery/Recycling Equipment and Recovery/Recycling/Recharging for Mobile Air-Conditioning...

75 FR 6216 - Proposed Information Collection; OMB Control Number 1018-0088; National Survey of Fishing...

Science.gov (United States)

2010-02-08

... Service, MS 222-ARLSQ, 4401 North Fairfax Drive, Arlington, VA 22203 (mail); or hope_ [email protected] (e-mail... mail or e-mail (see ADDRESSES) or by telephone at (703) 358-2482. SUPPLEMENTARY INFORMATION: I... Recreation (FHWAR) assists Federal and State agencies in administering the Sport Fish and Wildlife...

La articulación de los SAE y la generación de valor público

OpenAIRE

Suárez Ognio, María del Carmen Leonor; Chumacero Guzmán, Enrique Eloy

2017-01-01

Este trabajo busca identificar el problema que impide la consecución de logros en términos de valor público y trabajar en una de sus causas: la desarticulación de los principales Sistemas Administrativos del Estado (SAE). Este estudio sirve para explicar cómo la teoría de la agencia ha sido usada, consciente o inconscientemente, en el diseño de los SAE, haciendo que actúen como sistemas de control en lugar de ser sistemas para la gestión orientados a generar valor público. Con esto se ha afec...

Bilayers Polypyrrole Coatings for Corrosion Protection of SAE 4140 Steel

OpenAIRE

Lehr, I.L.; Saidman, S.B.

2014-01-01

In this study polypyrrole (PPy) bilayers films were electrodeposited onto SAE 4140 steel. The inner layer was electropolymerized in the presence of molibdate and nitrate and the outer layer in a solution containing sodium bis (2-ethylhexyl) sulfosuccinate (AOT). The electrosynthesis was done under potentiostatic conditions. The corrosion protection properties of the films were examined in sodium chloride solution by open circuit measurements, linear polarization and electrochemical impedance ...

14 CFR 61.99 - Aeronautical experience.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aeronautical experience. 61.99 Section 61.99 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND INSTRUCTORS Recreational Pilots § 61.99...

7 CFR 27.99 - Values; expression.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Values; expression. 27.99 Section 27.99 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... CLASSIFICATION UNDER COTTON FUTURES LEGISLATION Regulations Price Quotations and Differences § 27.99 Values...

14 CFR 99.47 - Guam ADIZ.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Guam ADIZ. 99.47 Section 99.47 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC Designated Air Defense Identification Zones § 99...

Cell and molecular biology of SAE, a cell line from the spiny dogfish shark, Squalus acanthias.

Science.gov (United States)

Parton, Angela; Forest, David; Kobayashi, Hiroshi; Dowell, Lori; Bayne, Christopher; Barnes, David

2007-02-01

Cartilaginous fish, primarily sharks, rays and skates (elasmobranchs), appeared 450 million years ago. They are the most primitive vertebrates, exhibiting jaws and teeth, adaptive immunity, a pressurized circulatory system, thymus, spleen, and a liver comparable to that of humans. The most used elasmobranch in biomedical research is the spiny dogfish shark, Squalus acanthias. Comparative genomic analysis of the dogfish shark, the little skate (Leucoraja erincea), and other elasmobranchs have yielded insights into conserved functional domains of genes associated with human liver function, multidrug resistance, cystic fibrosis, and other biomedically relevant processes. While genomic information from these animals is informative in an evolutionary framework, experimental verification of functions of genomic sequences depends heavily on cell culture approaches. We have derived the first multipassage, continuously proliferating cell line of a cartilaginous fish. The line was initiated from embryos of the spiny dogfish shark. The cells were maintained in a medium modified for fish species and supplemented with cell type-specific hormones, other proteins and sera, and plated on a collagen substrate. SAE cells have been cultured continuously for three years. These cells can be transfected by plasmids and have been cryopreserved. Expressed Sequence Tags generated from a normalized SAE cDNA library included a number of markers for cartilage and muscle, as well as proteins influencing tissue differentiation and development, suggesting that SAE cells may be of mesenchymal stem cell origin. Examination of SAE EST sequences also revealed a cartilaginous fish-specific repetitive sequence that may be evidence of an ancient mobile genetic element that most likely was introduced into the cartilaginous fish lineage after divergence from the lineage leading to teleosts.

29 CFR 99.400 - Responsibilities.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Responsibilities. 99.400 Section 99.400 Labor Office of the... Pass-through Entities § 99.400 Responsibilities. (a) Cognizant agency for audit responsibilities... the report submission due date required by § 99.320(a). The cognizant agency for audit may grant...

14 CFR 99.5 - Emergency situations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Emergency situations. 99.5 Section 99.5 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.5 Emergency situations. In an...

14 CFR 99.15 - Position reports.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Position reports. 99.15 Section 99.15 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.15 Position reports. (a) The...

14 CFR 99.9 - Radio requirements.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Radio requirements. 99.9 Section 99.9 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.9 Radio requirements. (a) A...

14 CFR 99.49 - Hawaii ADIZ.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Hawaii ADIZ. 99.49 Section 99.49 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC... Zones § 99.49 Hawaii ADIZ. (a) Outer boundary. The area included in the irregular octagonal figure...

Supplementary physicians' fees: a sustainable system?

Science.gov (United States)

Calcoen, Piet; van de Ven, Wynand P M M

2018-01-25

In Belgium and France, physicians can charge a supplementary fee on top of the tariff set by the mandatory basic health insurance scheme. In both countries, the supplementary fee system is under pressure because of financial sustainability concerns and a lack of added value for the patient. Expenditure on supplementary fees is increasing much faster than total health expenditure. So far, measures taken to curb this trend have not been successful. For certain categories of physicians, supplementary fees represent one-third of total income. For patients, however, the added value of supplementary fees is not that clear. Supplementary fees can buy comfort and access to physicians who refuse to treat patients who are not willing to pay supplementary fees. Perceived quality of care plays an important role in patients' willingness to pay supplementary fees. Today, there is no evidence that physicians who charge supplementary fees provide better quality of care than physicians who do not. However, linking supplementary fees to objectively proven quality of care and limiting access to top quality care to patients able and willing to pay supplementary fees might not be socially acceptable in many countries. Our conclusion is that supplementary physicians' fees are not sustainable.

Microstructural characterization of an AISI-SAE 4140 steel without nitridation and nitrided

International Nuclear Information System (INIS)

Medina F, A.; Naquid G, C.

2000-01-01

It was micro structurally characterized an AISI-SAE 4140 steel before and after of nitridation through the nitridation process by plasma post-unloading microwaves through Optical microscopy (OM), Scanning electron microscopy (SEM) by means of secondary electrons and retrodispersed, X-ray diffraction (XRD), Energy dispersion spectra (EDS) and mapping of elements. (Author)

15 CFR 9.9 - Consumer education.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Consumer education. 9.9 Section 9.9 Commerce and Foreign Trade Office of the Secretary of Commerce PROCEDURES FOR A VOLUNTARY LABELING PROGRAM FOR HOUSEHOLD APPLIANCES AND EQUIPMENT TO EFFECT ENERGY CONSERVATION § 9.9 Consumer education. The...

29 CFR 99.105 - Definitions.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 99.105 Section 99.105 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS General § 99.105 Definitions. Audit finding means deficiencies which the auditor is required by § 99.510(a) to report in the...

EJSCREEN Supplementary Indexes 2015 Public

Data.gov (United States)

U.S. Environmental Protection Agency — There are 40 supplementary EJSCREEN indexes that are divided into 5 categories: EJ Index with supplementary demographic index, Supplementary EJ Index 1 with...

22 CFR 99.3 - [Reserved

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false [Reserved] 99.3 Section 99.3 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES REPORTING ON CONVENTION AND NON-CONVENTION ADOPTIONS OF EMIGRATING CHILDREN § 99.3 [Reserved] ...

SAE2.py: a python script to automate parameter studies using SCREAMER with application to magnetic switching on Z

International Nuclear Information System (INIS)

Orndorff-Plunkett, Franklin

2011-01-01

The SCREAMER simulation code is widely used at Sandia National Laboratories for designing and simulating pulsed power accelerator experiments on super power accelerators. A preliminary parameter study of Z with a magnetic switching retrofit illustrates the utility of the automating script for optimizing pulsed power designs. SCREAMER is a circuit based code commonly used in pulsed-power design and requires numerous iterations to find optimal configurations. System optimization using simulations like SCREAMER is by nature inefficient and incomplete when done manually. This is especially the case when the system has many interactive elements whose emergent effects may be unforeseeable and complicated. For increased completeness, efficiency and robustness, investigators should probe a suitably confined parameter space using deterministic, genetic, cultural, ant-colony algorithms or other computational intelligence methods. I have developed SAE2 - a user-friendly, deterministic script that automates the search for optima of pulsed-power designs with SCREAMER. This manual demonstrates how to make input decks for SAE2 and optimize any pulsed-power design that can be modeled using SCREAMER. Application of SAE2 to magnetic switching on model of a potential Z refurbishment illustrates the power of SAE2. With respect to the manual optimization, the automated optimization resulted in 5% greater peak current (10% greater energy) and a 25% increase in safety factor for the most highly stressed element.

32 CFR 99.3 - General definitions.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false General definitions. 99.3 Section 99.3 National... PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.3 General definitions. For the purposes of §§ 99.1 through 99.9 of this part: Criminal history record information: information collected by...

Comparación del desgaste por abrasión y el desgaste por deslizamiento de los aceros aisi/sae 1020, 1045 y 4140

Directory of Open Access Journals (Sweden)

Gustavo Jiménez-Torrado

2012-01-01

Full Text Available Two ways of evaluating the resistance to the wear, these are analyzed from the quantitative and qualitative point of view. Wear tests were realized by graze and wear by slide according to the procedure ASTM G65 and G99, in the steels AISI/SAE 1020, 1045 and 4140. The factors of study are the load, the speed of slide and the slid distance; all the factors were combined to determine the behavior of every wear. The loss of material is compared by the model Archard. The results of the tests show that the behavior of the desgate of the steels they are proportional to the factors of load and slid distance. The spoiled surfaces show typical characteristics of both types of wear, showing a relation with the experimental factors.

46 CFR 25.01-3 - Incorporation by reference.

Science.gov (United States)

2010-10-01

....45-2 Standard A-16-97, Electric Navigation Lights, July 1997 25.10-3 National Fire Protection... Commercial Motor Craft, 1989 25.45-2 Society of Automotive Engineers (SAE) 400 Commonwealth Drive, Warrendale, PA 15096 SAE J-1928, Devices Providing Backfire Flame Control for Gasoline Engines in Marine...

14 CFR 99.45 - Alaska ADIZ.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Alaska ADIZ. 99.45 Section 99.45 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC... Zones § 99.45 Alaska ADIZ. The area is bounded by a line from 54°00′N; 136°00′W; 56°57′N; 144°00′W; 57...

14 CFR 99.13 - Transponder-on requirements.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Transponder-on requirements. 99.13 Section 99.13 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.13 Transponder-on...

14 CFR 99.7 - Special security instructions.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Special security instructions. 99.7 Section 99.7 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.7 Special...

45 CFR 99.25 - Evidence.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Evidence. 99.25 Section 99.25 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.25 Evidence. (a) Testimony. Testimony shall be given orally under...

22 CFR 99.1 - Definitions.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 99.1 Section 99.1 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES REPORTING ON CONVENTION AND NON-CONVENTION ADOPTIONS OF EMIGRATING CHILDREN § 99.1 Definitions. As used in this part, the term: (a) Convention means...

45 CFR 99.23 - Discovery.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Discovery. 99.23 Section 99.23 Public Welfare... DEVELOPMENT FUND Hearing Procedures § 99.23 Discovery. The Department, the Lead Agency, and any individuals or groups recognized as parties shall have the right to conduct discovery (including depositions) against...

Optical properties of ZnO, Zn{sub 0.99}Mn{sub 0.01}O nanopowders

Energy Technology Data Exchange (ETDEWEB)

Sokolov, V.I.; Yermakov, A.Ye.; Uimin, M.A.; Mysik, A.A.; Gruzdev, N.B. [Institute of Metal Physics UD RAS, S. Kovalevskaya Str. 18, 620041 Yekaterinburg (Russian Federation); Pustovarov, V.A. [Ural State Technical University, Mira Str. 19, 620002 Yekaterinburg (Russian Federation); Surikov, V.T. [Institute of Chemistry of Solid State, UD RAS, Pervomayskaya Str. 91, 620041 Yekaterinburg (Russian Federation)

2010-06-15

The photoluminescence and photoluminescence excitation spectra of Zn{sub 0.99}Mn{sub 0.01}O nanopowders are presented in this paper. Detected peaks at energies {Dirac_h}{omega} higher than the energy gap in the photoluminescence excitation spectra allow us to assume that the Zhang-Rice-like states in forbidden gap due to the strong exchange coupling between 3d localized spin and valence band holes are related with valence band states perturbed by strong p-d hybridization (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

21 CFR 99.1 - Scope.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Scope. 99.1 Section 99.1 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL DISSEMINATION OF INFORMATION ON UNAPPROVED/NEW USES FOR MARKETED DRUGS, BIOLOGICS, AND DEVICES General Information § 99.1 Scope. (a) This...

29 CFR 99.100 - Purpose.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Purpose. 99.100 Section 99.100 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS General § 99.100 Purpose. This part sets forth standards for obtaining consistency and uniformity among Federal agencies for the...

29 CFR 99.310 - Financial statements.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Financial statements. 99.310 Section 99.310 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditees § 99... have separate audits in accordance with § 99.500(a) and prepare separate financial statements. (b...

29 CFR 99.300 - Auditee responsibilities.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Auditee responsibilities. 99.300 Section 99.300 Labor Office... § 99.300 Auditee responsibilities. The auditee shall: (a) Identify, in its accounts, all Federal awards... the schedule of expenditures of Federal awards in accordance with § 99.310. (e) Ensure that the audits...

29 CFR 99.200 - Audit requirements.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Audit requirements. 99.200 Section 99.200 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.... Guidance on determining Federal awards expended is provided in § 99.205. (b) Single audit. Non-Federal...

45 CFR 99.13 - Place.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Place. 99.13 Section 99.13 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Preliminary Matters-Notice and Parties § 99.13 Place. The hearing shall be held in the city...

29 CFR 99.225 - Sanctions.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Sanctions. 99.225 Section 99.225 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.225 Sanctions. No audit costs may be charged to Federal awards when audits required by this part have not been...

29 CFR 99.405 - Management decision.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Management decision. 99.405 Section 99.405 Labor Office of... Agencies and Pass-through Entities § 99.405 Management decision. (a) General. The management decision shall... process available to the auditee. (b) Federal agency. As provided in § 99.400(a)(7), the cognizant agency...

29 CFR 99.510 - Audit findings.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Audit findings. 99.510 Section 99.510 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditors § 99.510 Audit... schedule of prior audit findings prepared by the auditee in accordance with § 99.315(b) materially...

29 CFR 99.505 - Audit reporting.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Audit reporting. 99.505 Section 99.505 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditors § 99.505 Audit... is required to report under § 99.510(a); (vii) An identification of major programs; (viii) The dollar...

29 CFR 99.320 - Report submission.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Report submission. 99.320 Section 99.320 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditees § 99.320... package pursuant to § 99.320(d)(2). (vii) A yes or no statement as to whether the auditee qualified as a...

29 CFR 99.230 - Audit costs.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Audit costs. 99.230 Section 99.230 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.230 Audit... years ending after December 31, 2003) and is thereby exempted under § 99.200(d) from having an audit...

A Novel Image Cryptosystem Based on S-AES and Chaotic Map

Directory of Open Access Journals (Sweden)

Bai Lan

2015-01-01

Full Text Available This paper proposes a novel scheme based on simplified advanced encryption standard (S-AES for image encryption. Modified Arnold Map applied as diffusion technique for an image, and the key and dynamic S-box of encryption is generated by PWLCM. The goal is to balance rapidity and security of encryption. Experimental implementation has been done. This light encryption scheme shows resistance against chosen-plaintext attack and is suitable for sensor networks and IoT.

The value of T1-weighted images in the differentiation between MS, white matter lesions, and subcortical arteriosclerotic encephalopathy (SAE)

Energy Technology Data Exchange (ETDEWEB)

Uhlenbrock, D.; Sehlen, S.

1989-07-01

The aim of the study was to define reliable criteria for the differentiation of MR imaging between patients with MS and with 'vascular' white matter lesions/SAE. We examined 35 patients with proven MS according to the Poser criteria and 35 patients with other white matter lesions and/or SAE. The result is that with MR a differentiation can be achieved provided that T1-weighted spin-echo sequences are included and the different pattern of distribution is considered. MS plaques are predominantly located in the subependymal region, vascular white matter lesions are mainly located in the water-shed of the superficial middle cerebral branches and the deep perforating long medullary vessels in the centrum semiovale. Infratentorial lesions are more often seen in MS. Confluence at the lateral ventricles is frequently accompanied by confluent abnormalities around the third ventricle, Sylvian aqueduct, and fourth ventricle, which is uncommon in SAE. In MS many lesions visible on T2-weighted images have a cellular or intracellular composition that renders them visible also on T1-weighted ones as regions with low signal intensity and more or less distinct boundary. 'Vascular' white matter lesions and SAE mainly represent demyelination and can therefore be seen on T2-weighted images, but corresponding low signal intensity lesions on T1-weighted images are uncommon. In some exceptions there are such lesions with low signal representing lacunar infarcts or widened Virchow-Robin-spaces. (orig.).

7 CFR 29.99 - Superseded certificate or sample.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Superseded certificate or sample. 29.99 Section 29.99 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS TOBACCO INSPECTION Regulations Appeal § 29.99 Superseded certificate or sample. When superseded...

45 CFR 99.31 - Posthearing briefs.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Posthearing briefs. 99.31 Section 99.31 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Posthearing Procedures, Decisions § 99.31 Posthearing briefs. The...

14 CFR 99.11 - ADIZ flight plan requirements.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false ADIZ flight plan requirements. 99.11 Section 99.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General § 99.11 ADIZ...

12 CFR 313.99 - Prohibited actions by employer.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Prohibited actions by employer. 313.99 Section 313.99 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE PROCEDURES FOR CORPORATE DEBT COLLECTION Administrative Wage Garnishment § 313.99 Prohibited actions by...

45 CFR 99.24 - Evidentiary purpose.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Evidentiary purpose. 99.24 Section 99.24 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.24 Evidentiary purpose. The purpose of the...

45 CFR 99.27 - Official transcript.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Official transcript. 99.27 Section 99.27 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.27 Official transcript. The Department will...

45 CFR 99.2 - Presiding officer.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Presiding officer. 99.2 Section 99.2 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND General § 99.2 Presiding officer. (a) (1) The presiding officer at a...

25 CFR 700.99 - Salvage value.

Science.gov (United States)

2010-04-01

... 25 Indians 2 2010-04-01 2010-04-01 false Salvage value. 700.99 Section 700.99 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION COMMISSION OPERATIONS AND RELOCATION PROCEDURES General Policies and Instructions Definitions § 700.99 Salvage value. Salvage value means the probable sale price of an...

Safety of the malaria vaccine candidate, RTS,S/AS01E in 5 to 17 month old Kenyan and Tanzanian Children.

Directory of Open Access Journals (Sweden)

John Lusingu

2010-11-01

Full Text Available The malaria vaccine candidate, RTS,S/AS01(E, showed promising protective efficacy in a trial of Kenyan and Tanzanian children aged 5 to 17 months. Here we report on the vaccine's safety and tolerability. The experimental design was a Phase 2b, two-centre, double-blind (observer- and participant-blind, randomised (1∶1 ratio controlled trial. Three doses of study or control (rabies vaccines were administered intramuscularly at 1 month intervals. Solicited adverse events (AEs were collected for 7 days after each vaccination. There was surveillance and reporting for unsolicited adverse events for 30 days after each vaccination. Serious adverse events (SAEs were recorded throughout the study period which lasted for 14 months after dose 1 in Korogwe, Tanzania and an average of 18 months post-dose 1 in Kilifi, Kenya. Blood samples for safety monitoring of haematological, renal and hepatic functions were taken at baseline, 3, 10 and 14 months after dose 1. A total of 894 children received RTS,S/AS01(E or rabies vaccine between March and August 2007. Overall, children vaccinated with RTS,S/AS01(E had fewer SAEs (51/447 than children in the control group (88/447. One SAE episode in a RTS,S/AS01(E recipient and nine episodes among eight rabies vaccine recipients met the criteria for severe malaria. Unsolicited AEs were reported in 78% of subjects in the RTS,S/AS01(E group and 74% of subjects in the rabies vaccine group. In both vaccine groups, gastroenteritis and pneumonia were the most frequently reported unsolicited AE. Fever was the most frequently observed solicited AE and was recorded after 11% of RTS,S/AS01(E doses compared to 31% of doses of rabies vaccine. The candidate vaccine RTS,S/AS01(E showed an acceptable safety profile in children living in a malaria-endemic area in East Africa. More data on the safety of RTS,S/AS01(E will become available from the Phase 3 programme.

SAE 1045 steel/WC-Co/Ni-Cu-Ni/SAE 1045 steel joints prepared by dynamic diffusion bonding: Microelectrochemical studies in 0.6 M NaCl solution

International Nuclear Information System (INIS)

Andreatta, Francesco; Matesanz, Laura; Akita, Adriano H.; Paussa, Luca; Fedrizzi, Lorenzo; Fugivara, Cecilio S.; Gomez de Salazar, Jose M.; Benedetti, Assis V.

2009-01-01

Corrosion of SAE 1045 steel/WC-Co/Ni-Cu-Ni/SAE 1045 steel interfaces was investigated in 0.6 M NaCl solution using an electrochemical microcell, which enables local electrochemical characterization at the micrometer scale. Two pieces of steel, one with a WC-Co coating covered with Ni (12 μm) and Cu (5 μm) layers, and the other with a Ni (15 μm) layer, were welded by dynamic diffusion bonding. A WC-Co coating was applied to the steel by the high velocity oxygen-fuel process, and Ni-Cu and Ni layers by electroplating. Polarization curves were recorded using an electrochemical microcell. Different regions of welded samples were investigated, including steel, cermet coating, and steel/cermet and steel/Ni-Cu-Ni/cermet interfaces. Optical and electronic microscopes were employed to study the corroded regions. Potentiodynamic polarization curves obtained using the microcell revealed that the base metal was more susceptible to corrosion than the cermet. In addition, cermet steel/cermet and steel/Ni-Cu-Ni/cermet joints exhibited different breakdown potentials. Steel was strongly corroded in the regions adjacent to the interfaces, while the cermet was less corroded. Iron oxides/hydroxides and chloride salts were the main corrosion products of steel. After removal of the superficial layer of corrosion products, iron oxides were mainly observed. Chloride ions were detected mainly on a copper-enriched layer placed between two Ni-enriched layers.

29 CFR 99.235 - Program-specific audits.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Program-specific audits. 99.235 Section 99.235 Labor Office... § 99.235 Program-specific audits. (a) Program-specific audit guide available. In many cases, a program... schedule of prior audit findings consistent with the requirements of § 99.315(b), and a corrective action...

12 CFR 9.9 - Audit of fiduciary activities.

Science.gov (United States)

2010-01-01

... commensurate with the nature and risk of that activity. Thus, certain fiduciary activities may receive audits... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Audit of fiduciary activities. 9.9 Section 9.9... NATIONAL BANKS Regulations § 9.9 Audit of fiduciary activities. (a) Annual audit. At least once during each...

Enhancement of surface properties of SAE 1020 by chromium plasma immersion recoil implantation

International Nuclear Information System (INIS)

Ueda, M.; Mello, C.B.; Beloto, A.F.; Rossi, J.O.; Reuther, H.

2007-01-01

SAE 1020 steel is commonly used as concrete reinforcement and small machine parts, but despite its good mechanical properties, as ductility, hardness and wear resistance, it is susceptible to severe corrosion. It is well known that chromium content above 12% in Fe alloys increases their corrosion resistance. In order to obtain this improvement, we studied the introduction of chromium atoms into the matrix of SAE 1020 steel by recoil implantation process using a plasma immersion ion implantation (PIII) system. Potentiodynamic scans showed that the presence of Cr film leads to a gain in the corrosion potential, from -650 mV to -400 mV. After PIII treatment, the corrosion potential increased further to -340 mV, but the corrosion current density presented no significant change. Vickers microhardness tests showed surface hardness increase of up to about 27% for the treated samples. Auger electron spectroscopy showed that, for a 30 nm film, Cr was introduced for about 20 nm into the steel matrix. Tribology tests, of pin-on-disk type, showed that friction coefficient of treated samples was reduced by about 50% and a change in wear mechanism, from adhesive to abrasive mode, occurred

Room temperature fatigue behaviour of a normalized steel SAE 4140 in torsion

International Nuclear Information System (INIS)

Klumpp, S.; Eifler, D.; Macherauch, E.

1990-01-01

Cyclic deformation behaviour of a normalized steel SAE 4140 in shear strain-controlled torsion is characterized by cyclic softening and cyclic hardening. If mean shear stresses are superimposed to an alternating shear stress, cycle-dependent creep occurs, and the number of cycles to failure decreases. In shear strain-controlled torsional loading, mean stresses are observed to relax nearly to zero within a few cycles. Fatigue life is not influenced by mean shear strains. (orig.) [de

45 CFR 99.14 - Issues at hearing.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Issues at hearing. 99.14 Section 99.14 Public... CHILD CARE AND DEVELOPMENT FUND Preliminary Matters-Notice and Parties § 99.14 Issues at hearing. (a... parties other than the Department and the Lead Agency (see § 99.15(b)) with written notice of the...

7 CFR 800.99 - Checkweighing sacked grain.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Checkweighing sacked grain. 800.99 Section 800.99 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS Weighing...

47 CFR 80.99 - Radiotelegraph station identification.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Radiotelegraph station identification. 80.99 Section 80.99 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO...-General § 80.99 Radiotelegraph station identification. This section applies to coast, ship and survival...

22 CFR 9.9 - Declassification and downgrading.

Science.gov (United States)

2010-04-01

... substantive or procedural right subject to judicial review. (e) Public dissemination of declassified... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Declassification and downgrading. 9.9 Section 9.9 Foreign Relations DEPARTMENT OF STATE GENERAL SECURITY INFORMATION REGULATIONS § 9.9...

45 CFR 99.32 - Decisions following hearing.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Decisions following hearing. 99.32 Section 99.32 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Posthearing Procedures, Decisions § 99.32 Decisions following...

32 CFR 99.5 - Eligibility for indemnification.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Eligibility for indemnification. 99.5 Section 99.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.5 Eligibility for...

45 CFR 99.26 - Unsponsored written material.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Unsponsored written material. 99.26 Section 99.26 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.26 Unsponsored written material. Letters...

Comparison of Data on Serious Adverse Events and Mortality in ClinicalTrials.gov, Corresponding Journal Articles, and FDA Medical Reviews: Cross-Sectional Analysis.

Science.gov (United States)

Pradhan, Richeek; Singh, Sonal

2018-04-11

Inconsistencies in data on serious adverse events (SAEs) and mortality in ClinicalTrials.gov and corresponding journal articles pose a challenge to research transparency. The objective of this study was to compare data on SAEs and mortality from clinical trials reported in ClinicalTrials.gov and corresponding journal articles with US Food and Drug Administration (FDA) medical reviews. We conducted a cross-sectional study of a randomly selected sample of new molecular entities approved during the study period 1 January 2013 to 31 December 2015. We extracted data on SAEs and mortality from 15 pivotal trials from ClinicalTrials.gov and corresponding journal articles (the two index resources), and FDA medical reviews (reference standard). We estimated the magnitude of deviations in rates of SAEs and mortality between the index resources and the reference standard. We found deviations in rates of SAEs (30% in ClinicalTrials.gov and 30% in corresponding journal articles) and mortality (72% in ClinicalTrials.gov and 53% in corresponding journal articles) when compared with the reference standard. The intra-class correlation coefficient between the three resources was 0.99 (95% confidence interval [CI] 0.98-0.99) for SAE rates and 0.99 (95% CI 0.97-0.99) for mortality rates. There are differences in data on rates of SAEs and mortality in randomized clinical trials in both ClinicalTrials.gov and journal articles compared with FDA reviews. Further efforts should focus on decreasing existing discrepancies to enhance the transparency and reproducibility of data reporting in clinical trials.

45 CFR 99.12 - Time of hearing.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Time of hearing. 99.12 Section 99.12 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Preliminary Matters-Notice and Parties § 99.12 Time of hearing. The...

32 CFR 99.1 - Scope and purpose.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Scope and purpose. 99.1 Section 99.1 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.1 Scope and purpose. (a) The Department...

32 CFR 99.9 - Terms of indemnification.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Terms of indemnification. 99.9 Section 99.9 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.9 Terms of indemnification. The terms of...

45 CFR 99.28 - Record for decision.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Record for decision. 99.28 Section 99.28 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.28 Record for decision. The transcript of...

45 CFR 99.22 - Rights of parties.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Rights of parties. 99.22 Section 99.22 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.22 Rights of parties. All parties may: (a...

21 CFR 99.105 - Recipients of information.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Recipients of information. 99.105 Section 99.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL... Disseminated § 99.105 Recipients of information. A manufacturer disseminating information on a new use under...

14 CFR 99.43 - Contiguous U.S. ADIZ.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Contiguous U.S. ADIZ. 99.43 Section 99.43 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC... Zones § 99.43 Contiguous U.S. ADIZ. The area bounded by a line from 43°15′N, 65°55′W; 44°21′N; 67°16′W...

SAES St 909 pilot scale methane cracking tests

International Nuclear Information System (INIS)

Klein, J. E.; Sessions, H. T.

2008-01-01

Pilot scale (0.5 kg) SAES St 909 methane cracking tests were conducted for potential tritium process applications. Up to 1400 hours tests were done at 700 deg.C, 202.7 kPa (1520 torr) with a 0.03 sLPM feed of methane plus impurities, in a 20 vol% hydrogen, balance helium, stream. Carbon dioxide gettered by St 909 can be equated to an equivalent amount of methane gettered, but equating nitrogen to an equivalent amount of methane was nitrogen feed composition dependent. A decreased hydrogen feed increased methane getter rates while a 30 deg.C drop in one furnace zone increased methane emissions by over a factor of 30. The impact of gettered nitrogen can be somewhat minimized if nitrogen feed to the bed has been stopped and sufficient time given to recover the methane cracking rate. (authors)

12 CFR 263.99 - Petition for reinstatement.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Petition for reinstatement. 263.99 Section 263... SYSTEM RULES OF PRACTICE FOR HEARINGS Practice Before the Board § 263.99 Petition for reinstatement. The Board may entertain a petition for reinstatement from any person debarred from practice before the Board...

29 CFR 99.220 - Frequency of audits.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Frequency of audits. 99.220 Section 99.220 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.220 Frequency of audits. Except for the provisions for biennial audits provided in paragraphs (a) and...

29 CFR 99.515 - Audit working papers.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Audit working papers. 99.515 Section 99.515 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Auditors § 99.515 Audit working papers. (a) Retention of working papers. The auditor shall retain working papers and...

45 CFR 99.4 - Suspension of rules.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Suspension of rules. 99.4 Section 99.4 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND General § 99.4 Suspension of rules. With notice to all parties, the...

Modeling of the flow behavior of SAE 8620H combing microstructure evolution in hot forming

Science.gov (United States)

Fu, Xiaobin; Wang, Baoyu; Tang, Xuefeng

2017-10-01

With the development of net-shape forming technology, hot forming process is widely applied to manufacturing gear parts, during which, materials suffer severe plastic distortion and microstructure changes continually. In this paper, to understand and model the flow behavior and microstructure evolution, SAE 8620H, a widely used gear steel, is selected as the object and the flow behavior and microstructure evolution are observed by an isothermal hot compression tests at 1273-1373 K with a strain rate of 0.1-10 s-1. Depending on the results of the compression test, a set of internal-state-variable based unified constitutive equations is put forward to describe the flow behavior and microstructure evaluation of SAE 8620H. Moreover, the evaluation of the dislocation density and the fraction of dynamic recrystallization based on the theory of thermal activation is modeled and reincorporated into the constitutive law. The material parameters in the constitutive model are calculated based on the measured flow stress and dynamic recrystallization fraction. The predicted flow stress under different deformation conditions has a good agreement with the measured results.

29 CFR 99.315 - Audit findings follow-up.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Audit findings follow-up. 99.315 Section 99.315 Labor Office... § 99.315 Audit findings follow-up. (a) General. The auditee is responsible for follow-up and corrective... include the reference numbers the auditor assigns to audit findings under § 99.510(c). Since the summary...

45 CFR 99.1 - Scope of rules.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Scope of rules. 99.1 Section 99.1 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND General § 99.1 Scope of rules. (a) The rules of procedure in this section govern the practice...

COMPUTATIONAL FLOW MODELLING OF FORMULA-SAE SIDEPODS FOR OPTIMUM RADIATOR HEAT MANAGEMENT

Directory of Open Access Journals (Sweden)

C. M. DE SILVA

2011-02-01

Full Text Available Formula SAE vehicles, over the program’s history have showcased a myriad of aerodynamic packages, each claiming specific quantitative and qualitative features. This paper attempts to critique differing aerodynamic sidepod designs and their effect upon radiator heat management. Various features from inlet size, sidepod shape and size, presence of an undertray, suspension cover, gills and chimneys are analysed for their effects. Computational Fluid Dynamics (CFD analyses are performed in the FLUENT environment, with the aid of GAMBIT meshing software and SolidWorks modelling.

30 CFR 7.99 - Critical characteristics.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Critical characteristics. 7.99 Section 7.99 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND... characteristics. The following critical characteristics shall be inspected or tested on each diesel power package...

42 CFR 9.9 - Facility staffing.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Facility staffing. 9.9 Section 9.9 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS STANDARDS OF CARE FOR... Biosafety Officer must have experience in developing and monitoring biohazards and dealing with biosafety...

29 CFR 99.305 - Auditor selection.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Auditor selection. 99.305 Section 99.305 Labor Office of the... Auditor selection. (a) Auditor procurement. In procuring audit services, auditees shall follow the... reviews, and price. (b) Restriction on auditor preparing indirect cost proposals. An auditor who prepares...

Application of digital image processing to determine the causes of failures in SAE 1018 carbon steel; Aplicacion del procesamiento digital de imagenes para la determinacion de las causas que provocan fallas en el acero al carbono SAE 1018

Energy Technology Data Exchange (ETDEWEB)

Bolanos-Rodriguez, E [Escuela Superior de Tizayuca, Universidad Autonoma del Estado de Hidalgo, Tizayuca, Hidalgo (Mexico)]. E-mail: bola7112@yahoo.com.mx; Gonzalez-Islas, J.C. [Universidad Tecnologica de Tulancingo, Tulancingo, Hidalgo (Mexico)]. E-mail: juanc.gonzalez@utec-tgo.edu.mx; Felipe-Riveron, E.M. [Centro de Investigacion en Computacion, Instituto Politecnico Nacional, Mexico, D.F. (Mexico)]. E-mail: edgardo@cic.ipn.mx

2013-03-15

The research is focused on determining the causes of failures in the SAE 1018 carbon steel that is used in pipes carrying drinking water. Digital processing of images captured by photomicrographs by scanning electron microscopy coupled with the technique of X-ray microanalysis. The results demonstrate that the low quality of the raw materials and the manufacturing process of steel are the reasons for the occurrence of cracks observed in the material. [Spanish] La investigacion se centra en determinar las causas que provocan fallas en el acero al carbono SAE 1018 que es utilizado en tuberias que transportan agua potable. Se emplea el procesamiento digital de imagenes de las microfotografias captadas por medio de microscopia electronica de barrido, unido a la tecnica de microanalisis de rayos X. Los resultados obtenidos demuestran que la baja calidad de las materias primas y el proceso de manufactura del acero son las razones de la ocurrencia de fisuras observadas en el material.

Serviço de assistência especializada (SAE: uma experiência profissional

Directory of Open Access Journals (Sweden)

Carla Glenda Souza da Silva

Full Text Available O trabalho visa a discutir o processo de implantação e operacionalização de um serviço de assistência especializada (SAE, que objetiva vincular o usuário portador do vírus HIV/Aids à equipe multiprofissional através da descrição de experiência profissional. Alcançou-se a implantação e operacionalização do SAE com a implementação de uma política de assistência voltada para o bem-estar, a humanização e a qualidade de vida do usuário. A implantação do serviço permitiu garantir a resolutividade, a eqüidade e a integralidade dos serviços no Município de Cabedelo, bem como a ampliação do processo de descentralização da atenção, conforme orienta a política institucional do SUS no Brasil, mesmo enfrentando dificuldades de ordem política, econômica e estrutural local. A cidade possui uma população de 47.076 habitantes. Há oitenta e seis casos de Aids notificados no período de jun./85 a fev./05. É um Município predominantemente urbano, litorâneo, portuário, é rota de caminhoneiros, possui um ferry boat, e apresenta elevado índice de prostituição.

Diseño de manguetas delanteras y posteriores de un vehículo monoplaza para la competición en la formula SAE

OpenAIRE

Mejía González, David Santiago

2015-01-01

En este trabajo de investigación se describe y aplica el proceso genérico de desarrollo de nuevos productos para el diseño de las manguetas delanteras y posteriores para un vehículo de competencia F-SAE. Que cumpla con las características de funcionamiento y las normas técnicas que dicta el reglamento emitido por los organizadores de la competencia F-SAE 2014. This research describes and applies the generic process of developing new products for the design of the front and rear uprights fo...

19 CFR 12.99 - Procedures for permitted entry.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Procedures for permitted entry. 12.99 Section 12.99 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Switchblade Knives § 12.99 Procedures for permitted entry...

45 CFR 99.21 - Authority of presiding officer.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Authority of presiding officer. 99.21 Section 99.21 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.21 Authority of presiding officer...

49 CFR 38.99 - Floors, steps and thresholds.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Floors, steps and thresholds. 38.99 Section 38.99 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY SPECIFICATIONS FOR TRANSPORTATION VEHICLES Commuter Rail Cars and Systems § 38.99 Floors, steps and thresholds...

29 CFR 99.210 - Subrecipient and vendor determinations.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Subrecipient and vendor determinations. 99.210 Section 99.210 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.210 Subrecipient and vendor determinations. (a) General. An auditee may be a recipient...

45 CFR 99.3 - Records to be public.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Records to be public. 99.3 Section 99.3 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND General § 99.3 Records to be public. All pleadings, correspondence...

Supplementary information

Indian Academy of Sciences (India)

Supplementary information. Flexible synthesis of isomeric pyranoindolones and evaluation of cytotoxicity towards HeLa cells. J C JEYAVEERANa, CHANDRASEKAR PRAVEEN*,b, Y ARUNc, A A M PRINCEa and P. T PERUMALc. aDepartment of Chemistry, Ramakrishna Mission Vivekananda College, Mylapore, Chennai.

29 CFR 2570.99 - Review by the Secretary.

Science.gov (United States)

2010-07-01

... 29 Labor 9 2010-07-01 2010-07-01 false Review by the Secretary. 2570.99 Section 2570.99 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(5) § 2570.99 Review by the Secretary. (a) The Secretary may review a decision of an...

27 CFR 19.99 - Spirits in customs custody.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Spirits in customs custody. 19.99 Section 19.99 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Conveyance of Spirits Or Wines on Plant Premises § 19.99 Spirits in customs custody. Spirits in customs...

29 CFR 99.215 - Relation to other audit requirements.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Relation to other audit requirements. 99.215 Section 99.215... Audits § 99.215 Relation to other audit requirements. (a) Audit under this part in lieu of other audits... audited as a major program using the risk-based audit approach described in § 99.520 and, if not, the...

32 CFR 9.9 - Protection of State secrets.

Science.gov (United States)

2010-07-01

... FOR TRIALS BY MILITARY COMMISSIONS OF CERTAIN NON-UNITED STATES CITIZENS IN THE WAR AGAINST TERRORISM § 9.9 Protection of State secrets. Nothing in this part shall be construed to authorize disclosure of... 32 National Defense 1 2010-07-01 2010-07-01 false Protection of State secrets. 9.9 Section 9.9...

Diseño de un prototipo de volante para un vehículo tipo formula SAE mediante técnicas de optimización estructural

OpenAIRE

Picón Mejía, Jaime Andrés

2016-01-01

En este proyecto técnico se presenta una metodología para el diseño y construcción de un prototipo de volante de dirección para un vehículo tipo formula SAE, aplicando técnicas de optimización estructural considerando procesos de manufactura aditiva. In this technical project, a methodology is presented for the design and construction of a prototype steering wheel for a Formula SAE vehicle, using structural optimization techniques considering additive manufacturing processes.

Supplementary data:

Indian Academy of Sciences (India)

charissa

Supplementary data: Table 1. Oligonucleotide primers used for SNP verification by Sanger sequencing. Oligo. 5' – 3' sequence. Product size (bp). Annealing temperature (°C). katG_L gccggtcaagaagaagtacg. 591. 67. katG_R ctcttcgtcagctcccactc. rpoB_La ctgatccaaaaccagatccg. 440. 64. rpoB_Ra tacacgatctcgtcgctaac.

12038_2016_9620_Supplementary 1..3

Indian Academy of Sciences (India)

lactamases and integron-bearing gut bacteria. Supplementary material. Supplementary table 1. Prevalence of resistance factors in the bacterial strains isolated from Tilapia gut. Isolate code. Identification. IntI1. IntI2. blaSHV. blaOXA aac(6')-Ib-cr.

Evidence of the pitting corrosion induced embrittlement of the structural steel SAE 8620

International Nuclear Information System (INIS)

Atanazio Filho, Nelson do Nascimento; Mansur, Tanius Rodrigues; Rabello, Emerson Giovani

2007-01-01

The influence of an aggressive environment (NaCl 3.5% aerated solution) on fatigue crack initiation and crack growth behavior were studied. This study comprised corrosion fatigue tests using specimens of SAE 8620 steel. The decreasing cyclic frequency (60 Hz to 11.7 Hz) effect on corrosion fatigue crack initiation behavior was examined. The tests carried out under rotating-bending loading conditions at 11.7 Hz (700 rpm), showed that pitting corrosion caused by anodic attack was responsible for corrosion fatigue crack initiation (author)

Influence of the electrolyte in the fixation of {sup 99} Mo in hydroxyapatite as matrix of the {sup 99} Mo/ {sup 99m} Tc generator; Influencia del electrolito en la fijacion de {sup 99} Mo en hidroxiapatita coma matriz del generador {sup 99} Mo/ {sup 99m} Tc

Energy Technology Data Exchange (ETDEWEB)

Vazquez G, S.; Badillo A, V.E. [UAZ, Zacatecas (Mexico); Monroy G, F. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: s_vazgro@hotmail.com

2005-07-01

The more used isotope at the moment in the services of nuclear medicine in the world is the technetium-99m. The {sup 99m} Tc emitts gamma rays of 141 keV and it semi disintegration period is of six hours, given it short half life, to produce it is necessary to order generators that are systems that allow to separate periodically at the {sup 99m}Tc of the {sup 99} Mo by means of chromatographic techniques. In this work it is sought to evaluate the use of the hydroxyapatite, to separate molybdates {sup 99} MoO{sub 4}{sup 2} of pertechnetates {sup 99m}TcO{sub 4}{sup -} and to be able to determine if it is feasible their use for to build generators of {sup 99m} Tc. With this purpose preliminary tests to know the likeness of the hydroxyapatite for the molybdates in function of the pH value, in different solutions were carried out: one of NaCl 0.9%, NaCl 2% and CaCl{sub 2} 0.01 M. The obtained results in a NaCl 0.9% solution and at to 2% to different pH values of the solution, shows that the fixation of the molybdate ions (MoO{sub 4}{sup -2}) it is worthless to basic pH values of (9-11), as long as in solution of CaCI{sub 2} 0.01 M show a considerable retention of molybdate ions. (Author)

Behaviour of AISI-SAE 8615 steel in ferritic nitrocarburizing using urea-metanol

International Nuclear Information System (INIS)

Barrena, M.I.; Castro, A.

1998-01-01

The present work shows the behaviour of low carbon alloyed steels as AISI-SAE 8615, after a ferritic nitrocarburizing process. Nitrocarburizing takes place at 570 degree centigree for 3 h in an atmosphere by combustion of methanol and urea under different flow rates. Metallographic studies were performed by optical microscopy. Harness profiles were measured and carbon percentages were also analyzed by emission spectrometry in order to determine the extension of the nitrocarburizing process. Optimal flow conditions have been found. The influence of the flow rate on the nitrocarburizing layer thickness has been also studied. (Author) 12 refs

Magnesium-Molybate Compounds as Matrix for 99Mo/99mTc Generators

Directory of Open Access Journals (Sweden)

Fabiola Monroy-Guzman

2011-01-01

Full Text Available This work reports the preparation of a 99mTc generator based on conversion of 99Mo produced by neutron irradiation, into insoluble magnesium 99Mo-molybdates compounds as matrix. The effect of magnesium salt types and concentration, Mg:Mo molar ratios, pH of molybdate solutions, eluate volume as well as the addition order of molybdate and magnesium solutions’ influences on the final 99mTc were evaluated. Polymetalates and polymolybdates salts either crystallized or amorphous were obtained depending on the magnesium salt and Mg:Mo molar ratio used in matrix preparation. 99Mo/99mTc generator production based on magnesium-99Mo molybdate compounds allow reduction of preparation time and eliminates the use of specialized installations. The best generator performances were attained using matrices prepared from 0.1 mol/L MgCl2·6H2O solutions, ammonium molybdate solutions at pH 7 and at a Mg:Mo molar ratio of 1:1.

An essential role for trimethylguanosine RNA caps in Saccharomyces cerevisiae meiosis and their requirement for splicing of SAE3 and PCH2 meiotic pre-mRNAs.

Science.gov (United States)

Qiu, Zhicheng R; Shuman, Stewart; Schwer, Beate

2011-07-01

Tgs1 is the enzyme that converts m(7)G RNA caps to the 2,2,7-trimethylguanosine (TMG) caps characteristic of spliceosomal snRNAs. Fungi grow vegetatively without TMG caps, thereby raising the question of what cellular transactions, if any, are TMG cap-dependent. Here, we report that Saccharomyces cerevisiae Tgs1 methyltransferase activity is essential for meiosis. tgs1Δ cells are specifically defective in splicing PCH2 and SAE3 meiotic pre-mRNAs. The TMG requirement for SAE3 splicing is alleviated by two intron mutations: a UAUUAAC to UACUAAC change that restores a consensus branchpoint and disruption of a stem-loop encompassing the branchpoint. The TMG requirement for PCH2 splicing is alleviated by a CACUAAC to UACUAAC change restoring a consensus branchpoint and by shortening the PCH2 5' exon. Placing the SAE3 and PCH2 introns within a HIS3 reporter confers Tgs1-dependent histidine prototrophy, signifying that the respective introns are portable determinants of TMG-dependent gene expression. Analysis of in vitro splicing in extracts of TGS1 versus tgs1Δ cells showed that SAE3 intron removal was enfeebled without TMG caps, whereas splicing of ACT1 was unaffected. Our findings illuminate a new mode of tunable splicing, a reliance on TMG caps for an essential developmental RNA transaction, and three genetically distinct meiotic splicing regulons in budding yeast.

Influence of the electrolyte in the fixation of 99 Mo in hydroxyapatite as matrix of the 99 Mo/ 99m Tc generator

International Nuclear Information System (INIS)

Vazquez G, S.; Badillo A, V.E.; Monroy G, F.

2005-01-01

The more used isotope at the moment in the services of nuclear medicine in the world is the technetium-99m. The 99m Tc emitts gamma rays of 141 keV and it semi disintegration period is of six hours, given it short half life, to produce it is necessary to order generators that are systems that allow to separate periodically at the 99m Tc of the 99 Mo by means of chromatographic techniques. In this work it is sought to evaluate the use of the hydroxyapatite, to separate molybdates 99 MoO 4 2 of pertechnetates 99m TcO 4 - and to be able to determine if it is feasible their use for to build generators of 99m Tc. With this purpose preliminary tests to know the likeness of the hydroxyapatite for the molybdates in function of the pH value, in different solutions were carried out: one of NaCl 0.9%, NaCl 2% and CaCl 2 0.01 M. The obtained results in a NaCl 0.9% solution and at to 2% to different pH values of the solution, shows that the fixation of the molybdate ions (MoO 4 -2 ) it is worthless to basic pH values of (9-11), as long as in solution of CaCI 2 0.01 M show a considerable retention of molybdate ions. (Author)

Supplementary data:

Indian Academy of Sciences (India)

Acer

Supplementary data: Table 1. Collection localities of C. mystaceus in Thailand. Pop. Code N. Province. District. Region. 1. BRk. 9. Buri Ram. Krasang. Northeast. 2. CPm. 5. Chaiyaphum. Mueang. Northeast. 3. KKk. 5. Khon Kaen. Kranuan. Northeast. 4. KKm. 5. Khon Kaen. Mueang. Northeast. 5. KKu. 4. Khon Kaen.

Novel Aerodynamic Design for Formula SAE Vehicles

Science.gov (United States)

Sentongo, Samuel; Carter, Austin; Cecil, Christopher; Feier, Ioan

2017-11-01

This paper identifies and evaluates the design characteristics of a novel airfoil that harnesses the Magnus Effect, applying a moving-surface boundary-layer control (MSBC) method to a Formula SAE Vehicle. The MSBC minimizes adverse pressure gradient and delays boundary layer separation through the use of a conveyor belt that interacts with the airfoil boundary layer. The MSBC allows dynamic control of the aerodynamic coefficients by variation of the belt speed, minimizing drag in high speed straights and maximizing downforce during vehicle cornering. A conveyer belt wing measuring approximately 0.9 x 0.9m in planform was designed and built to test the mechanical setup for such a MSBC wing. This study follows the relationship between inputted power and outputted surface velocity, with the goal being to maximize speed output vs. power input. The greatest hindrance to maximizing speed output is friction among belts, rollers, and stationary members. The maximum belt speed achieved during testing was 5.9 m/s with a power input of 48.8 W, which corresponds to 45.8 N of downforce based on 2D CFD results. Ongoing progress on this project is presented. United States Air Force Academy.

21 CFR 99.101 - Information that may be disseminated.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Information that may be disseminated. 99.101 Section 99.101 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Information To Be Disseminated § 99.101 Information that may be disseminated. (a) A manufacturer may...

45 CFR 99.15 - Request to participate in hearing.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Request to participate in hearing. 99.15 Section 99.15 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Preliminary Matters-Notice and Parties § 99.15 Request to...

Relation of supplementary feeding to resumptions of menstruation and ovulation in lactating postpartum women.

Science.gov (United States)

Li, Wei; Qiu, Yi

2007-05-20

Resumption of menstrual cycles is one of the indicators for restoration of reproductive capability in postpartum women. However, menstruation does not necessarily mean that ovulation has taken place. The aim of this study was to investigate the relation of supplementary feeding to return of menstruation and ovulation after delivery. A questionnaire was used to obtain data from 101 breastfeeding mothers. The following elements were analyzed: age, education level, breastfeeding practice, time of return of menstruation, contraceptive practice, and starting time of supplementary feeding during the lactation at intervals of 6 weeks to 18 months after delivery. The ovulation was continuously monitored by ultrasonography and basal body temperature (BBT) measurement. By ultrasonography, 53 of the 101 women (52.5%) had the first ovulation (follicle > 1.8 cm in diameter) within 154 days after delivery on average, among whom 11 (10.9%, 11/101) had restoration of ovulation within 4 months and 42 (41.6%, 42/101) had it after 4 months. In women with follicles > 1.8 cm in diameter (n = 53), the menstruation resumed (138 +/- 84) days after delivery, and the supplementary feeding was started at (4.0 +/- 1.1) months, which were significantly earlier than those in the women with follicular diameter menstruation before the end of ultrasonographic monitoring, while only 8 in the women with follicular diameter menstruation (n = 100, r = 0.4764, P < 0.01) and first ovulation after delivery (n = 53, r = 0.5554, P < 0.01). In this series, no woman had pregnancy within 18 months postpartum. Supplementary feeding can affect the restoration of menstrual cycles and ovulation in lactating postpartum women.

Hepatic decompensation/serious adverse events in post-liver transplantation recipients on sofosbuvir for recurrent hepatitis C virus.

Science.gov (United States)

Patel, Neal; Bichoupan, Kian; Ku, Lawrence; Yalamanchili, Rachana; Harty, Alyson; Gardenier, Donald; Ng, Michel; Motamed, David; Khaitova, Viktoriya; Bach, Nancy; Chang, Charissa; Grewal, Priya; Bansal, Meena; Agarwal, Ritu; Liu, Lawrence; Im, Gene; Leong, Jennifer; Kim-Schluger, Leona; Odin, Joseph; Ahmad, Jawad; Friedman, Scott; Dieterich, Douglas; Schiano, Thomas; Perumalswami, Ponni; Branch, Andrea

2016-03-07

To determine the safety profile of new hepatitis C virus (HCV) treatments in liver transplant (LT) recipients with recurrent HCV infection. Forty-two patients were identified with recurrent HCV infection that underwent LT at least 12 mo prior to initiating treatment with a Sofosbuvir-based regimen during December 2013-June 2014. Cases were patients who experienced hepatic decompensation and/or serious adverse events (SAE) during or within one month of completing treatment. Controls had no evidence of hepatic decompensation and/or SAE. HIV-infected patients were excluded. Cumulative incidence of decompensation/SAE was calculated using the Kaplan Meier method. Exact logistic regression analysis was used to identify factors associated with the composite outcome. Median age of the 42 patients was 60 years [Interquartile Range (IQR): 56-65 years], 33% (14/42) were female, 21% (9/42) were Hispanic, and 9% (4/42) were Black. The median time from transplant to treatment initiation was 5.4 years (IQR: 2.1-8.8 years). Thirteen patients experienced one or more episodes of hepatic decompensation and/or SAE. Anemia requiring transfusion, the most common event, occurred in 62% (8/13) patients, while 54% (7/13) decompensated. The cumulative incidence of hepatic decompensation/SAE was 31% (95%CI: 16%-41%). Risk factors for decompensation/SAE included lower pre-treatment hemoglobin (OR = 0.61 per g/dL, 95%CI: 0.40-0.88, P < 0.01), estimated glomerular filtration rate (OR = 0.95 per mL/min per 1.73 m(2), 95%CI: 0.90-0.99, P = 0.01), and higher baseline serum total bilirubin (OR = 2.43 per mg/dL, 95%CI: 1.17-8.65, P < 0.01). The sustained virological response rate for the cohort of 42 patients was 45%, while it was 31% for cases. Sofosbuvir/ribavirin will continue to be used in the post-transplant population, including those with HCV genotypes 2 and 3. Management of anemia remains an important clinical challenge.

A simple and sensitive separation technique of 99Mo and 99mTc from their equilibrium mixture

International Nuclear Information System (INIS)

Swadesh Mandal; Ajoy Mandal

2014-01-01

The present work describes a simple and inexpensive separation method of 99 Mo from the equilibrium mixture. The liquid-liquid extraction technique has been employed to separate 99 Mo and 99m Tc using triisooctylamine (TIOA). The 99 Mo and 99m Tc were quantitatively separated out in 2 M TIOA with tripled distilled water; 99m Tc was back extracted from TIOA organic phase to aqueous phase by 0.1 M DTPA. The species information or indirect speciation of molybdenum was also established by the extraction profile of the molybdenum. (author)

Supplementary data:

Indian Academy of Sciences (India)

Plant Pathology

Supplementary data: Table 1. Identification of various virulence factors in R. solanacearum: Rs-09-161, Rs-10-244, GMI1000. Gene name Rs-09-161 locus tag*. Accession no. Rs-10-244 locus tag*. Accesion no. GMI1000 locus tag. Location. Gene description. Exopolysacharide. epsA. RALSO161_m00209880 KY661391 ...

45 CFR 99.5 - Filing and service of papers.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Filing and service of papers. 99.5 Section 99.5 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND General § 99.5 Filing and service of papers. (a) An original and...

Concrete with supplementary cementitious materials

OpenAIRE

Jensen, Ole M; Kovler, Konstantin; De Belie, Nele

2016-01-01

This volume contains the proceedings of the MSSCE 2016 conference segment on “Concrete with Supplementary Cementitious Materials” (SCM). The conference segment is organized by the RILEM technical committee TC 238-SCM: Hydration and microstructure of concrete with supplementary cementitious materials. TC 238-SCM started activities in 2011 and has about 50 members from all over the world. The main objective of the committee is to support the increasing utilisation of hydraulic...

Supplementary Material

Indian Academy of Sciences (India)

mraga

1. Supplementary Material. A soluble-lead Redox Flow Battery with corrugated graphite sheet and reticulated vitreous carbon as positive and negative current collectors by A Banerjee et al (pp 163-. 170). Figure S1. SEM images for bare substrates: (a) graphite sheet, (b) 20 ppi RVC, (c) 30 ppi. RVC and (d) 45 ppi RVC.

49 CFR 176.99 - Permit requirements for certain hazardous materials.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Permit requirements for certain hazardous materials. 176.99 Section 176.99 Transportation Other Regulations Relating to Transportation PIPELINE AND... CARRIAGE BY VESSEL Special Requirements for Barges § 176.99 Permit requirements for certain hazardous...

Effects of Rh on the thermoelectric performance of the p-type Zr0.5Hf0.5Co1-xRhxSb0.99Sn0.01 half-Heusler alloys

International Nuclear Information System (INIS)

Maji, Pramathesh; Takas, Nathan J.; Misra, Dinesh K.; Gabrisch, Heike; Stokes, Kevin; Poudeu, Pierre F.P.

2010-01-01

We show that Rh substitution at the Co site in Zr 0.5 Hf 0.5 Co 1-x Rh x Sb 0.99 Sn 0.01 (0≤x≤1) half-Heusler alloys strongly reduces the thermal conductivity with a simultaneous, significant improvement of the power factor of the materials. Thermoelectric properties of hot-pressed pellets of several compositions with various Rh concentrations were investigated in the temperature range from 300 to 775 K. The Rh 'free' composition shows n-type conduction, while Rh substitution at the Co site drives the system to p-type semiconducting behavior. The lattice thermal conductivity of Zr 0.5 Hf 0.5 Co 1-x Rh x Sb 0.99 Sn 0.01 alloys rapidly decreased with increasing Rh concentration and lattice thermal conductivity as low as 3.7 W/m*K was obtained at 300 K for Zr 0.5 Hf 0.5 RhSb 0.99 Sn 0.01 . The drastic reduction of the lattice thermal conductivity is attributed to mass fluctuation induced by the Rh substitution at the Co site, as well as enhanced phonon scattering at grain boundaries due to the small grain size of the synthesized materials. - Graphical abstract: Significant reduction of the lattice thermal conductivity with increasing Rh concentration in the p-type Zr 0.5 Hf 0.5 Co 1-x Rh x Sb 0.99 Sn 0.01 half-Heusler materials prepared by solid state reaction at 1173 K.

37 CFR 1.99 - Third-party submission in published application.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Third-party submission in published application. 1.99 Section 1.99 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND... Provisions Information Disclosure Statement § 1.99 Third-party submission in published application. (a) A...

Uma Metodologia para a avaliação dos gradientes de tenacidade à fratura ao longo da camada cementada do aço SAE 5115

OpenAIRE

Sandor,Leonardo Taborda; Ferreira,Itamar

2006-01-01

Este trabalho propõe um modelo para avaliar pontualmente as variações de tenacidade à fratura ao longo da camada cementada de um aço SAE 5115. A pequena espessura dessas camadas impede a retirada de corpos de prova nas dimensões especificadas pelas normas de ensaios de tenacidade à fratura. Assim, para simular uma camada cementada retirou-se corpos-de-prova de tração e de tenacidade à fratura de amostras de aços SAE 5115, 5140, 5160 e 52100 assumindo a influência local apenas da variação do t...

Case depth in SAE 1020 steel using barkhausen noise

Directory of Open Access Journals (Sweden)

Alessandra Drehmer

2013-01-01

Full Text Available The most widely used thermochemical process for surface hardening of steels is case hardening. Using several different heat treatments, martensitic surface layers were formed on SAE 1020 steel into which carbon had been diffused. Case depths were measured by traditional destructive techniques. Barkhausen noise measurements were made and both the RMS Barkhausen pulse envelope and the fast Fourier transform (FFT were obtained from numerical calculation. The FFT amplitudes, functions of frequency, were associated with distance from the sample surface using the skin depth equation δ = 1/ (πfσµ½ , where f is the frequency of the electromagnetic wave, s is the electrical conductivity, and µ is the magnetic permeability. We define a normalized power index (NPI which can be used to estimate case depths. The NPI is discussed in relation to the sample microstructure and it is shown that the case depth is most easily determined when the magnetic properties of the surface layer and core are substantially different.

32 CFR 99.7 - Procedures for requesting an indemnification agreement.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Procedures for requesting an indemnification agreement. 99.7 Section 99.7 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.7...

45 CFR 99.33 - Effective date of Assistant Secretary's decision.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Effective date of Assistant Secretary's decision. 99.33 Section 99.33 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Posthearing Procedures, Decisions § 99.33...

37 CFR 2.99 - Application to register as concurrent user.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Application to register as concurrent user. 2.99 Section 2.99 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... Proceedings § 2.99 Application to register as concurrent user. (a) An application for registration as a lawful...

32 CFR 842.99 - Compromise, termination, and suspension of collection.

Science.gov (United States)

2010-07-01

... 32 National Defense 6 2010-07-01 2010-07-01 false Compromise, termination, and suspension of collection. 842.99 Section 842.99 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR... States (31 U.S.C. 3701, 3711-3719) § 842.99 Compromise, termination, and suspension of collection. This...

29 CFR 99.205 - Basis for determining Federal awards expended.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true Basis for determining Federal awards expended. 99.205 Section 99.205 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.205 Basis for determining Federal awards expended. (a) Determining Federal awards...

MuSAE: A European Project for the Diffusion of Energy and Environmental Planning in Small-Medium Sized Municipalities

Directory of Open Access Journals (Sweden)

Giorgio Baldinelli

2015-12-01

Full Text Available The basic idea of the EU LIFE+ 2011 project MuSAE (“Municipalities Subsidiarity for Actions on Energy”, code LIFE11 ENV/IT/000016 consists of transferring the skills and experience related to energy planning, acquired by the leading beneficiary, the Municipality of Perugia, to three small- or medium-sized Umbrian Municipalities (Marsciano, Umbertide and Lisciano Niccone. This transfer is aimed, among other objectives, at the drafting of the Municipal Energy and Environmental Plan (MEEP and the opening of an energy information office in each partner Municipality, in cooperation with CIRIAF and Umbria Region. The present paper provides a summary of MuSAE activities, analyzing the procedures and modalities of implementation of the various phases of the MEEPs, on the basis of the experience gained over the years through the collaboration with the Municipality of Perugia and adapted to smaller territories such as those represented by the other partner Municipalities. A summary of the dissemination activities and pilot projects is also presented, testifying the first concrete results of the planning activity developed by each administration within the project.

49 CFR 218.99 - Shoving or pushing movements.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Shoving or pushing movements. 218.99 Section 218... Derails § 218.99 Shoving or pushing movements. (a)(1) Each railroad shall adopt and comply with an... violated the requirements of this section. (2) The following requirements for shoving or pushing movements...

42 CFR 84.99 - Man tests; testing conditions; general requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Man tests; testing conditions; general requirements. 84.99 Section 84.99 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.99...

14 CFR 99.17 - Deviation from flight plans and ATC clearances and instructions.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Deviation from flight plans and ATC clearances and instructions. 99.17 Section 99.17 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... TRAFFIC General § 99.17 Deviation from flight plans and ATC clearances and instructions. (a) No pilot may...

34 CFR 99.5 - What are the rights of students?

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false What are the rights of students? 99.5 Section 99.5 Education Office of the Secretary, Department of Education FAMILY EDUCATIONAL RIGHTS AND PRIVACY General § 99.5 What are the rights of students? (a)(1) When a student becomes an eligible student, the rights...

Entrywise Squared Transforms for GAMP Supplementary Material

DEFF Research Database (Denmark)

2016-01-01

Supplementary material for a study on Entrywise Squared Transforms for Generalized Approximate Message Passing (GAMP). See the README file for the details.......Supplementary material for a study on Entrywise Squared Transforms for Generalized Approximate Message Passing (GAMP). See the README file for the details....

Targeting osteomyelitis with complete [99mTc]besilesomab and fragmented [99mTc]sulesomab antibodies: kinetic evaluations

International Nuclear Information System (INIS)

GRATZ, Stefan; KEMKE, Bendix; KEIZE, Patrik; KAMPEN, Wim U.; LUSTER, Markus; HÖFFKEN, Helmut

2016-01-01

The aim of this retrospective study was to compare the targeting of “pure” osteomyelitis (i.e., without surrounding soft tissue infection) by directly 99mTc-labelled complete immunoglobulin G (IgG) monoclonal antibody (MAb) ([99mTc]besilesomab) and by directly 99mTc-labelled fragment antigen-binding (FAb) MAb ([99mTc]sulesomab) in relation to their kinetic fate. A total of 73 patients with “pure” osteomyelitis were examined with [99mTc]besilesomab, (Scintimun®, IBA/CIS bio international, Saclay, France; N.=38) and [99mTc]sulesomab (LeukoScan®, Immunomedics Inc., Morris Plains, NJ, USA; N.=35). Kinetic data were deduced from whole-body and single-photon emission computed tomographic scans, performed 10 minutes to 24 hour p.i. (region-of-interest technique [ROI]). In targeting “pure” osteomyelitis, sensitivities at 1-4 hours were found to be higher for [99mTc]sulesomab (44% and 80% for [99mTc]besilesomab and [99mTc]sulesomab, respectively) but at significantly lower target/background (T/B) ratios than with [99mTc]besilesomab (1.8±0.3 versus 1.4±0.5 for [99mTc]besilesomab and [99mTc]sulesomab respectively; P<0.01). With [99mTc]besilesomab, there was a continuous osteomyelitis uptake over 24 hours, whereas with [99mTc]sulesomab, the maximal uptake occurred mostly within 1-4 hours, with subsequent clearance being slower for antigen-bound activity than for nonspecific background. Hence, diagnosis was possible mostly after 4h with [99mTc]sulesomab but often not before 24 hours with [99mTc]besilesomab, the later increasing significantly (P<0.01) in sensitivity (87% and 84% for [99mTc]besilesomab and [99mTc]sulesomab, respectively). These results show that the higher sensitivity of [99mTc]sulesomab in osteomyelitis targeting at earlier p.i. times does not rely on an increased antibody uptake but on a more rapid clearance of nonspecific background activity due to faster metabolism and excretion. Intact [99mTc]besilesomab show a slow, continuous uptake

Assessment of vascularity and permeability in brain tumor using SPECT and [sup 99m]Tc-DTPA-human serum albumin in relation to [sup 201]Tl SPECT

Energy Technology Data Exchange (ETDEWEB)

Nakagawara, Jyoji; Fukuoka, Seiji; Takahashi, Shuhei; Takahashi, Masaaki; Satoh, Katsuyasu; Suematsu, Katsumi; Nakamura, Jun-ichi (Nakamura Memorial Hospital, Sapporo (Japan))

1994-02-01

Single photon emission computed tomography (SPECT) using technetium-99m-DTPA-human serum albumin ([sup 99m]Tc-HSA-D) and thallium-201 chloride ([sup 201]Tl) was simultaneously performed on 25 patients with brain tumors; 10 with brain metastasis, 8 with astrocytoma (Gr. 3) and 7 with meningioma. The early image was obtained 10 minutes after [sup 99m]Tc-HSA-D (740 MBq) injection, and the delayed image was taken 5 hours after the injection. HSA-D index, based on the ratio of [sup 99m]Tc-HSA-D uptake in the tumor versus the cortical area, was calculated on each image, and compared with Tl index (tumor/contralateral cerebrum ratio). HSA-D delayed index was significantly greater than HSA-D early index in all tumor types (p<0.05 by the Wilcoxon ranked sign test). Linear correlation between HSA-D early index and HSA-D delayed index was significant in astrocytoma (GR. 3) (p<0.01) and meningioma (p<0.001), and a linear correlation between HSA-D delayed index and Tl index was significant in astrocytoma (Gr. 3) (p<0.05). It is concluded that HSA-D early index and delayed index could reflect tumor vascularity and permeability, respectively, and provide supplementary information for Tl index. (author).

34 CFR 99.4 - What are the rights of parents?

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false What are the rights of parents? 99.4 Section 99.4... § 99.4 What are the rights of parents? An educational agency or institution shall give full rights under the Act to either parent, unless the agency or institution has been provided with evidence that...

Novel cloning machine with supplementary information

International Nuclear Information System (INIS)

Qiu Daowen

2006-01-01

Probabilistic cloning was first proposed by Duan and Guo. Then Pati established a novel cloning machine (NCM) for copying superposition of multiple clones simultaneously. In this paper, we deal with the novel cloning machine with supplementary information (NCMSI). For the case of cloning two states, we demonstrate that the optimal efficiency of the NCMSI in which the original party and the supplementary party can perform quantum communication equals that achieved by a two-step cloning protocol wherein classical communication is only allowed between the original and the supplementary parties. From this equivalence, it follows that NCMSI may increase the success probabilities for copying. Also, an upper bound on the unambiguous discrimination of two nonorthogonal pure product states is derived. Our investigation generalizes and completes the results in the literature

Development of multi-element active aerodynamics for the formula sae car

Science.gov (United States)

Merkel, James Patrick

This thesis focuses on the design, development, and implementation of an active aerodynamics system on 2013 Formula SAE car. The aerodynamics package itself consists of five element front and rear wings as well as an under body diffuser. Five element wings produce significant amounts of drag which is a compromise between the cornering ability of the car and the acceleration capability on straights. The active aerodynamics system allows for the wing angle of attack to dynamically change their configuration on track based on sensory data to optimize the wings for any given scenario. The wings are studied using computational fluid dynamics both in their maximum lift configuration as well as a minimum drag configuration. A control system is then developed using an electro mechanical actuation system to articulate the wings between these two states.

Myocardial uptake of Tc-99m MDP in chronic renal failure with cardiomyopathy

International Nuclear Information System (INIS)

Kim, Seung Eun; Sohn, Hyung Sun; Chung, Yong An; Park, Young Ha; Kim, Sung Hoon; Chung, Soo Kyo

2000-01-01

A uremic patient on hemodialysis, who had concurrent cardiomyopathy showed intense myocardial uptake of 99m Tc-methylene diphosphonate (MDP). The presumed cause of uptake in the myocardium is metastatic calcification due to hypercalcemia secondary to the renal failure. However, supplementary mechanism caused by cardiomyopathy should be considered. We describe a case with bone tracer uptake in the myocardium in the absence of infarction in a patient with chronic renal failure.=20

19 CFR 200.735-117 - Supplementary statements.

Science.gov (United States)

2010-04-01

... under this section, each employee shall at all times avoid acquiring a financial interest that could... CONDUCT Provisions Governing Statements of Employment and Financial Interests § 200.735-117 Supplementary... and financial interests shall be reported in a supplementary statement as of June 30 each year. If no...

Supplementary contribution payable to the Health Insurance Scheme for spouses

CERN Multimedia

HR Department

2008-01-01

Staff members, fellows and pensioners are reminded that any change in their marital status, as well as any change in their spouse or registered partner’s income or health insurance cover, must be reported to CERN in writing within 30 calendar days, in accordance with Articles III 6.01 to 6.03 of the Rules of the CERN Health Insurance Scheme (CHIS). Such changes may affect the conditions of the spouse or registered partner’s membership of the CHIS or the payment of the supplementary contribution to it for the spouse or registered partner’s insurance cover. For more information see: http://cern.ch/chis/contribsupp.asp From 1.1.2008, the indexed amounts of the supplementary monthly contribution for the different monthly income brackets are as follows, expressed in Swiss francs: more than 2500 CHF and up to 4250 CHF: 134.- more than 4250 CHF and up to 7500 CHF: 234.- more than 7500 CHF and up to 10,000 CHF: 369.- more than 10,000 CHF: 470.- It is in the member of the ...

Clinical comparison of diisopropyl-IDA Tc 99m and diethyl-IDA Tc 99m for evaluation of the hepatobiliary system

International Nuclear Information System (INIS)

Klingensmith, W.C.; Fritzberg, A.R.; Spitzer, V.M.; Kuni, C.C.; Shanahan, W.S.

1981-01-01

Thirty-one patients with a wide range of hepatobiliary function and clinical diagnoses were studied with both diisopropyl-IDA Tc 99m and diethyl-IDA Tc 99m. Images were similar except for an increased liver-to-kidney ratio with diisopropyl-IDA Tc 99m (p less than 0.01) and a tendency toward an increased liver-to-background ratio at five minutes with diisopropyl-IDA Tc 99m (p greater than 0.05). Quantification of the relative hepatocyte extraction efficiency indicated a 16% higher extraction efficiency for diisopropyl-IDA Tc 99m (p greater than 0.05). Cumulative three-hour urine collections following injection demonstrated no significant difference in renal excretion in patients with normal total serum bilirubin levels. Both radiopharmaceuticals demonstrated increasing renal excretion with increasing total serum bilirubin levels; however, renal excretion of diisopropyl-IDA Tc 99m increased more slowly than excretion of diethyl-IDA Tc 99m (p less than 0.01). We conclude that, while the overall differences between these two radiopharmaceuticals are small, diisopropyl-IDA Tc 99m is superior because of a lower renal excretion rate in patients with decreased hepatocyte function

PENGARUH REGENERASI KOLOM ALUMINA ASAM TERHADAP RECOVERY DAN KUALITAS 99mTc HASIL EKSTRAKSI PELARUT MEK DARI 99Mo HASIL AKTIVASI NEUTRON

Directory of Open Access Journals (Sweden)

Adang H G

2017-01-01

Full Text Available ABSTRAK PENGARUH REGENERASI KOLOM ALUMINA ASAM TERHADAP RECOVERY DAN KUALITAS 99mTc HASIL EKSTRAKSI PELARUT MEK DARI 99Mo HASIL AKTIVASI NEUTRON. Melalui kerjasama antara PTRR-BATAN, Chiyoda dan JAEA Jepang telah dilakukan pemurnian 99mTc dari 99Mo hasil aktivasi neutron dengan menggunakan metode kromatografi kolom alumina asam terhadap hasil ekstraksi MEK (Metil Etil Keton. Pemurnian 99mTc dengan metode kolom alumina asam hanya dapat digunakan satu kali dan pemurnian berikutnya harus diganti dengan kolom baru. Hal ini dinilai kurang praktis dan juga memerlukan biaya yang mahal. Dalam penelitian ini dicoba penggunaan kolom alumina asam untuk pemurnian 99mTc lebih dari satu kali dengan melakukan proses regenerasi dengan cara melewatkan larutan HNO3 0,1N setiap kali proses pemurnian selesai. Penelitian ini bertujuan untuk mendapatkan larutan 99mTc yang dapat digunakan untuk penandaan kit radiofarmaka. Parameter yang diamati dalam penelitian ini adalah recovery, profil elusi, pH, kemurnian radiokimia dan kemurnian radionuklida (lolosan 99Mo. Hasil penelitian yang dilakukan selama 5 hari telah diperoleh pH ~5, recovery > 60 %, kemurnian radiokimia > 95 % dan lolosan 99Mo tidak terdeteksi. Dari hasil perlakuan terhadap kolom alumina asam dengan larutan HNO3 0,1 N disimpulkan bahwa kolom alumina asam tidak perlu diganti setiap hari. Kata kunci: 99mTc, 99Mo, MEK, kolom alumina asam, kemurnian radiokimia. ABSTRACT Purification of 99mTc from 99Mo activation using acidic alumina column chromatography system from MEK (Methyl Ethyl Keton extraction has been carried out through cooperation between PTRR - BATAN, Chiyoda and JAEA Japan. This method has a limitation that acidic alumina column for purification of 99mTc can be used only once, for the next purification acidic alumina column should be replaced with new column, so it is less practical and also requires high cost. This study aims to obtain a 99mTc solution can be use for labelling of a

45 CFR 99.11 - Notice of hearing or opportunity for hearing.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Notice of hearing or opportunity for hearing. 99.11 Section 99.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Preliminary Matters-Notice and Parties § 99...

Effect of particle size on the friction welding of Al2O3 reinforced 6160 Al alloy composite and SAE 1020 steel

International Nuclear Information System (INIS)

Hascalik, Ahmet; Orhan, Nuri

2007-01-01

The aim of this study is to investigate the feasibility of joining Al 2 O 3 reinforced Al alloy composite to SAE 1020 steel by rotational friction welding. The aluminum-based metal matrix composite (MMC) material containing 5, 10 and 15 vol% Al 2 O 3 particles with average particle sizes of 30 and 60 μm was produced by powder metallurgy technique. The integrity of the joints has been investigated by optical and scanning electron microscopy, while the mechanical properties assessment included microhardness and shear tests. Results indicated that Al/Al 2 O 3 composite could be joined to SAE 1020 steel by friction welding. However, it was pointed out that the quality of the joint was effected negatively with the increase in particle size and volume percentage of the oxide particles in the MMC

Benchmark tests for a Formula SAE Student car prototyping

Science.gov (United States)

Mariasiu, Florin

2011-12-01

Aerodynamic characteristics of a vehicle are important elements in its design and construction. A low drag coefficient brings significant fuel savings and increased engine power efficiency. In designing and developing vehicles trough computer simulation process to determine the vehicles aerodynamic characteristics are using dedicated CFD (Computer Fluid Dynamics) software packages. However, the results obtained by this faster and cheaper method, are validated by experiments in wind tunnels tests, which are expensive and were complex testing equipment are used in relatively high costs. Therefore, the emergence and development of new low-cost testing methods to validate CFD simulation results would bring great economic benefits for auto vehicles prototyping process. This paper presents the initial development process of a Formula SAE Student race-car prototype using CFD simulation and also present a measurement system based on low-cost sensors through which CFD simulation results were experimentally validated. CFD software package used for simulation was Solid Works with the FloXpress add-on and experimental measurement system was built using four piezoresistive force sensors FlexiForce type.

19 CFR 10.99 - Importation of ethyl alcohol for nonbeverage purposes.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Importation of ethyl alcohol for nonbeverage purposes. 10.99 Section 10.99 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... Provisions Ethyl Alcohol § 10.99 Importation of ethyl alcohol for nonbeverage purposes. (a) If claim is made...

Private Supplementary Tutoring in the Czech Republic

Science.gov (United States)

Štastný, Vít

2016-01-01

The study contributes to the literature on private supplementary tutoring by shedding light on this phenomenon in the Czech Republic. The aim of the paper is to identify the reasons for seeking out private supplementary tutoring and to assess the factors underlying its demand. In the representative sample of 1,265 senior upper-secondary school…

Comportamiento a fatiga del acero sae 4140 usando alta rugosidad superficial y ambiente corrosivo

OpenAIRE

CEBALLOS, WILSON FERNANDO; GÓMEZ, ADOLFO LEÓN; CORONADO, JOHN JAIRO

2010-01-01

En este artículo se presenta el estudio del comportamiento a fatiga del acero SAE 4140 en condiciones diferentes: superficie pulida (acabado espejo), ambiente corrosivo (jugo de caña de azúcar), alta rugosidad superficial (superficie equivalente a la encontrada típicamente en los ejes de molino de caña) y una condición que involucra la combinación de las dos últimas. Las anteriores condiciones están presentes en los ejes de maza de molino de caña de azúcar durante el proceso de molienda. Se r...

COMPORTAMIENTO A FATIGA DEL ACERO SAE 4140 USANDO ALTA RUGOSIDAD SUPERFICIAL Y AMBIENTE CORROSIVO

OpenAIRE

CEBALLOS, WILSON FERNANDO; GÓMEZ, ADOLFO LEÓN; CORONADO, JOHN JAIRO

2010-01-01

En este artículo se presenta el estudio del comportamiento a fatiga del acero SAE 4140 en condiciones diferentes: superficie pulida (acabado espejo), ambiente corrosivo (jugo de caña de azúcar), alta rugosidad superficial (superficie equivalente a la encontrada típicamente en los ejes de molino de caña) y una condición que involucra la combinación de las dos últimas. Las anteriores condiciones están presentes en los ejes de maza de molino de caña de azúcar durante el proceso de molienda. Se r...

Improving supplementary feeding in species conservation.

Science.gov (United States)

Ewen, John G; Walker, Leila; Canessa, Stefano; Groombridge, Jim J

2015-04-01

Supplementary feeding is often a knee-jerk reaction to population declines, and its application is not critically evaluated, leading to polarized views among managers on its usefulness. Here, we advocate a more strategic approach to supplementary feeding so that the choice to use it is clearly justified over, or in combination with, other management actions and the predicted consequences are then critically assessed following implementation. We propose combining methods from a set of specialist disciplines that will allow critical evaluation of the need, benefit, and risks of food supplementation. Through the use of nutritional ecology, population ecology, and structured decision making, conservation managers can make better choices about what and how to feed by estimating consequences on population recovery across a range of possible actions. This structured approach also informs targeted monitoring and more clearly allows supplementary feeding to be integrated in recovery plans and reduces the risk of inefficient decisions. In New Zealand, managers of the endangered Hihi (Notiomystis cincta) often rely on supplementary feeding to support reintroduced populations. On Kapiti island the reintroduced Hihi population has responded well to food supplementation, but the logistics of providing an increasing demand recently outstretched management capacity. To decide whether and how the feeding regime should be revised, managers used a structured decision making approach informed by population responses to alternative feeding regimes. The decision was made to reduce the spatial distribution of feeders and invest saved time in increasing volume of food delivered into a smaller core area. The approach used allowed a transparent and defendable management decision in regard to supplementary feeding, reflecting the multiple objectives of managers and their priorities. © 2014 The Authors. Conservation Biology published by Wiley Periodicals, Inc., on behalf of Society for

Thermodynamic Analysis of Supplementary-Fired Gas Turbine Cycles

DEFF Research Database (Denmark)

Elmegaard, Brian; Henriksen, Ulrik Birk; Qvale, Einar Bjørn

2002-01-01

This paper presents an analysis of the possibilities for improving the efficiency of an indirectly biomass-fired gas turbine (IBFGT) by supplementary direct gas-firing. The supplementary firing may be based on natural gas, biogas, or pyrolysis gas. {The interest in this cycle arise from a recent...... demonstration of a two-stage gasification process through construction of several plants.} A preliminary analysis of the ideal recuperated Brayton cycle shows that for this cycle any supplementary firing will have a marginal efficiency of unity per extra unit of fuel. The same result is obtained...

Study of the viability of hydroxyapatite as matrix of the generator 99 Mo/99m Tc

International Nuclear Information System (INIS)

Aguilar D, I.C.; Badillo A, V.E.; Monroy G, F.

2004-01-01

The generator more used in the nuclear medicine it is the generator 99 Mo / 99 Tc. The separation of 99 Mo and 99m Tc in the commercial generator is carried out on a column that contains alumina (Al 2 0 3 ). The adsorbent proposed in this investigation work, the hydroxyapatite, is an insoluble solid considered within of the fixers of anions more important. To evaluate the efficiency of the hydroxyapatite in the separation of the Mo and the Tc they were carried out preliminary tests to know the likeness of the one been accustomed to by the molybdate ions (MoO 4 -2 ) and the pertechnetate ions (Tc0 4 - ) in function of the value of the p H, in a solution of CaCI 2 0.01 M. For the study of the retention of the molybdate ion, it was used the radioisotope Mo-99 fission product, and for the pertechnetate ion it was used the Tc- 99 m radionuclide son of the Mo-99. The obtained results in a solution of CaCl 2 0.01 M to different values of p H of the solution, show that the fixation of the pertechnetate ions (TcO 4 - ) and the fixation of the molybdate ions (MoO 4 -2 ), they present very different behaviors in the hydroxyapatite. The results indicate that the synthetic hydroxyapatite BIO-RAD retains to the molybdate ion to values of lightly acid p H (5-6), being the retention of the pertechnetate practically worthless. (Author)

An Early Historical Examination of the Educational Intent of Supervised Agricultural Experiences (SAEs) and Project-Based Learning in Agricultural Education

Science.gov (United States)

Smith, Kasee L.; Rayfield, John

2016-01-01

Project-based learning has been a component of agricultural education since its inception. In light of the current call for additional emphasis of the Supervised Agricultural Experience (SAE) component of agricultural education, there is a need to revisit the roots of project-based learning. This early historical research study was conducted to…

Method of producing radioactive technetium-99M

International Nuclear Information System (INIS)

Karageozian, H.L.

1979-01-01

A chromatographic process of producing high purity and high yield radioactive Technetium-99m. A solution containing Molybdenum-99m and Technetium-99m is placed on a chromatographic column and eluted with a neutral solvent system comprising an organic solvent and from about 0.1 to less than about 10% of water or from about 1 to less than about 70% of a solvent selected from the group consisting of aliphatic alcohols having 1 to 6 carbon atoms. The eluted solvent system containing the Technetium-99m is then removed leaving the Technetium-99m as a dry, particulate residue

Study of the viability of hydroxyapatite as matrix of the generator {sup 99} Mo/{sup 99m} Tc; Estudio de la viabilidad de la hidroxiapatita como matriz del generador {sup 99} Mo/{sup 99m} Tc

Energy Technology Data Exchange (ETDEWEB)

Aguilar D, I.C.; Badillo A, V.E. [UAZ, Unidad Academica de Ciencias Quimicas, 98600 Guadalupe, Zacatecas (Mexico); Monroy G, F. [ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico)]. E-mail: itzelaguilar@hotmail.com

2004-07-01

The generator more used in the nuclear medicine it is the generator {sup 99} Mo / {sup 99} Tc. The separation of {sup 99}Mo and {sup 99m}Tc in the commercial generator is carried out on a column that contains alumina (Al{sub 2}0{sub 3}). The adsorbent proposed in this investigation work, the hydroxyapatite, is an insoluble solid considered within of the fixers of anions more important. To evaluate the efficiency of the hydroxyapatite in the separation of the Mo and the Tc they were carried out preliminary tests to know the likeness of the one been accustomed to by the molybdate ions (MoO{sub 4}{sup -2}) and the pertechnetate ions (Tc0{sub 4}{sup -}) in function of the value of the p H, in a solution of CaCI{sub 2} 0.01 M. For the study of the retention of the molybdate ion, it was used the radioisotope Mo-99 fission product, and for the pertechnetate ion it was used the Tc- 99 m radionuclide son of the Mo-99. The obtained results in a solution of CaCl{sub 2} 0.01 M to different values of p H of the solution, show that the fixation of the pertechnetate ions (TcO{sub 4}{sup -}) and the fixation of the molybdate ions (MoO{sub 4}{sup -2}), they present very different behaviors in the hydroxyapatite. The results indicate that the synthetic hydroxyapatite BIO-RAD retains to the molybdate ion to values of lightly acid p H (5-6), being the retention of the pertechnetate practically worthless. (Author)

Main Determinants of Supplementary Health Insurance Demand: (Case of Iran)

Science.gov (United States)

Motlagh, Soraya Nouraei; Gorji, Hassan Abolghasem; Mahdavi, Ghadir; Ghaderi, Hossein

2015-01-01

Introduction: In the majority of developing countries, the volume of medical insurance services, provided by social insurance organizations is inadequate. Thus, supplementary medical insurance is proposed as a means to address inadequacy of medical insurance. Accordingly, in this article, we attempted to provide the context for expansion of this important branch of insurance through identification of essential factors affecting demand for supplementary medical insurance. Method: In this study, two methods were used to identify essential factors affecting choice of supplementary medical insurance including Classification and Regression Trees (CART) and Bayesian logit. To this end, Excel® software was used to refine data and R® software for estimation. The present study was conducted during 2012, covering all provinces in Iran. Sample size included 18,541 urban households, selected by Statistical Center of Iran using 3-stage cluster sampling approach. In this study, all data required were collected from the Statistical Center of Iran. Results: In 2012, an overall 8.04% of the Iranian population benefited from supplementary medical insurance. Demand for supplementary insurance is a concave function of age of the household head, and peaks in middle-age when savings and income are highest. The present study results showed greater likelihood of demand for supplementary medical insurance in households with better economic status, higher educated heads, female heads, and smaller households with greater expected medical expenses, and household income is the most important factor affecting demand for supplementary medical insurance. Conclusion: Since demand for supplementary medical insurance is hugely influenced by households’ economic status, policy-makers in the health sector should devise measures to improve households’ economic or financial access to supplementary insurance services, by identifying households in the lower economic deciles, and increasing their

14 CFR 151.99 - Modifications of programming standards.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Modifications of programming standards. 151... (CONTINUED) AIRPORTS FEDERAL AID TO AIRPORTS Project Programming Standards § 151.99 Modifications of programming standards. The Director, Airports, Service, or the Regional Director concerned may, on individual...

49 CFR 40.99 - How long does the laboratory retain specimens after testing?

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false How long does the laboratory retain specimens after testing? 40.99 Section 40.99 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Drug Testing Laboratories § 40.99 How...

Effects of supplementary lighting by natural light for growth of Brassica chinensis

Science.gov (United States)

Yeh, Shih-Chuan; Lee, Hui-Ping; Kao, Shih-Tse; Lu, Ju-Lin

2016-04-01

This paper present a model of cultivated chamber with supplementary natural colour light. We investigate the effects of supplementary natural red light and natural blue light on growth of Brassica chinensis under natural white light illumination. After 4 weeks of supplementary colour light treatment, the experiment results shown that the weight of fresh leaf were not affected by supplementary natural blue light. However, those Brassica chinensis were cultivated in the chambers with supplementary natural red light obtained a significant increasing of fresh weight of leaf under both white light illuminate models. The combination of natural white light with supplementary natural red light illumination will be benefits in growth for cultivation and energy saving.

Use and mis-use of supplementary material in science publications.

Science.gov (United States)

Pop, Mihai; Salzberg, Steven L

2015-11-03

Supplementary material is a ubiquitous feature of scientific articles, particularly in journals that limit the length of the articles. While the judicious use of supplementary material can improve the readability of scientific articles, its excessive use threatens the scientific review process and by extension the integrity of the scientific literature. In many cases supplementary material today is so extensive that it is reviewed superficially or not at all. Furthermore, citations buried within supplementary files rob other scientists of recognition of their contribution to the scientific record. These issues are exacerbated by the lack of guidance on the use of supplementary information from the journals to authors and reviewers. We propose that the removal of artificial length restrictions plus the use of interactive features made possible by modern electronic media can help to alleviate these problems. Many journals, in fact, have already removed article length limitations (as is the case for BMC Bioinformatics and other BioMed Central journals). We hope that the issues raised in our article will encourage publishers and scientists to work together towards a better use of supplementary information in scientific publishing.

29 CFR 99.530 - Criteria for a low-risk auditee.

Science.gov (United States)

2010-07-01

... management of Federal awards and provide a waiver. (c) There were no deficiencies in internal control which... periods) in which they were classified as Type A programs: (1) Internal control deficiencies which were... 29 Labor 1 2010-07-01 2010-07-01 true Criteria for a low-risk auditee. 99.530 Section 99.530 Labor...

Experimental analysis of residual stresses in pre-straightened SAE 1045 steel

Energy Technology Data Exchange (ETDEWEB)

Diehl, Carla Adriana Theis Soares; Rocha, Alexandre da Silva, E-mail: carla.adriana@ufrgs.br [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Laboratorio de Formacao de Metais; Epp, Jérémy; Zoch, Hans-Werner [Stiftung Institut für Werkstofftechnik IWT, University of Bremen (Germany)

2017-11-15

This paper aims at analyzing the effects of the roller pre-straightening of wire-rods on residual stress distributions in SAE 1045 steel bars. The combined drawing process is used in industrial production of bars in order to obtain a good surface quality and improved mechanical properties complying with specifications of the final products. In this process, prior to the drawing step, a roller straightening of the steel wire-rod is essential, because it provides the minimum straightness necessary for drawing. Metallographic analysis and hardness test were done for selected samples after different processing steps. Also, residual stress analysis of pre-straightened wire-rods by X-ray diffraction and neutron diffraction were carried out. The hardness tests show higher values near the surface and lower in the center of the wire-rod. Besides, the residual stresses results show a big inhomogeneity from one peripheral position to another and also in the evaluated cross section. (author)

Experimental analysis of residual stresses in pre-straightened SAE 1045 steel

International Nuclear Information System (INIS)

Diehl, Carla Adriana Theis Soares; Rocha, Alexandre da Silva

2017-01-01

This paper aims at analyzing the effects of the roller pre-straightening of wire-rods on residual stress distributions in SAE 1045 steel bars. The combined drawing process is used in industrial production of bars in order to obtain a good surface quality and improved mechanical properties complying with specifications of the final products. In this process, prior to the drawing step, a roller straightening of the steel wire-rod is essential, because it provides the minimum straightness necessary for drawing. Metallographic analysis and hardness test were done for selected samples after different processing steps. Also, residual stress analysis of pre-straightened wire-rods by X-ray diffraction and neutron diffraction were carried out. The hardness tests show higher values near the surface and lower in the center of the wire-rod. Besides, the residual stresses results show a big inhomogeneity from one peripheral position to another and also in the evaluated cross section. (author)

46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...

Probabilistic cloning with supplementary information

International Nuclear Information System (INIS)

Azuma, Koji; Shimamura, Junichi; Koashi, Masato; Imoto, Nobuyuki

2005-01-01

We consider probabilistic cloning of a state chosen from a mutually nonorthogonal set of pure states, with the help of a party holding supplementary information in the form of pure states. When the number of states is 2, we show that the best efficiency of producing m copies is always achieved by a two-step protocol in which the helping party first attempts to produce m-1 copies from the supplementary state, and if it fails, then the original state is used to produce m copies. On the other hand, when the number of states exceeds two, the best efficiency is not always achieved by such a protocol. We give examples in which the best efficiency is not achieved even if we allow any amount of one-way classical communication from the helping party

Technetium-99m scintigraphy associated with spondylolysis of the lumbar spine in children

International Nuclear Information System (INIS)

Kubota, Wataru; Sudo, Nariomi; Nakazima, Kiyonori; Nakamura, Mitsutaka

1987-01-01

Eight children with spondylolysis, aged from 10 to 18 years of age, underwent bone scanning with technetium-99m methylene diphosphonic acid. Radioisotope (RI) uptake was significantly observed in the site marked by the separation of the pars interarticularis, compared with the other sites between the articular processes. This showed the increase in metabolic activity of bones, providing supplementary information in the initial diagnosis. At the completion of conservative treatment, RI uptake decreased, being seemingly attributable to the improvement of subjective symptoms. Bone scanning may, however, be unhelpful in detecting synostosis. (Namekawa, K.)

Technetium-99m scintigraphy associated with spondylolysis of the lumbar spine in children

Energy Technology Data Exchange (ETDEWEB)

Kubota, W.; Sudo, N.; Nakazima, K.; Nakamura, M.

1987-02-01

Eight children with spondylolysis, aged from 10 to 18 years of age, underwent bone scanning with technetium-99m methylene diphosphonic acid. Radioisotope (RI) uptake was significantly observed in the site marked by the separation of the pars interarticularis, compared with the other sites between the articular processes. This showed the increase in metabolic activity of bones, providing supplementary information in the initial diagnosis. At the completion of conservative treatment, RI uptake decreased, being seemingly attributable to the improvement of subjective symptoms. Bone scanning may, however, be unhelpful in detecting synostosis.

Technetium-99m ceftizoxime kit preparation

International Nuclear Information System (INIS)

Diniz, Simone Odilia Fernandes; Siqueira, Cristiano Ferrari; Nelson, David Lee; Cardoso, Valbert Nascimento

2005-01-01

The aim of this work was to prepare a kit of 99 m Tc-ceftizoxime ( 99m Tc-CFT), with stability and biological activity preserved, able to identify a septic focus (E. coli) in the experimental infection model in rats. The preparation of the CFT kit involved the use of lyophilized solutions containing the antibiotic ceftizoxime and the sodium dithionite reducing agent (6.0 mg/m L). After lyophilization, the kit was reconstituted with 1.0 mL of sodium 99m Tc pertechnetate solution (Na 99m Tc O 4- ) with an activity of 370 MBq. The solution was boiled for 10 min and filtered through a cellulose ester filter. The labeling efficiency was on the order of 92%, remaining stable for six hours and the kit remained stable for two months. The biological activity of the 99m Tc-CFT was evaluated by diffusion in agar impregnated with E.coli and S. aureus. Seven Wistar rats, weighing from 200 to 250 g, were used for the development of the septic focus. After 24 hours from the induction of the infectious site (E.coli), the animals were anesthetized and 0.1 mL of 99m Tc-CFT (37 MBq) was injected into the tail veins of the animals. The images were obtained with a gamma camera one, two and six hours after injection and the regions of interest (ROIs) were calculated. The diameters of the inhibition halos for 99 m Tc-CFT were 27.16 ± 0.23 and 27.17 ± 0.20 for S.aureus and E.coli, respectively, while those for the unlabeled CFT were 30.4 ± 0.33 and 29.43 ± 0.26, respectively. The results for the biodistribution of 99m Tc-CFT in infected animals furnished a ratio of 1.97 ± 0.31, 2.10 ± 0.42 and 2.01 ± 0.42 for cpm-target/cpm-no target for the one, two and six-hour periods, respectively. The images showed a clear uptake of labeled antibiotic ( 99m Tc-CFT) by the infectious site during the experiment. The results attest to the viability of producing a kit with 99m technetium-labeled ceftizoxime for the investigation of infectious processes. (author)

Caffeine impairs resection during DNA break repair by reducing the levels of nucleases Sae2 and Dna2

Science.gov (United States)

Tsabar, Michael; Eapen, Vinay V.; Mason, Jennifer M.; Memisoglu, Gonen; Waterman, David P.; Long, Marcus J.; Bishop, Douglas K.; Haber, James E.

2015-01-01

In response to chromosomal double-strand breaks (DSBs), eukaryotic cells activate the DNA damage checkpoint, which is orchestrated by the PI3 kinase-like protein kinases ATR and ATM (Mec1 and Tel1 in budding yeast). Following DSB formation, Mec1 and Tel1 phosphorylate histone H2A on serine 129 (known as γ-H2AX). We used caffeine to inhibit the checkpoint kinases after DSB induction. We show that prolonged phosphorylation of H2A-S129 does not require continuous Mec1 and Tel1 activity. Unexpectedly, caffeine treatment impaired homologous recombination by inhibiting 5′ to 3′ end resection, independent of Mec1 and Tel1 inhibition. Caffeine treatment led to the rapid loss, by proteasomal degradation, of both Sae2, a nuclease that plays a role in early steps of resection, and Dna2, a nuclease that facilitates one of two extensive resection pathways. Sae2's instability is evident in the absence of DNA damage. A similar loss is seen when protein synthesis is inhibited by cycloheximide. Caffeine treatment had similar effects on irradiated HeLa cells, blocking the formation of RPA and Rad51 foci that depend on 5′ to 3′ resection of broken chromosome ends. Our findings provide insight toward the use of caffeine as a DNA damage-sensitizing agent in cancer cells. PMID:26019182

Evaluation of sup(99m)Tc-albumin dilution curve with simultaneous injection of sup(99m)Tc- and 131I-albumins

International Nuclear Information System (INIS)

Kinoshita, Masahiko; Kato, Shotaro; Motomura, Masakazu; Kawakita, Seiichi

1979-01-01

A critical comparison of radiocardiograms with sup(99m)Tc- and 131 I-albumins was made to determine whether or not sup(99m)Te-albumin can be used as a tracer for measuring blood volume (BV) and cardiac output (CO). Simultaneous injection of both isotopes was given to twenty-two patients to obtain radiocardiograms for each by means of a single scintillation counter with two pulse height analyzers. Such method allows for the determination of the energy levels for both sup(99m)Tc and 131 I. The radiocardiographic pattern was somewhat different between sup(99m)Tc- and 131 I-radiocardiograms: The ratio of left to right peak height was 16% on the average lower in the sup(99m)Tc-radiocardiogram than in the 131 I-one. The reason for the lower ratio is explained by greater absorption of sup(99m)Tc-radioactivity within the soft tissue interposing between the scintillation probe and heart. The values for sup(99m)Tc-derived blood volume were 7.4% on the average larger than those for 131 I-derived blood volume (p less than 0.01), although the correlation was excellent (r = 0.98 p less than 0.01). There was no systemic difference between cardiac output determined by sup(99m)Tc- and 131 I-albumins since the overestimation of blood volume can compensate for the underestimation of CO/BV by sup(99m)Tc-study. In view of its rapid extravasation, sup(99m)Tc-albumin is not so appropriate tracer for accurate measurements of BV and CO/BV, although it may be used for measurement of cardiac output. (author)

SUPPLEMENTARY INFORMATION Non-oxidative methane ...

Indian Academy of Sciences (India)

dell

SUPPLEMENTARY INFORMATION. Non-oxidative methane dehydroaromatization reaction over highly active α-MoC1-x ZSM-5 derived from pretreatment. BUDDE PRADEEP KUMAR, ARVIND KUMAR SINGH and SREEDEVI UPADHYAYULA*. Heterogeneous Catalysis & Reaction Engineering Laboratory, Department of ...

Bioleaching of Gold and Silver from Waste Printed Circuit Boards by Pseudomonas balearica SAE1 Isolated from an e-Waste Recycling Facility.

Science.gov (United States)

Kumar, Anil; Saini, Harvinder Singh; Kumar, Sudhir

2018-02-01

Indigenous bacterial strain Pseudomonas balearica SAE1, tolerant to e-waste toxicity was isolated from an e-waste recycling facility Exigo Recycling Pvt. Ltd., India. Toxicity tolerance of bacterial strain was analyzed using crushed (particle size ≤150 µm) waste computer printed circuit boards (PCBs)/liter (L) of culture medium. The EC 50 value for SAE1 was 325.7 g/L of the e-waste pulp density. Two-step bioleaching was then applied to achieve the dissolution of gold (Au) and silver (Ag) from the e-waste. To maximize precious metal dissolution, factors including pulp density, glycine concentration, pH level, and temperature were optimized. The optimization resulted in 68.5 and 33.8% of Au and Ag dissolution, respectively, at a pH of 9.0, a pulp density of 10 g/L, a temperature of 30 °C, and a glycine concentration of 5 g/L. This is the first study of Au and Ag bioleaching using indigenous e-waste bacteria and its analysis to determine e-waste toxicity tolerance.

21 CFR 1.99 - Costs chargeable in connection with relabeling and reconditioning inadmissible imports.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Costs chargeable in connection with relabeling and reconditioning inadmissible imports. 1.99 Section 1.99 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ENFORCEMENT REGULATIONS Imports and Exports § 1.99 Costs...

Studies of techniques for the post-elution concentration of 99mTc obtained from gel type 99Mo/99mTc generators

International Nuclear Information System (INIS)

Suzuki, Katia Noriko

2009-01-01

On average 80% of the radiopharmaceuticals used in Nuclear Medicine are labeled with 99 mTc due to its physical properties and easy attainment through of 99 Mo/ 99 mTc generators. The Directory of Radiopharmacy (DIRF) of IPEN-CNEN/SP developed a gel type chromatographic generator of MoZr with 99 Mo produced by 98 Mo(n,γ) 99 Mo reaction that occurs at the IEA-R1 Nuclear Reactor. The gel is composed of zirconium molybdate with elution volume of 12 mL with an activity of 11100 MBq (300 mCi) producing a radioactive concentration of 925 MBq (25 mCi)/mL. The fission generator gives a higher radioactive concentration around 1850 MBq (50 mCi)/mL. The aim of this work is to study a system of post-elution concentration of 99 mTc for the attainment of a high enough radioactive concentration to meet the demands of the market, with a proved quality. Two types of systems of post-elution concentration were developed: the single and the tandem. The most appropriate system for the gel generator of 99 Mo/ 99 mTc, being at the same time sterile and vacuum automated, was the tandem system using Dionex 2.5 cc/QMA cartridges. The gel generator is eluted with 10 mL of solution of 0.1% NaCl and the pertechnetate anion is retained in the QMA cartridge and further eluted with 4 mL of saline. The process takes no more than 30 minutes. The elution efficiency of the system of concentration was 90 %. At the beginning of 2009 a global crisis in the supply of 99 Mo took place making it necessary the development of alternative technologies for the production of 99 Mo/ 99 mTc generators using fission produced 99 Mo and the development of an appropriate method to extend the useful life of this generator. The results of this study showed that the same system developed for the post- concentration of the gel generator can be employed for the fission generator, using the tandem system, giving a concentration factor of 3 for the elution of 99 mTc. (author)

SUPPLEMENTARY INFORMATION Dimethylglyoxime as an ...

Indian Academy of Sciences (India)

lenovo

1. SUPPLEMENTARY INFORMATION. Dimethylglyoxime as an Efficient Ligand for Copper-Catalyzed Hydroxylation of Aryl. Halides. SURESH S SHENDAGE*. Department of Chemistry, KET'S Vinayak Ganesh Vaze College of Arts, Science and. Commerce, Mithagar Road, Mulund (E) Mumbai, Maharashtra 400 081, India.

The InSAeS4 Airborne X-Band Interferometric SAR System: A First Assessment on Its Imaging and Topographic Mapping Capabilities

Directory of Open Access Journals (Sweden)

Stefano Perna

2016-01-01

Full Text Available We present in this work a first assessment of the imaging and topographic mapping capabilities of the InSAeS4 system, which is a single-pass interferometric airborne X-Band Synthetic Aperture Radar (SAR. In particular, we first provide a brief description of the InSAeS4 sensor. Then, we discuss the results of our analysis on the SAR and interferometric SAR products relevant to the first flight-test campaign. More specifically, we have exploited as reference the GPS measurements relevant to nine Corner Reflectors (CRs deployed over the illuminated area during the campaign and a laser scanner Digital Elevation Model (DEM. From the analysis carried out on the CRs we achieved a mean geometric resolution, for the SAR products, of about 0.14 m in azimuth and 0.49 m in range, a positioning misalignment with standard deviation of 0.07 m in range and 0.08 m in azimuth, and a height error with standard deviation of 0.51 m. From the comparison with the laser scanner DEM we estimated a height error with standard deviation of 1.57 m.

Clinical application of 99mTc-DTPA-HSA

International Nuclear Information System (INIS)

Kawamura, Yasuaki; Yamazaki, Junichi; Okuzumi, Ichio

1989-01-01

A newly developed blood pool imaging agent, Tc-99m DTPA-HSA (Tc-99m HSA-D), was clinically assessed in blood pool studies of patients with heart disease. Twenty mCi of Tc-99m HSA-D was iv injected to the patients. Similarly, conventional Tc-99m HSA was injected one week later for comparison. Blood counts of Tc-99m HSA-D were significantly higher than those of Tc-99m HSA at 30 minutes after iv injection (p<0.01) and at one, 3, and 6 hours (p<0.001). For the heart, liver, and lungs, sequential counts of Tc-99m HSA-D were also significantly higher than those of Tc-99m HSA. Free Tc-99m uptake in the stomach, thyroid gland, and kidneys was higher on Tc-99m HSA images than Tc-99m HSA-D images. Hepatic and pulmonary uptake of free Tc-99m that were visualized on Tc-99m HSA-D did not influence the diagnostic ability. None of the patients had clinical toxicity of Tc-99m HSA-D. The results indicate that Tc-99m HSA-D is a stable blood pool imaging agent. (Namekawa, K)

Determination of 99Mo in 99mTc eluates used in nuclear medicine centers in Rio de Janeiro

International Nuclear Information System (INIS)

Ribeiro, Bianca da S.; Souza, Raphael S.S.; Lucena, Eder A.; Dantas, Ana Leticia A.; Dantas, Bernardo M.

2009-01-01

99m Tc is used in nuclear medicine for image diagnoses with SPECT. It is obtained from the elution of molybdenum-99/technetium-99m ( 99 Mo/ 99m Tc) generators. During the elution, 99 Mo can detach from the column, passing through the filter and mixing in the solution of pertechnetate eluate and becoming a radionuclidic impurity. The presence of molybdenum in the radiopharmaceutical solution imparts an unnecessary radiation dose to the patient, since its half-life is relatively long (66 hours) and it emits beta particles and high-energy photons of (740 keV). A parameter that indicates the quality of the eluates is the radionuclidic purity, the MBT (molybdenum break through), defined as the ratio between 99 Mo and 99m Tc activities in the eluate. The American and the European Pharmacopoeias restrict 99 Mo content to respectively 0.015% and 0.1% activity ratio 99 Mo/ 99m Tc at the time of the administration to the patient. In Brazil, this parameter is not controlled by official regulations. The objective of this work is to determine the presence of 99 Mo in the eluates used in nuclear medicine centers (NMC). The activity measurements of 99 Mo were performed with a NaI(Tl)8''x4'' scintillation detector installed in the IRD whole body counter. The activity of 99m Tc was measured in the NMC where the eluates were collected and, using the established calculations, it was determined the activity ratio 99 Mo/ 99m Tc. The eluate samples were kindly supplied by the participating NMC of Rio de Janeiro. All measurements indicated the presence of 99 Mo. It is concluded that the technique is sensitive to detect 99 Mo in 99m Tc eluates and permits to verify the quality of the generators used in NMC evaluated in this study. (author)

Effect of austempering temperature and time on mechanical properties of SAE 9260 steel

Science.gov (United States)

Dalwatkar, Ranjit; Prabhu, N.; Singh, R. K. P.

2018-04-01

This work describes the effect of austempering heat treatment on microstrcuture and mechanical properties of SAE 9260 steel. Steel samples, austenitized at 900 °C for one hour, were isothermally heat treated in the temperature range 300,325 and 350 °C for different times. Microstructural characterization was carried out using optical and scanning electron microscopes. The microstructure of the austempered samples consisted of bainitic ferrite and retained austenite. The volume fraction of retained austenite was determined using X-ray diffraction. Isothermal heat treatment at 350 °C for 20 min, resulted in a retained austenite content of around 38% in the microstructure. Increase in isothermal transformation temperature led to an increase in the fraction of retained austenite. Also, good combination of strength and ductility was obtained in the samples with increased amounts of retained austenite.

Technetium-99m ceftizoxime kit preparation

Energy Technology Data Exchange (ETDEWEB)

Diniz, Simone Odilia Fernandes; Siqueira, Cristiano Ferrari; Nelson, David Lee; Cardoso, Valbert Nascimento [Minas Gerais Univ. Federal, Belo Horizonte, MG (Brazil). Faculdade de Farmacia]. E-mail: simone@farmacia.ufmg.br; Martin-Comin, Josep [Bellvitge Univ., Barcelona (Spain)

2005-10-15

The aim of this work was to prepare a kit of {sup 99}m Tc-ceftizoxime ({sup 99m} Tc-CFT), with stability and biological activity preserved, able to identify a septic focus (E. coli) in the experimental infection model in rats. The preparation of the CFT kit involved the use of lyophilized solutions containing the antibiotic ceftizoxime and the sodium dithionite reducing agent (6.0 mg/m L). After lyophilization, the kit was reconstituted with 1.0 mL of sodium {sup 99m} Tc pertechnetate solution (Na {sup 99m} Tc O{sub 4-}) with an activity of 370 MBq. The solution was boiled for 10 min and filtered through a cellulose ester filter. The labeling efficiency was on the order of 92%, remaining stable for six hours and the kit remained stable for two months. The biological activity of the {sup 99m} Tc-CFT was evaluated by diffusion in agar impregnated with E.coli and S. aureus. Seven Wistar rats, weighing from 200 to 250 g, were used for the development of the septic focus. After 24 hours from the induction of the infectious site (E.coli), the animals were anesthetized and 0.1 mL of {sup 99m} Tc-CFT (37 MBq) was injected into the tail veins of the animals. The images were obtained with a gamma camera one, two and six hours after injection and the regions of interest (ROIs) were calculated. The diameters of the inhibition halos for {sup 99}m Tc-CFT were 27.16 {+-} 0.23 and 27.17 {+-} 0.20 for S.aureus and E.coli, respectively, while those for the unlabeled CFT were 30.4 {+-} 0.33 and 29.43 {+-} 0.26, respectively. The results for the biodistribution of {sup 99m} Tc-CFT in infected animals furnished a ratio of 1.97 {+-} 0.31, 2.10 {+-} 0.42 and 2.01 {+-} 0.42 for cpm-target/cpm-no target for the one, two and six-hour periods, respectively. The images showed a clear uptake of labeled antibiotic ({sup 99m} Tc-CFT) by the infectious site during the experiment. The results attest to the viability of producing a kit with {sup 99m} technetium-labeled ceftizoxime for the

Sae regulator factor impairs the response to photodynamic inactivation mediated by Toluidine blue in Staphylococcus aureus.

Science.gov (United States)

Gándara, Lautaro; Mamone, Leandro; Dotto, Cristian; Buzzola, Fernanda; Casas, Adriana

2016-12-01

Photodynamic inactivation (PDI) involves the combined use of light and a photosensitizer, which, in the presence of oxygen, originates cytotoxic species capable of inactivating bacteria. Since the emergence of multi-resistant bacterial strains is becoming an increasing public health concern, PDI becomes an attractive choice. The aim of this work was to study the differential susceptibility to Toluidine blue (TB) mediated PDI (TB-PDI) of S. aureus mutants (RN6390 and Newman backgrounds) for different key regulators of virulence factors related to some extent to oxidative stress. Complete bacteria eradication of planktonic cultures of RN6390 S. aureus photosensitized with 13μM TB was obtained upon illumination with a low light dose of 4.2J/cm 2 from a non-coherent light source. Similarly, complete cell death was achieved applying 1.3μM TB and 19J/cm 2 light dose, showing that higher light doses can lead to equal cell death employing low photosensitizer concentrations. Interestingly, RN6390 in planktonic culture responded significantly better to TB-PDI than the Newman strain. We showed that deficiencies in rsbU, mgrA (transcription factors related to stress response) or agr (quorum sensing system involved in copper resistance to oxidative stress) did not modify the response of planktonic S. aureus to PDI. On the other hand, the two component system sae impaired the response to TB-PDI through a mechanism not related to the Eap adhesin. More severe conditions were needed to inactivate S. aureus biofilms (0.5mM TB, 157J/cm 2 laser light). In mutant sae biofilms, strain dependant differential susceptibilities are not noticed. Copyright © 2016 Elsevier B.V. All rights reserved.

The effect of gamma irradiation on thermoelectric power and thermal conductivity of Ln0.01Sn0.99Se (Ln-Pr,Tb,Er) single crystals

International Nuclear Information System (INIS)

Guseynov, D.I.; Murguzov, M.I.; Ismaylov, Sh.S.; Mamedova, R.F.

2013-01-01

The present paper contains research results on the effect of gamma irradiation on thermal electromotive force and thermal conductivity of Ln 0 .01Sn 0 .99Se (Ln-Pr,Tb,Er) crystals. It is studied some electrical properties of the samples obtained before and after irradiation in a wide temperature range (80-420 K). As a source it was used an isotope 60Co with photon energies 1.25 MeV, the radiation dose was 65 Mrad

supplementary foods for weaning purposes

African Journals Online (AJOL)

DR. AMINU

Nigeria. ABSTRACT. The paper focuses on complementary and supplementary foods for weaning purposes. While ... decision, which guides when to introduce semi-solid foods to infants. It considers the .... readiness of many healthy infants. ... foods. However, caution should be exercised .... Attitudes and practices of infants.

Development of Tc-99m labeled myocardial imaging agent

International Nuclear Information System (INIS)

Jeong, J. M.; Jang, Y. S.; Kim, Y. J.; Lee, Y. S.; Kim, H. W.; Ray, G.; Lee, M. S.

2006-02-01

Lipophilic cations have been widely used for myocardial SPECT. We synthesized novel +1 charged lipophilic Tc-99m-labeled N,N'-disubstituted N2S2 derivatives and investigated their biodistribution. The N,N'-dimethyl-, N,N'-diethyl-, N,N'-bis(methoxyethyl)-, and N,N'-bis(ethoxyethyl)N2S2 derivatives were synthesized by alkylating disulfide form of N2S2 with corresponding alkyl halides and subsequently reduced with LAH in THF. To label with Tc-99m, 50% gluconic acid (0.1 ml), SnCl2·2H2O (10 μg), Tc-99m-pertechnetate (370 MBq/2.5 ml) and 0.5 M Na2CO3 (0.3 ml) were added to the compounds. These mixtures were reacted in boiling water bath for 30∼60 min. Radiochemical purities were checked by Whatman No.1 chromatography (normal saline, Rf 0.3∼0.4). Biodistribution of each compound was investigated after injecting 74 kBq (0.1 ml) of each Tc-99m-labeled compound to ICR-mice through the tail vein. Chemical structures of synthesized compounds were confirmed by GC-MSD and 1H-NMR spectroscopy. All of the Tc-99m-labeled compound showed labeling efficiencies of higher than 93%. In biodistribution study, the myocardial uptake of Tc-99m-N,N'-dimethylN2S2, Tc-99m-N,N'-diethylN2S2, Tc-99m-N,N'-bis(methoxyethyl)N2S2 and Tc-99m-N,N'-bis(ethoxyethyl)N2S2 were 5.38 ±0.96, 2.98 ±0.16, 4.27 ±0.47, 7.24 ±1.01% ID/g at 10 min and 5.34 ±1.57, 2.05 ±0.40, 1.02 ±0.16, 1.69 ±0.04% ID/g at 2 hr, respectively. We successfully synthesized Tc-99m-labeled N,N-disubstituted N2S2 derivatives that are novel lipophilic +1 charged compounds. We thought our results prove the feasibility of these compounds to use for myocardial SPECT agent

Supplementary contribution payable to the health insurance scheme for the spouse's coverage

CERN Multimedia

HR Department

2007-01-01

Staff Members, Fellows and Pensioners are reminded that any change in their marital status, as well as any change in the spouse or registered partner's income or health insurance cover, shall be notified in writing to CERN, within 30 calendar days of the change, in accordance with Articles III 6.01 to 6.03 of the Rules of the CERN Health Insurance Scheme. Such changes may have consequences on the conditions of the spouse or registered partner's affiliation to the CERN Health Insurance Scheme (CHIS) or on the payment of the supplementary contribution to the CHIS for the coverage of the spouse or registered partner. From 1.1.2007, for the following monthly income brackets, the indexed amounts in Swiss francs of the monthly supplementary contribution are: more than 2'500 CHF and up to 4'250 CHF: 134.- more than 4'250 CHF and up to 7'500 CHF: 234.- more than 7'500 CHF and up to 10'000 CHF: 369.- more than 10'000 CHF: 461.- It is in the member of the personnel's interest to declare a change in the annual ...

Development of ultrafine ferritic sheaves/plates in SAE 52100 steel for enhancement of strength by controlled thermomechanical processing

Energy Technology Data Exchange (ETDEWEB)

Chakraborty, J. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Kharagpur, W.B. 721 302 (India); Scientific Services and Research and Development, Tata Steel, Jamshedpur 831 001, Jharkhand (India); Manna, I., E-mail: imanna@metal.iitkgp.ernet.in [Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Kharagpur, W.B. 721 302 (India); Central Glass and Ceramic Research Institute (CGCRI), Council of Scientific and Industrial Research (CSIR), 196 Raja S C Mullick Road, Jadavpur, Kolkata 700032 (India)

2012-06-30

Highlights: Black-Right-Pointing-Pointer Ultrafine bainite + martensite duplex microstructure developed in SAE 52100 steel. Black-Right-Pointing-Pointer Thermomechanical processing modifies size + morphology of bainitic ferrite. Black-Right-Pointing-Pointer Processing involves hot deformation prior to/during/after austenitizing. Black-Right-Pointing-Pointer Significant improvement in mechanical strength achieved. Black-Right-Pointing-Pointer Similar study on high carbon, low alloy steel not reported in the literature. - Abstract: The present study attempts to tailor the size, morphology and distribution of the ferrite needles/sheaves by thermomechanical processing and develop an ultrafine ferrite + martensite duplex microstructure for enhancement of strength and toughness in SAE 52100 steel. The thermo-mechanical routine included 5% hot deformation before, during or after austenitizing at 950 Degree-Sign C for 15 min followed by austempering at 270 Degree-Sign C for 30 min and subsequent water quenching to room temperature. Optical/electron microscopy along with X-ray diffraction was used to quantitatively monitor the size, morphology and distribution of the phase or phase aggregate. Significant improvement in nanohardness, wear resistance and elastic modulus and was observed in samples subjected to thermomechanical processing, as compared to that following the same austenitizing and austempering routine without hot deformation at any stage. However, improvement in the bulk mechanical property due to the present thermo-mechanical is lower than that obtained in our earlier study comprising cold deformation prior to austenitizing and austempering.

75 FR 64717 - Convention on Supplementary Compensation for Nuclear Damage Contingent Cost Allocation

Science.gov (United States)

2010-10-20

... DEPARTMENT OF ENERGY Convention on Supplementary Compensation for Nuclear Damage Contingent Cost... Supplementary Compensation for Nuclear Damage (``CSC'') including its obligation to contribute to an international supplementary fund in the event of certain nuclear incidents. The NOI provided a September 27...

34 CFR 99.8 - What provisions apply to records of a law enforcement unit?

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false What provisions apply to records of a law enforcement unit? 99.8 Section 99.8 Education Office of the Secretary, Department of Education FAMILY EDUCATIONAL RIGHTS AND PRIVACY General § 99.8 What provisions apply to records of a law enforcement unit? (a)(1) Law enforcement unit means any individual,...

40 CFR 86.1772-99 - Road load power, test weight, and inertia weight class determination.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 19 2010-07-01 2010-07-01 false Road load power, test weight, and inertia weight class determination. 86.1772-99 Section 86.1772-99 Protection of Environment ENVIRONMENTAL... for Light-Duty Vehicles and Light-Duty Trucks § 86.1772-99 Road load power, test weight, and inertia...

The role of Technetium99m-MIBI in the follow-up of differentiated thyroid carcinoma

International Nuclear Information System (INIS)

Machado, L.S.; Corbo, R.; Pedras, D.S.V.; Anttonuccia, J.B.

2004-01-01

Full text: Technetium-99m-methoxyisobutylisonitrile (99mTc-MIBI) is being used as a tumor-seeking agent over the last few years. We evaluated the role of 99mTc-MIBI whole body scan (WBS) in localizing metastatic lesions in patients with thyroid cancer and compared the results with 131I scan and serum thyroglobulin (Tg) levels. Eighty nine patients of differentiated thyroid cancer subjected to thyroidectomy were enrolled for the study. Early (20 minutes) and delayed (6 and 24 hours) whole body images were obtained after injecting 99mTc-MIBI. Tg measurements were obtained during thyroid hormone replacement and 4 weeks after hormone discontinuation. 131I scans were performed after low diagnostic or high ablative/therapeutic dose. These methods were used as standard to evaluate the presence of residual or metastatic thyroid cancer. The patients with positive 99mTc-MIBI scan but negative 131I scan underwent chest x-ray, computed tomography (CT) or magnetic resonance imaging (MRI). 34 of the total 89 patients were found to be negative on 131I scan. 23 of these 34 patients had negative 99mTc-MIBI WBS and 11 patients were positive for abnormal MIBI uptake (specificity: 67.6%). Twenty-two patients had both 99mTc-MIBI WBS and 131I scan positive. Eleven patients had 131I scan negative and 99mTc-MIBI WBS positive; seven of those proved to be true positive. From the findings of our study, it may be concluded that although 99mTc-MIBI has low sensitivity for detection of tumor recurrence, it definitely has a role as a supplementary tool to thyroglobulin measurements and 131I scans. (author)

Gene : CBRC-CJAC-01-0809 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-0809 Novel UN B UNKNOWN ZNF99_HUMAN 1e-22 55% dbj|BAC87181.1| unnamed ...protein product [Homo sapiens] 1e-30 69% MLCFKTHAPILSALSFPVFFMQVDPHLPATTESAASSSKGKQSQRVFVWLLLLSYLLFYFLRWSLTL

22 CFR 99.2 - Reporting requirements for adoption cases involving children emigrating from the United States.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting requirements for adoption cases involving children emigrating from the United States. 99.2 Section 99.2 Foreign Relations DEPARTMENT OF... CHILDREN § 99.2 Reporting requirements for adoption cases involving children emigrating from the United...

22 CFR 96.99 - Converting an application for temporary accreditation to an application for full accreditation.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Converting an application for temporary accreditation to an application for full accreditation. 96.99 Section 96.99 Foreign Relations DEPARTMENT OF... INTERCOUNTRY ADOPTION ACT OF 2000 (IAA) Procedures and Standards Relating to Temporary Accreditation § 96.99...

Design optimization of rear uprights for UniMAP Automotive Racing Team Formula SAE racing car

Science.gov (United States)

Azmeer, M.; Basha, M. H.; Hamid, M. F.; Rahman, M. T. A.; Hashim, M. S. M.

2017-10-01

In an automobile, the rear upright are used to provide a physical mounting and links the suspension arms to the hub and wheel assembly. In this work, static structural and shape optimization analysis for rear upright for UniMAP’s Formula SAE racing car had been done using ANSYS software with the objective to reduce weight while maintaining the structural strength of the vehicle upright. During the shape optimization process, the component undergoes 25%, 50% and 75 % weight reduction in order to find the best optimal shape of the upright. The final design of the upright is developed considering the weight reduction, structural integrity and the manufacturability. The final design achieved 21 % weight reduction and is able to withstand several loads.

Labelling and quality control of 99mTc labelled somatostatin analogues

International Nuclear Information System (INIS)

Poramatikul, N.; Sangsuriyan, J.; Kongpeth, P.; Ngamprayad, T.; Laloknam, S.; Permtermsin, C.; Madsomboon, N.

2001-01-01

To standardize interlaboratory reproducibility, iodination of RC-160 with 125 I and direct labelling of RC-160 with 99m Tc, quality control and binding assay were performed. Two conjugated peptides, HYNIC-RC-160 and MAG-3-RC-160, were synthesized. The conjugated peptides were radiolabelled with 99m Tc via co-ligands; 99m Tc-MAG-3-RC-160 via glucoheptonate, 99m Tc-HYNIC-RC-160 via EDDA and tricine. Conditions for labelling were optimized. Analytical and purification methods for the labelled products were developed. Radiochemical purity test of 99m Tc labelled peptides was performed by HPLC with gradient elution of 0.1%TFA/water and acetonitrile, or by ITLC-SG in saline and in 50% acetonitrile. The contaminants in 99m Tc radiolabelled product were separated by elution from SEPPAK C-18 cartridge by 0.1% acetic acid and the pure product was eluted out of SEPPAK column by 50% acetonitrile with about 68% recovery. Stability of the purified 99m Tc-MAG3-RC-160 stored at -20 deg. C was more than 72 h. 99m Tc-MAG-3-RC-160 showed a high equilibrium dissociation constant with K D of 26 pmole/mg protein and B max of 7.9 mM. (author)

Technetium-99m ceftizoxime kit preparation

Directory of Open Access Journals (Sweden)

Simone Odília Fernandes Diniz

2005-10-01

Full Text Available The aim of this work was to prepare a kit of 99mTc-ceftizoxime (99mTc-CFT, with stability and biological activity preserved, able to identify a septic focus (E. coli in the experimental infection model in rats. The preparation of the CFT kit involved the use of lyophilized solutions containing the antibiotic ceftizoxime and the sodium dithionite reducing agent (6.0 mg/mL. After lyophilization, the kit was reconstituted with 1.0 mL of sodium 99mTc-pertechnetate solution (Na99mTcO4- with an activity of 370 MBq. The solution was boiled for 10 min and filtered through a cellulose ester filter. The labeling efficiency was on the order of 92%, remaining stable for six hours and the kit remained stable for two months. The biological activity of the 99mTc-CFT was evaluated by diffusion in agar impregnated with E.coli and S. aureus. Seven Wistar rats, weighing from 200 to 250 g, were used for the development of the septic focus. After 24 hours from the induction of the infectious site (E.coli, the animals were anesthetized and 0.1 mL of 99mTc-CFT (37 MBq was injected into the tail veins of the animals. The images were obtained with a gamma camera one, two and six hours after injection and the regions of interest (ROIs were calculated. The diameters of the inhibition halos for 99mTc-CFT were 27.16 ± 0.23 and 27.17 ± 0.20 for S.aureus and E.coli, respectively, while those for the unlabeled CFT were 30.4 ± 0.33 and 29.43 ± 0.26, respectively. The results for the biodistribution of 99mTc-CFT in infected animals furnished a ratio of 1.97 ± 0.31, 2.10 ± 0.42 and 2.01 ± 0.42 for cpm-target/cpm-no target for the one, two and six-hour periods, respectively. The images showed a clear uptake of labeled antibiotic (99mTc-CFT by the infectious site during the experiment. The results attest to the viability of producing a kit with 99m technetium-labeled ceftizoxime for the investigation of infectious processes.O objetivo deste trabalho foi preparar um kit de Tc

Study on Stability and Electrochemical Properties of Nano-LiMn1.9Ni0.1O3.99S0.01-Based Li-Ion Batteries with Liquid Electrolyte Containing LiPF6

Directory of Open Access Journals (Sweden)

Monika Bakierska

2016-01-01

Full Text Available Herein, we report on the stability and electrochemical properties of nanosized Ni and S doped lithium manganese oxide spinel (LiMn1.9Ni0.1O3.99S0.01, LMN1OS in relation to the most commonly used electrolyte solution containing LiPF6 salt. The influence of electrochemical reaction in the presence of selected electrolyte on the LMN1OS electrode chemistry was examined. The changes in the structure, surface morphology, and composition of the LMN1OS cathode after 30 cycles of galvanostatic charging/discharging were determined. In addition, thermal stability and reactivity of the LMN1OS material towards the electrolyte system were verified. Performed studies revealed that no degradative effects, resulting from the interaction between the spinel electrode and liquid electrolyte, occur during electrochemical cycling. The LMN1OS electrode versus LiPF6-based electrolyte has been indicated as an efficient and electrochemically stable system, exhibiting high capacity, good rate capability, and excellent coulombic efficiency. The improved stability and electrochemical performance of the LMN1OS cathode material originate from the synergetic substitution of LiMn2O4 spinel with Ni and S.

Effect of sintering pressure on structure and magnetic properties of Zn0.99Ni0.01O bulk samples synthesized under different pressures

International Nuclear Information System (INIS)

Wang, Yongqiang; Yuan, Chaosheng; Su, Lei; Wang, Zheng; Hao, Junhong; Ren, Yufen

2015-01-01

A series of Zn 0.99 Ni 0.01 O bulk samples were prepared by a coprecipitation method, and then sintered at 600 °C under various pressures from normal pressure(NP) to 3 GPa. The effects of sintering pressure (P S ) on the structure, morphology and magnetic properties of the doping samples were investigated in detail. The XRD and HRTEM results reveal that all samples are of single-phase hexagonal structure. Compared with the sample sintered at normal pressure, the lattice parameters a and c of the samples sintered at high pressures (HP) show a sharply decrease. With the increase of sintering pressure, the particle size gradually increases as well as the particles get closer to each other. At 300 K, the sample sintered at normal pressure shows a superparamagnetic-like behavior, while the samples sintered at high pressures display typical ferromagnetic behaviors. The saturation magnetization of the samples sintered at high pressures is three orders of magnitude larger than that of the one sintered at normal pressure. Our results reveal that an appropriate sintering pressure can tune the magnetic properties of Ni-doped ZnO system by changing the lattice parameters, particle size and inter-particle spacing, which may be helpful to the practical applications. - Highlights: • A series of Zn 0.99 Ni 0.01 O bulk samples were sintered in different pressures. • The lattice constants of the samples sintered at high pressure clearly decrease. • The particle size increases gradually with the increase of sintering pressure. • The samples sintered at different pressures show different magnetic behaviors. • Appropriate sintering pressure can tune the magnetic properties of Zn–Ni–O system

40 CFR 790.99 - Statement of financial responsibility.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 31 2010-07-01 2010-07-01 true Statement of financial responsibility... From Test Rules § 790.99 Statement of financial responsibility. Each applicant for an exemption shall submit the following sworn statement with his or her application: I understand that if this application...

NCBI nr-aa BLAST: CBRC-CBRE-01-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CBRE-01-0085 ref|NP_224081.1| DNA POLYMERASE I [Helicobacter pylori J99] sp|Q9...ZJE9|DPO1_HELPJ DNA polymerase I (POL I) gb|AAD06938.1| DNA POLYMERASE I [Helicobacter pylori J99] NP_224081.1 0.87 40% ...

Supplementary contribution for spouses and registered partners payable to the health insurance scheme

CERN Multimedia

HR Department

2009-01-01

Staff members, fellows and pensioners are reminded that they must notify CERN of any change in their marital status and any change in the income or health insurance cover of their spouse or registered partner, in writing and within 30 calendar days of the change, in accordance with Articles III 6.01 to 6.03 of the Rules of the CERN Health Insurance Scheme (CHIS). Such changes may affect the conditions of the spouse or registered partner’s membership of the CHIS or the payment of the supplementary contribution to the CHIS. For more information see: http://cern.ch/chis/contribsupp.asp From 1.1.2009 onwards, the following indexed monthly supplementary contributions, expressed in Swiss francs, are payable for the various monthly income brackets: •\tmore than 2’500 CHF and up to 4’250 CHF: 134.- •\tmore than 4’250 CHF and up to 7’500 CHF: 234.- •\tmore than 7’500 CHF and up to 10’000 CHF: 369.- •\tmore than 10’000 CHF: 485.- It is in the member of...

40 CFR 152.99 - Petitions to cancel registration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Petitions to cancel registration. 152... Submitters' Rights § 152.99 Petitions to cancel registration. An original data submitter may petition the Agency to deny or cancel the registration of a product in accordance with this section if he has...

3DII implantation effect on corrosion properties of the AISI/SAE 1020 steel

Energy Technology Data Exchange (ETDEWEB)

Dulce M., H.J.; Rueda V., Alejandro [Universidad Francisco de Paula Santander, A.A. 1055, Cucuta (Colombia); Dougar-Jabon, Valeri [Universidad Industrial de Santander, A.A. 678, Bucaramanga (Colombia)

2005-08-01

The three dimensional ion implantation technology (3DII) is one of the methods of improving the tribological characteristics and resistance to hydrogen embrittlement processes in metals. In this report, some results concerning the resistance effect of nitrogen ion implantation to oxidation of the sample, made of AISI/SAE 1020 steel, are given. The nitrogen ions were implanted in the discharge chamber of the JUPITER reactor. Both the treated and untreated samples were tested through potential-static measurements, which permitted to determine the corrosion current, the slopes that characterise the braking level of anode and cathode reactions. The polarization resistance near the corrosion potential is calculated. The results of the study encourage to consider the nitrogen ion implantation in high voltage and low pressure discharges as one of the methods of anticorrosive protection which do not change the geometric configuration of the treated steel pieces. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Comparison of uptake of 99mTc-MIBI, 99mTc-tetrofosmin and 99mT-Q12 into human breast cancer cell lines

International Nuclear Information System (INIS)

Yong, M. de; Bernard, B.F.; Breeman, W.A.P.; Ensing, G.; Benjamins, H.; Bakker, W.H.; Visser, T.J.; Krenning, E.P.

1996-01-01

Technetium-99m hexakis-2-methoxyisobutyl-isonitrile (MIBI), 99m Tc-tetrofosmin and 99m Tc-Q12 were all introduced for myocardial imaging but found additional applications as they are taken up by different tumours, enabling imaging of these lesions in patients. The aim of this study was to compare the uptake characteristics of these compounds in vitro in the human adenocarcinoma breast cell lines MCF-7 and ZR-75. It was shown that 99m Tc-MIBI had the highest cellular uptake (15.9%±0.5% dose/mg protein after 60 min in MCF-7, and 14.2%±0.4% dose/mg protein in ZR-75), followed by 99m Tc-tetrofosmin (6.8%±0.6% dose/mg protein in MCF-7, and 8.2%±0.2% dose/mg protein in ZR-75) and 99m TC-Q12 (3.2%±0.1% dose/mg protein in MCF-7, and 3.5%±0.3% dose/mg protein in ZR-75 cells). For all three compounds tenfold differences in specific activity did not influence total cell-associated radioactivity. Uptake of 99m Tc-MIBI and 99m Tc-tetrofosmin was obviously lower at 4 C than at 37 C, whereas 99m Tc-Q12 uptake showed only slight temperature dependence. When uptake was compared in cells grown to different cell densities (1 mg/ml cellular protein versus 0.3 mg/ml), no differences in uptake were detected when uptake was corrected for the amount of cellular protein present in the dishes. Furthermore, for all compounds it was shown that cellular radioactivity decreased rapidly after washing. Apart from the differences in cellular uptake of the three compounds after 60 min, no differences in residual cellular radioactivity after washing were found between the different compounds when expressed as a percentage of their 60-min uptake, suggesting that the efflux process of the radiolabelled compounds was similar. The differences in cell-associated activity after 60 min were thus presumably caused by differences in uptake. (orig./MG)

Thermal degradation of a synthetic lube oil API SL/CF SAE 5W 40; Degradacao termica do oleo lubrificante sintetico API SL/CF SAE 5W 40

Energy Technology Data Exchange (ETDEWEB)

Lopes, Eddy H. de O.; Carvalho, Laura H. de; Silva, Everson de L. [Universidade Federal de Campina Grande (UFCG), PB (Brazil)

2008-07-01

This work deals with the thermal degradation to 210 deg C of lubricating oil synthetic API SL/CF SAE 5W 40 as received and on the presence of metallic particles, from engine parts (head and crankshaft). Samples were collected at various intervals of time. The metallic particles were spent in mesh sieve no. 200 (0.074 mm) and used both in the trials of characterization (EDX and SEM) as the thermal degradation of the oil. Changes in rheology, viscosity, density, color and FTIR were monitored over time of heat exposure. The results indicate that thermal exposure caused by thermal oxidation of synthetic oil and that the presence of metallic particles (10 ppm) accelerated this process, so it is suggested that during the exchange of oil are taken care to remove them from to prevent the premature deterioration of the new oil. The behaviour Newtonian was maintained throughout the period degradation and viscosity of the oil has not changed significantly even after long periods (1148 hours) of thermal exposure. Despite the density of oil also has not changed significantly with time of exposure, changes in color indicate that chemical changes occurred, which was detected by FTIR. (author)

Evaluation of '99Mo presence in eluates of 99mTc used in nuclear medicine

International Nuclear Information System (INIS)

Ribeiro, Bianca da Silva

2010-01-01

Tc-99m is used for diagnostic imaging in nuclear medicine through SPECT technique. It is obtained by the elution of 99 Mo/ 99m Tc generators. During the elution process 99 Mo can be extracted becoming a radionuclidic impurity. One of the quality parameters of the eluate is the radionuclidic purity, MBT (molybdenum break through), defined as the ratio between 99 Mo and 99m Tc activities in the eluate. The North-American and European pharmacopoeias restrict the 99 Mo content, respectively, in 0.015 e 0.1% and, according to the International Atomic Energy Agency (IAEA), the activity ratio at the moment of administration of the radiopharmaceutical to the patient, should not exceed 0.015%. In Brazil, the control of such parameter is not obliged in official regulations. Thus, the objective of this work is to evaluate the occurrence of 99 Mo in 99m Tc eluates. It was initially optimized a methodology to determine the activity of 99 Mo in eluate samples. Efficiency curves were obtained for a NaI (Tl) 8'' x 4'' scintillation detector installed at the In Vivo Monitoring Laboratory (LABMIV-IRD). The methodology has been validated through the measurement of a 99 Mo standard liquid source calibrated at the National Metrology Laboratory for Ionizing Radiation (LNMRI-IRD). The samples analyzed in this work were gently supplied by 5 Nuclear Medicine Clinics located in the city of Rio de Janeiro. The activities of 99 mTc and 99 Mo in those samples have been measured respectively at the clinics and at the LABMIV. By applying a standardized methodology, the ration between the activities were calculated. The results show that 147 out of 174 samples presented 99 Mo activities above the minimum detectable activity of the technique. On the other hand, only 2 out of 147 samples surpassed the MBT limit suggested by the IAEA and have been detected in samples eluted from generators of 750 mCi. In one of the samples, eluted from a generator of 1000 mCi, the calculated MBT value was very close

7 CFR 900.310 - Supplementary instructions.

Science.gov (United States)

2010-01-01

... Conduct of Referenda To Determine Producer Approval of Milk Marketing Orders To Be Made Effective Pursuant to Agricultural Marketing Agreement Act of 1937, as Amended § 900.310 Supplementary instructions. The... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing...

SUPPLEMENTARY INFORMATION Protonation of the imino ...

Indian Academy of Sciences (India)

Ashish

SUPPLEMENTARY INFORMATION. Protonation of the imino nitrogen deactivates the excited state of imidazolin-5-one in the solid state. ASHISH SINGH, KHALID BADI-UZ ZAMA and GURUNATH RAMANATHAN*. Department of Chemistry, Indian Institute of Technology Kanpur, Kanpur, Uttar Pradesh India. 208 016.

7 CFR 1770.12 - Supplementary accounts.

Science.gov (United States)

2010-01-01

... AGRICULTURE (CONTINUED) ACCOUNTING REQUIREMENTS FOR RUS TELECOMMUNICATIONS BORROWERS Uniform System of... shall be changed to conform with the State's accounting system. (b) In addition to the accounts set forth in § 1770.15, cooperative or other nonprofit borrowers shall maintain the supplementary accounts...

Thermodynamic Analysis of Supplementary-Fired Gas Turbine Cycles

DEFF Research Database (Denmark)

Elmegaard, Brian; Henriksen, Ulrik Birk; Qvale, Einar Bjørn

2003-01-01

to result in a high marginal efficiency. The paper shows that depending on the application, this is not always the case. The interest in this cycle arises from a recent demonstration of the feasibility of a two-stage gasification process through construction of several plants. The gas from this process...... could be divided into two streams, one for primary and one for supplementary firing. A preliminary analysis of the ideal, recuperated Brayton cycle shows that for this cycle any supplementary firing will have a marginal efficiency of unity per extra unit of fuel. The same result is obtained...

Determination of 99Mo contamination in 99mTc elute obtained from 99Mo/99mTc- generator

International Nuclear Information System (INIS)

Momennezhad, M.; Zakavi, S. R.; Sadeghi, R.

2010-01-01

99m Tc is a widely used radioisotope in nuclear medicine centers which is obtained by elution from Mo-99/Tc-99m generators. Usually the generators are either supplied by the Iran Atomic Energy Agency or by private companies from foreign countries. In this study we have measured 99 Mo contamination in 99m Tc elute from different generators in a period of one year. Materials and Methods: The radionuclide impurity of the 99m Tc elute were studied in two types of radionuclide generators (A: produced in Iran and B: Imported from other country). In-vitro measurements were performed using dose calibrator. Direct measurements were made, using a standard canister at the time of milking of the generators and also in Subsequent hours after milking. Results: The results showed a mean of 99 Mo impurity in generators A and B to be 0.00932±0.0043 and 0.0170±0.0127 respectively. Although the results showed that the 99 Mo contamination in 99 mTc elute was lesser than the maximum accepted activity limit of 0.015%, the difference in these two types may reflect different methods of productions of generator, as well as the quality control procedures. Conclusion: The mean of 99 Mo contamination in generators produced in Iran Atomic Energy Organization was lesser than generators imported from foreign origin.

Minimizing Molybdenum 99 contamination in Technetium 99m Pertechnetate from the elution of 99Mo/ 99m Tc Generator

International Nuclear Information System (INIS)

Zakaria Ibrahim; Zulkifli Hashim; Bohari Yaacob

2011-01-01

Radioisotope Tc-99m is widely used for variety of nuclear medicine diagnostic procedures. For many commercial applications, it is prepared in a portable type generator. Nuclear Malaysia has been producing a dry type alumina chromatographic column generator utilizing fission Mo-99. This injectable Tc-99m must meet the British Pharmacopeia [1] product specification prior to be apply on patient. This paper provides a method to minimize the up to acceptable level Mo-99 in the final product. Purposely made pertechnetate contaminated with Mo-99 and re-eluate by using old generator. Excellent removal of Mo-99 impurity was achieved and more than 80 % of Tc-99m total activity was recovered. (author)

Optimization of the {sup 99m} Tc generator with hydrotalcite as support of {sup 99} Mo; Optimizacion del generador de {sup 99m} Tc con hidrotalcita como soporte del {sup 99} Mo

Energy Technology Data Exchange (ETDEWEB)

Aranda O, N

2004-07-01

In the last years, in the laboratories of the National Institute of Nuclear Investigations (ININ) its have been investigating to the hydrotalcite like a material of support of the {sup 99} Mo with the purpose of developing a new technetium generator. During the development of the investigations it has been demonstrated that when putting in contact to the HTC with an aqueous solution that contains anions of any type, the HTC re hydrate and the structure is regenerated to laminate of the hydrotalcite. If the present anions in the solution are molybdate anions (MoO{sub 4}{sup 2-}), these anions passed to be part of the structure of the hydrotalcite (HT-MoO{sub 4}). These anions can contain, in turn, {sup 99} Mo in their composition ({sup 99}MoO{sub 4}{sup 2-}) and equally they can pass to be part of the structure of the hydrotalcite forming the HT-{sup 99}MoO{sub 4}. When the HT-{sup 99}MoO{sub 4} is packed in a column, the {sup 99m}Tc that it takes place when decaying the {sup 99}Mo radioactively can separate the column using aqueous solution of NaCl. This way, in previous studies (Serrano, 2000) it was found that the aqueous solution of NaCl to 0.5% it is the but appropriate for elutriate at the {sup 99m}Tc from the column the yield of the elution of the {sup 99m}Tc was since high (98%) in the first elution, and the radionuclide contamination caused by the presence of {sup 99}Mo in the eluate it was low (<0.01%). In this investigation it was also found that the HTC has a high capacity to retain molybdate ions (255.1 mg of ions MoO{sub 4}{sup 2-} for gram of HTC). These facts, standing out the high capacity of the HTC to retain molybdate ions, they drove from a direct way to investigate the optimization of the generator of {sup 99m}Tc, with hydrotalcite like support of the {sup 99}Mo, using {sup 99}Mo of low specific activity. This finishes radioactive material it can be obtained by the irradiation of the {sup 98}Mo (in the chemical form of MoO{sub 3} or (NH{sub 4

18 CFR 706.405 - Supplementary statements.

Science.gov (United States)

2010-04-01

... employee shall at all times avoid acquiring a financial interest that could result, or taking an action... EMPLOYEE RESPONSIBILITIES AND CONDUCT Statements of Employment and Financial Interests § 706.405... employment and financial interests shall be reported in a supplementary statement, in the format prescribed...

SUPPLEMENTARY INFORMATION Temperature effects on the ...

Indian Academy of Sciences (India)

Windows User

SUPPLEMENTARY INFORMATION. Temperature effects on the hydrophobic force between two graphene-like surfaces in liquid water. TUHIN SAMANTA and BIMAN BAGCHI. Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore, Karnataka 560. 012, India. Table of Contents. Figure S1. Page 2.

Defect chemistry and oxygen transport of (La0.6Sr0.4 − xMx)0.99Co0.2Fe0.8O3 − δ, M = Ca (x = 0.05, 0.1), Ba (x = 0.1, 0.2), Sr: Part II: Oxygen transport

DEFF Research Database (Denmark)

Dalslet, Bjarke Thomas; Søgaard, Martin; Hendriksen, Peter Vang

2009-01-01

This paper is the second part of a two part series, where the effects of varying the A-site dopant on the defect chemistry and transport properties of the materials (La0.6Sr0.4 − xMx)0.99Co0.2Fe0.8O3 − δ, M = Sr, Ca (x = 0.05, 0.1), Ba (x = 0.1, 0.2) (LSMFC) have been investigated. In part I......, the findings on the defect chemistry were reported, while the oxygen transport properties are reported here in part II. In the investigated material series, the amount of divalent dopant has been kept constant, while Sr ions have been substituted with Ca ions (smaller ionic radius) or Ba ions (larger ionic...... electrolyte probe were used to extract the permeability and surface resistance, rs. The highest permeability was found for (La0.6Sr0.3Ca0.1)0.99Co0.2Fe0.8O3 − δ. The apparent activation energy of the permeability was 78 kJ/mol. The inverse surface resistance, rs− 1, also had an activated behavior...

Effect of supplementary feed and stocking rate on the production of ...

African Journals Online (AJOL)

This study was conducted to determine the effect of two different levels of supplementary feed and two different stocking rates on the production of grazing ostriches. One hundred and seventy ostriches were randomly allocated to four groups and kept on irrigated lucerne pasture with or without supplementary feed from ...

Trends in the Use of Supplementary Materials in Environmental Science Journals

Science.gov (United States)

Kenyon, Jeremy; Sprague, Nancy R.

2014-01-01

Our research examined the use of supplementary materials in six environmental science disciplines: atmospheric sciences, biology, fisheries, forestry, geology, and plant sciences. Ten key journals were selected from each of these disciplines and the number of supplementary materials, such as data files or videos, in each issue was noted over a…

20 CFR 255.9 - Individual enrolled under supplementary medical insurance plan.

Science.gov (United States)

2010-04-01

... supplementary medical insurance premiums will be applied toward payment of such premiums, and the balance of the... medical insurance plan. 255.9 Section 255.9 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS... supplementary medical insurance plan. Where recovery of the overpayment is by setoff as provided for in § 255.6...

Spent 99Mo/99mTc generator as an economical source of 99Mo

International Nuclear Information System (INIS)

El-Kolaly, M.T.

1990-01-01

An improved method for utilization and purification of 99 Mo from spent 90 Mo/ 99m Tc generators has been described. After washing the generator with saline to remove the generated 99m Tc, followed by 2 mL 5 M NaOH containing a few drops of H 2 O 2 , the 99 Mo was quantitatively eluted from the generator with 5 mL 5 M NaOH. The alkaline eluate containing 99 Mo was contaminated with partially dissolved alumina. In the present method, an anion-exchange resin Dowex 1 x 8 column was used for purification of 99 Mo from the contaminating alumina. The resultant 99 Mo was of high purity and contained 3+ /mL 99 Mo solution, as estimated by atomic absorption. (author)

Supplementary data: Comparative studies on sequence ...

Indian Academy of Sciences (India)

Unknown

Page 1. Supplementary data: Comparative studies on sequence characteristics around translation initiation codon in four eukaryotes. Qingpo Liu and Qingzhong Xue. J. Genet. 84, 317–322. Table 1. Spearman's rank correlation coefficients of 39 base positions around the AUG codon in the four eukaryotic species studied.

Convention on supplementary compensation for nuclear damage

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-22

The document reproduces the text of the Convention on Supplementary Compensation for Nuclear Damage which was adopted on 12 September 1997 by a Diplomatic Conference held between 8-12 September 1997 in Vienna

Convention on supplementary compensation for nuclear damage

International Nuclear Information System (INIS)

1998-01-01

The document reproduces the text of the Convention on Supplementary Compensation for Nuclear Damage which was adopted on 12 September 1997 by a Diplomatic Conference held between 8-12 September 1997 in Vienna

Spillover effects of supplementary on basic health insurance: Evidence from the Netherlands

NARCIS (Netherlands)

A.-F. Roos (Anne-Fleur); F.T. Schut (Erik)

2012-01-01

textabstractLike many other countries, the Netherlands has a health insurance system that combines mandatory basic insurance with voluntary supplementary insurance. Both types of insurance are founded on different principles. Since basic and supplementary insurance are sold by the same health

29 CFR 1960.18 - Supplementary standards.

Science.gov (United States)

2010-07-01

... agency employees for which there exists no appropriate OSHA standards. In order to avoid any possible... adopted inconsistent with OSHA standards, or inconsistent with OSHA enforcement practices under section 5... of this finding. In such a case, the supplementary standard shall not be adopted, but the agency will...

Influence of pH, temperature and thermal treatment on site corrosion of SAE 304 steel in chlorinated solutions

International Nuclear Information System (INIS)

Konrad, I.B.

1982-01-01

The electrochemical behaviour and fracture morphology of homogenized and sensitized type SAE 304 stainless steel U bent specimens, in 3% NaCl solution, at pH=2.0 and pH=7.0 both at room temperature and 100 0 C was studied. Polarization curves, galvanostatic and potentiostatic experiments were run. It could be observed that high temperature and low pH favour transgranular cracking and longer sensitization times lower fracture time and tend to give rise to intergranular fracture. Light sensitization can produce transgranular cracking even at room temperature, when the homogenized alloy does not present stress-corrosion cracking for the same condition. (Author) [pt

Comparative biological evaluation between 99mTc tricarbonyl and 99mTc-Sn(II) levosalbutamol as a β2-adrenoceptor agonist

International Nuclear Information System (INIS)

Sanad, Mahmoud H.; Borai, Emad H.

2015-01-01

This study describes the comparison between 99m Tc-tricarbonyl and 99m Tc-Sn (II) levosalbutamol as a β 2 -adrenoceptors radiopharmaceutical and evaluation of their different biological characteristics using experimental animals. Levosalbutamol was labeled firstly with 99m Tc in the presence of SnCl 2 . 2H 2 O as a reducing agent under the optimum conditions: pH 8, 50 μg SnCl 2 . 2H 2 O, room temperature, 40 μg levosalbutamol and 30 min reaction time to give a maximum radiochemical yield of 98 ± 0.1%. The obtained 99m Tc-levosalbutamol was stable for a time up to 8 h. Secondly, 99m Tc-tricarbonyl ([ 99m Tc(CO) 3 (H 2 O) 3 ] + ) levosalbutamol was prepare under 30 min heating at 100 C. Labeling yield and stability were analyzed by high performance liquid chromatography (labeling yield >99% and stability for 8 h). Biodistribution investigation showed that, the maximum uptake ratio of the 99m Tc-levosalbutamol ( 99m Tc-Lev) between lung and heart was 2.34 ± 0.62 % of the injected activity/g tissue organ, at 30 min post-injection. But in case of 99m Tc-tricarbonyl levosalbutamol ( 99m Tc-tricarbonyl Lev) the maximum uptake ratio was 3.6 ± 0.11 of the injected activity/g tissue organ, at 30 min post-injection. This indicates that 99m Tc-tricarbonyl levosalbutamol was more selective for lung β 2 -adrenoceptors than 99m Tc-levosalbutamol. These results introduce 99m Tc-tricarbonyl levosalbutamol as a novel potential radiopharmaceutical for lung imaging.

Vehículo de competición Fórmula SAE: Diseño y optimización del chasis

OpenAIRE

PONS ESTRUCH, ARANTXA

2016-01-01

[Es] El objetivo de este proyecto es realizar el diseño y el análisis de un chasis tubular para un vehículo prototipo de competición bajo los parámetros de las normas Formula SAE Competition. Mediante software informático, se realizará la modelización en 3D del chasis y el cálculo mediante elementos finitos, analizando diversas hipótesis de carga según la normativa aplicable, que simularán las diferentes pruebas a las que puede ser sometido el vehículo. Se estudiarán diversas a...

Technetium-99m-dimethylglyoxime ([sup 99m]Tc-DMG) as renal imaging agent

Energy Technology Data Exchange (ETDEWEB)

Adonaylo, V.N. (Buenos Aires Univ. (Argentina). Facultad de Ciencias Exactas y Naturales Buenos Aires Univ. (Argentina). Dept. de Ciencias Biologicas); Stahl, Adriana; Pomilio, A.B.; Vitale, A.A. (Buenos Aires Univ. (Argentina). Facultad de Ciencias Exactas y Naturales); Canellas, C.O. (Buenos Aires Univ. (Argentina). Facultad de Ciencias Exactas y Naturales Comision Nacional de Energia Atomica, Buenos Aires (Argentina))

1993-06-01

Dimethylglyoxime (DMG) labelled with [sup 99m]Tc is presented as a renal imaging agent. The behaviour of this complex was analysed at different pH by means of UV spectral data and using DMG-calcium chloride as a reference complex. Biokinetic data were evaluated in two biological models, Sprague-Dawley rats and Didelphis albiventris argentine opossum. Biodistribution in rats demonstrated fast and specific renal excretion. Time-activity values over both kidneys could be quantified for this complex. Renographic studies led to mean time-to maximum values on twelve assays of 2.0 [+-] 0.1 min and a mean relative function of 53.0 [+-] 2.3 and 47.0 [+-] 3.2 for right and left kidneys, respectively. [sup 99m]Tc-DMG showed specificity for the renal excretion pathway and therefore seems to be a very useful radiopharmaceutical for renal function studies. (Author).

Experiences from polio supplementary immunization activities in ...

African Journals Online (AJOL)

2014-05-31

May 31, 2014 ... lessons from supplementary immunization activities (SIAs) conducted in the State that will be useful to ... Poliovirus invades the central nervous system and causes ..... The vaccine wastage rate of 6.6% was slightly higher.

Successful labeling of 99mTc-MDP using 99mTc separated from 99Mo produced by 100Mo(n,2n)99Mo

International Nuclear Information System (INIS)

Nagai, Yasuki; Hatsukawa, Yuichi; Kin, Tadahiro; Hashimoto, Kazuyuki; Motoishi, Shoji; Konno, Chikara; Ochiai, Kentaro; Takakura, Kosuke; Sato, Yuichi; Sato, Norihito; Ohta, Akio; Yamabayashi, Hisamichi; Tanase, Masakazu; Fujisaki, Saburo; Kawauchi, Yukimasa; Teranaka, Tomoyuki; Takeuchi, Nobuhiro; Igarashi, Takashi

2011-01-01

We have for the first time succeeded in separating 99m Tc from a MoO 3 sample irradiated with accelerator neutrons free from any radioactive impurities and in formulating 99m Tc-methylene diphosphonate ( 99 mTc-MDP). 99 Mo, the mother nuclide of 99m Tc, was produced by the 100 Mo(n,2n) 99 Mo reaction using about 14 MeV neutrons provided by the 3 H(d,n) 4 He reaction at the Fusion Neutronics Source of Japan Atomic Energy Agency. The 99m Tc was separated from 99 Mo by sublimation and its radionuclide purity was confirmed to be higher than 99.99% by γ-spectroscopy. The labeling efficiency of 99m Tc-MDP was shown to be higher than 99% by thin-layer chromatography. These values exceed the United States Pharmacopeia requirements for a fission product, 99 Mo. Consequently, a 99m Tc radiopharmaceutical preparation formed by using the mentioned 99 Mo can be a promising substitute for the fission product 99 Mo, which is currently produced using a highly enriched uranium target in aging research reactors. A longstanding problem to ensure a reliable and constant supply of 99 Mo in Japan can be partially mitigated. (author)

Room temperature fatigue behaviour of a normalized steel SAE 4140 in torsion. Ermuedungsverhalten von normalisiertem 42CrMo4 unter Torsionsbeanspruchung bei Raumtemperatur

Energy Technology Data Exchange (ETDEWEB)

Klumpp, S.; Eifler, D.; Macherauch, E. (Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Werkstoffkunde 1)

1990-05-01

Cyclic deformation behaviour of a normalized steel SAE 4140 in shear strain-controlled torsion is characterized by cyclic softening and cyclic hardening. If mean shear stresses are superimposed to an alternating shear stress, cycle-dependent creep occurs, and the number of cycles to failure decreases. In shear strain-controlled torsional loading, mean stresses are observed to relax nearly to zero within a few cycles. Fatigue life is not influenced by mean shear strains. (orig.).

Different uptake of 99mTc-ECD adn 99mTc-HMPAO in the same brains: analysis by statistical parametric mapping.

Science.gov (United States)

Hyun, Y; Lee, J S; Rha, J H; Lee, I K; Ha, C K; Lee, D S

2001-02-01

The purpose of this study was to investigate the differences between technetium-99m ethyl cysteinate dimer (99mTc-ECD) and technetium-99m hexamethylpropylene amine oxime (99mTc-HMPAO) uptake in the same brains by means of statistical parametric mapping (SPM) analysis. We examined 20 patients (9 male, 11 female, mean age 62+/-12 years) using 99mTc-ECD and 99mTc-HMPAO single-photon emission tomography (SPET) and magnetic resonance imaging (MRI) of the brain less than 7 days after onset of stroke. MRI showed no cortical infarctions. Infarctions in the pons (6 patients) and medulla (1), ischaemic periventricular white matter lesions (13) and lacunar infarction (7) were found on MRI. Split-dose and sequential SPET techniques were used for 99mTc-ECD and 99mTc-HMPAO brain SPET, without repositioning of the patient. All of the SPET images were spatially transformed to standard space, smoothed and globally normalized. The differences between the 99mTc-ECD and 99mTc-HMPAO SPET images were statistically analysed using statistical parametric mapping (SPM) 96 software. The difference between two groups was considered significant at a threshold of uncorrected P values less than 0.01. Visual analysis showed no hypoperfused areas on either 99mTc-ECD or 99mTc-HMPAO SPET images. SPM analysis revealed significantly different uptake of 99mTc-ECD and 99mTc-HMPAO in the same brains. On the 99mTc-ECD SPET images, relatively higher uptake was observed in the frontal, parietal and occipital lobes, in the left superior temporal lobe and in the superior region of the cerebellum. On the 99mTc-HMPAO SPET images, relatively higher uptake was observed in the medial temporal lobes, thalami, periventricular white matter and brain stem. These differences in uptake of the two tracers in the same brains on SPM analysis suggest that interpretation of cerebral perfusion is possible using SPET with 99mTc-ECD and 99mTc-HMPAO.

Óxidos Mistos de Al2O3/ZrO2 como Inibidores de Corrosão do Aço SAE 1020

Directory of Open Access Journals (Sweden)

Marcelo Rodrigues da Silva

2014-01-01

Full Text Available This paper describes the use of Al2O3/ZrO2 mixed oxides synthesized by sol-gel process with different amounts of ZrO2 (5%, 10%, 15% and 20% by mass in the Al2O3 matrix and different temperatures of calcination, such as interesting inhibitor materials of corrosive processes of SAE 1020 steel. The materials were characterized by Infrared Spectroscopy Fourier Transform (FTIR and X-Ray Diffraction (XRD techniques. FTIR spectra show the typical Al-O and Zr-O bonds vibrations in the mixed oxides. The XRD patterns of the samples calcined at 800 °C and 1000 °C shows the ZrO2 tetragonal and γ-Al2O3 face-centered cubic (FCC phases. The corrosion tests showed that the SAE 1020 steel covered with mixed oxides have an anodic passive region, thereby inhibiting the corrosive processes on the metal surface. Furthermore, the found values for steel coated with mixed oxide synthesized indicate a decrease in corrosion potentials (Ecor and corrosion current (icor. With respect to different samples of mixed oxides, the sample with 20 % of ZrO2 in the Al2O3 matrix proved to be the best inhibitor of steel corrosion, with the lowest values of corrosion potential and corrosion current, - 1.32 V and 0.31 μA cm-2, respectively.

21 CFR 99.205 - Application for exemption from the requirement to file a supplemental application.

Science.gov (United States)

2010-04-01

... minus the costs of goods sold and marketing and administrative expenses attributable to the new use of... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Application for exemption from the requirement to file a supplemental application. 99.205 Section 99.205 Food and Drugs FOOD AND DRUG ADMINISTRATION...

Apoptotic abscess imaging with {sup 99m}Tc-HYNIC-rh-Annexin-V

Energy Technology Data Exchange (ETDEWEB)

Penn, David L.; Kim, Christopher; Zhang, Kaijun; Mukherjee, Archana; Devakumar, Devadhas; Jungkind, Donald [Department of Radiology, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Thakur, Mathew L. [Department of Radiology, Thomas Jefferson University, Philadelphia, PA 19107 (United States)], E-mail: mathew.thakur@jefferson.edu

2010-01-15

Abscess formation causes systemic and localized up-regulation of neutrophil [polymorphonuclear leukocytes (PMNs)] signaling pathways. In the abscess, following bacterial ingestion or PMN activation by inflammatory mediators, PMN apoptosis is elevated and leads to the externalization of phosphatidylserine. Annexin-V (AnxV) has been shown to have high affinity to externalized phosphatidylserine. We hypothesized that {sup 99m}Tc-AnxV will target high densities of apoptotic PMNs and image abscesses. AnxV, conjugated with hydrazinenicaotinamide (HYNIC), was labeled with reduced {sup 99m}TcO{sub 4}{sup -} and its purity was determined by instant thin-layer chromatography. Apoptosis was induced in isolated human PMNs by incubation in 2% saline for 17 and 22 h at 37 deg. C. PMNs were then incubated with {sup 99m}Tc-HYNIC-AnxV and associated {sup 99m}Tc was determined. Abscesses were induced in mice by intramuscular injection of bacteria or turpentine. Following intravenous administration of {sup 99m}Tc-HYNIC-AnxV, mice were imaged and tissue distribution studied at 4 and 24 h. Radiochemical purity of {sup 99m}Tc-HYNIC-AnxV was 84.9{+-}8.11%. At 17 h, {sup 99m}Tc-HYNIC-AnxV bound to apoptotic PMNs was 71.6{+-}0.01% and 48.6{+-}0.01% for experimental and control cells, respectively (P=.002). At 22 h, experimental cells retained 74.9{+-}0.02% and control cells retained 47.2{+-}0.02% (P=.005). {sup 99m}Tc-HYNIC-AnxV associated with bacterial abscesses was 1.25{+-}0.09 and 3.75{+-}0.83 percent injected dose per gram (%ID/g) at 4 and 24 h compared to turpentine abscesses which was 1.02{+-}0.16 and 0.72{+-}0.17 %ID/g at 4 (P{<=}.05) and 24 h (P{<=}.01). {sup 99m}Tc-HYNIC-AnxV represents a minimally invasive and promising agent to image and potentially distinguish between infectious and inflammatory abscesses.

Relative roles of grey squirrels, supplementary feeding, and habitat in shaping urban bird assemblages.

Science.gov (United States)

Bonnington, Colin; Gaston, Kevin J; Evans, Karl L

2014-01-01

Non-native species are frequently considered to influence urban assemblages. The grey squirrel Sciurus carolinensis is one such species that is widespread in the UK and is starting to spread across Europe; it predates birds' nests and can compete with birds for supplementary food. Using distance sampling across the urbanisation intensity gradient in Sheffield (UK) we test whether urban grey squirrels influence avian species richness and density through nest predation and competition for supplementary food sources. We also assess how urban bird assemblages respond to supplementary feeding. We find that grey squirrels slightly reduced the abundance of breeding bird species most sensitive to squirrel nest predation by reducing the beneficial impact of woodland cover. There was no evidence that grey squirrel presence altered relationships between supplementary feeding and avian assemblage structure. This may be because, somewhat surprisingly, supplementary feeding was not associated with the richness or density of wintering bird assemblages. These associations were positive during the summer, supporting advocacy to feed birds during the breeding season and not just winter, but explanatory capacity was limited. The amount of green space and its quality, assessed as canopy cover, had a stronger influence on avian species richness and population size than the presence of grey squirrels and supplementary feeding stations. Urban bird populations are thus more likely to benefit from investment in improving the availability of high quality habitats than controlling squirrel populations or increased investment in supplementary feeding.

Relative roles of grey squirrels, supplementary feeding, and habitat in shaping urban bird assemblages.

Directory of Open Access Journals (Sweden)

Colin Bonnington

Full Text Available Non-native species are frequently considered to influence urban assemblages. The grey squirrel Sciurus carolinensis is one such species that is widespread in the UK and is starting to spread across Europe; it predates birds' nests and can compete with birds for supplementary food. Using distance sampling across the urbanisation intensity gradient in Sheffield (UK we test whether urban grey squirrels influence avian species richness and density through nest predation and competition for supplementary food sources. We also assess how urban bird assemblages respond to supplementary feeding. We find that grey squirrels slightly reduced the abundance of breeding bird species most sensitive to squirrel nest predation by reducing the beneficial impact of woodland cover. There was no evidence that grey squirrel presence altered relationships between supplementary feeding and avian assemblage structure. This may be because, somewhat surprisingly, supplementary feeding was not associated with the richness or density of wintering bird assemblages. These associations were positive during the summer, supporting advocacy to feed birds during the breeding season and not just winter, but explanatory capacity was limited. The amount of green space and its quality, assessed as canopy cover, had a stronger influence on avian species richness and population size than the presence of grey squirrels and supplementary feeding stations. Urban bird populations are thus more likely to benefit from investment in improving the availability of high quality habitats than controlling squirrel populations or increased investment in supplementary feeding.

Effect of milking efficiency on Tc-99 content of Tc-99m derived from Tc-99m generators

International Nuclear Information System (INIS)

Bonnyman, J.

1983-01-01

Tc-99m obtained by separation from its parent Mo-99 always contains Tc-99 produced by decay of Tc-99m and Mo-99. Factors effecting the Tc-99/Tc-99m ratios are discussed. An HPLC method has been developed to measure the 99 TcO 4- content of sodium pertechnetate from generators with a detection limit of 0.9 ng Tc-99 for a 500 μl/ aliquot of TcO 4- -99m. First eluates of 10 chromatograph-ic generators gave Tc-99/Tc-99m ratios ranging from 3.5-46 ng Tc/mCi Tc-99m measured at the time of milking. The measurements indicate that Tc-99/Tc-99m ratios high enough to cause adverse labelling effects could be found in 'instant pertechnetate' and in the first eluate from Tc-99m generators for the activities normally used in radiopharmaceutical production

Production technologies for molybdenum-99 and technetium-99m

International Nuclear Information System (INIS)

1999-02-01

Technetium-99m (6.02 h) is the most widely used radioisotope in nuclear medicine, accounting for more than 80% of all diagnostic nuclear medicine procedures. It is almost exclusively produced from the decay of its parent 99 Mo. The present sources of 99 Mo are research reactors by using the (n,γ) nuclear reaction with natural Mo ( 98 Mo, ∼24%), resulting in inexpensive but low-specific activity 99 Mo, or by neutron-induced fission of 235 U, which results in expensive but high specific activity 99 Mo. This publication covers several aspects related to the production of 99 Mo and 99m Tc. The contributed papers reflect the current status of the technology and discuss potential alternative methodologies for the production of 99 Mo and 99m Tc for medical use. The first four papers address the technologies using nuclear reactors, including the description of a new method using an aqueous homogenous reactor core for production of fission 99 Mo and the latest development efforts to fabricate 235 U low enriched targets (LEU, 235 U). The next five papers discuss the potential of utilizing particle accelerators and assess the current status of the available nuclear data for the production of both, 99 Mo and 99m Tc with proton and deuteron beams. The last paper discusses a new technology based on gel system for the preparation of 99 Mo/ 99m Tc generators using low specific activity 99 Mo produced in research reactors by the neutron activation of natural and inexpensive molybdenum oxide targets. Each individual paper was indexed and abstracted

34 CFR 99.39 - What definitions apply to the nonconsensual disclosure of records by postsecondary educational...

Science.gov (United States)

2010-07-01

... concerning crimes of violence or non-forcible sex offenses? 99.39 Section 99.39 Education Office of the Secretary, Department of Education FAMILY EDUCATIONAL RIGHTS AND PRIVACY May an Educational Agency or... 34 Education 1 2010-07-01 2010-07-01 false What definitions apply to the nonconsensual disclosure...

Coincident resection at both ends of random, γ-induced double-strand breaks requires MRX (MRN, Sae2 (Ctp1, and Mre11-nuclease.

Directory of Open Access Journals (Sweden)

James W Westmoreland

2013-03-01

Full Text Available Resection is an early step in homology-directed recombinational repair (HDRR of DNA double-strand breaks (DSBs. Resection enables strand invasion as well as reannealing following DNA synthesis across a DSB to assure efficient HDRR. While resection of only one end could result in genome instability, it has not been feasible to address events at both ends of a DSB, or to distinguish 1- versus 2-end resections at random, radiation-induced "dirty" DSBs or even enzyme-induced "clean" DSBs. Previously, we quantitatively addressed resection and the role of Mre11/Rad50/Xrs2 complex (MRX at random DSBs in circular chromosomes within budding yeast based on reduced pulsed-field gel electrophoretic mobility ("PFGE-shift". Here, we extend PFGE analysis to a second dimension and demonstrate unique patterns associated with 0-, 1-, and 2-end resections at DSBs, providing opportunities to examine coincidence of resection. In G2-arrested WT, Δrad51 and Δrad52 cells deficient in late stages of HDRR, resection occurs at both ends of γ-DSBs. However, for radiation-induced and I-SceI-induced DSBs, 1-end resections predominate in MRX (MRN null mutants with or without Ku70. Surprisingly, Sae2 (Ctp1/CtIP and Mre11 nuclease-deficient mutants have similar responses, although there is less impact on repair. Thus, we provide direct molecular characterization of coincident resection at random, radiation-induced DSBs and show that rapid and coincident initiation of resection at γ-DSBs requires MRX, Sae2 protein, and Mre11 nuclease. Structural features of MRX complex are consistent with coincident resection being due to an ability to interact with both DSB ends to directly coordinate resection. Interestingly, coincident resection at clean I-SceI-induced breaks is much less dependent on Mre11 nuclease or Sae2, contrary to a strong dependence on MRX complex, suggesting different roles for these functions at "dirty" and clean DSB ends. These approaches apply to resection at

12038_2016_9630_Supplementary 1..4

Indian Academy of Sciences (India)

Supplementary file 2. b a. HiSeq dataset with SRA accession number SRR892664 and read length 150 bases. (H. sapiens), b. MiSeq dataset with SRA accession number ERP000362 and read length 250 bases (H. sapiens), c. GA IIx dataset with SRA accession number SRR660877 and read length 91 bases (H. sapiens), ...

Differentiation of malignant and degenerative benign bone disease using Tc-99m Citrate and Tc-99m MDP scintigraphy

International Nuclear Information System (INIS)

Jin, J.; Guo, R.; Li, S.-J.; Ren, Y.; Zhang, C.; Zhang, X.

2007-01-01

Full text: For the evaluation of bone metastases in patients (pts) with cancer, 99mTcMDP bone scintigraphy is an important tool, but some limitations exist. One of these is the differential diagnosis of malignant and degenerative benign bone disease. The aim of this study was to differentiate them using 99mTcCitrate and 99mTcMDP scintigraphy. Methods: 39 pts (92 lesions) with known malignant or degenerative benign bone disease were studied. 23 pts had malignant bone disease (48 lesions, group 1), the other 16 pts had degenerative benign bone disease (44 lesions, group2), for which the results of 99mTcMDP scintigraphy were positive. In both groups, 99mTcCitrate scintigraphy was performed within a time interval of 2-7 days after 99mTcMDP scintigraphy (555∼740MBq. static, 3hr, planar or SPECT i m a g e s w h e n r e q u i r e d ) . The 99mTccitrate/99mTcMDP lesion-to-background radioisotope uptake ratio (RUR) was calculated for each lesion. Conventional techniques (histopathology, X-ray, CT, MRI and clinical follow up) were considered to be proof of the presence of bone metastases and degenerative benign bone disease. Results: Uptake of 99mTcMDP in the two groups is the same (1.96±0.25 vs. 1.87±0.21; t=1.178, P>0.20), while in 99mTcCitrate image, malignant lesions demonstrated a higher uptake of lesion activity than that of benign degenerative lesions (1.47±0.42 vs. 1.09±0.38; t=2.887, P<0.01). The mean 99mTccitrate/99mTcMDP RUR in the malignant group was significantly higher than the mean in the benign group (0.78±0.21 vs. 0.54±0.19; t=3.646, P<0.001). Conclusions: The preliminary results of the study confirm the usefulness and feasibility of 99mTcCitrate scintigraphy for differentiating malignant from benign degenerative lesions seen as areas of increased activity on 99mTcMDP bone scintigraphy. (author)

29 CFR 37.99 - If the Director concludes that compliance cannot be secured by voluntary means, what actions must...

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true If the Director concludes that compliance cannot be secured by voluntary means, what actions must he or she take? 37.99 Section 37.99 Labor Office of the... INVESTMENT ACT OF 1998 (WIA) Compliance Procedures § 37.99 If the Director concludes that compliance cannot...

Basic and supplementary sensory feedback in handwriting

Science.gov (United States)

Danna, Jérémy; Velay, Jean-Luc

2015-01-01

The mastering of handwriting is so essential in our society that it is important to try to find new methods for facilitating its learning and rehabilitation. The ability to control the graphic movements clearly impacts on the quality of the writing. This control allows both the programming of letter formation before movement execution and the online adjustments during execution, thanks to diverse sensory feedback (FB). New technologies improve existing techniques or enable new methods to supply the writer with real-time computer-assisted FB. The possibilities are numerous and various. Therefore, two main questions arise: (1) What aspect of the movement is concerned and (2) How can we best inform the writer to help them correct their handwriting? In a first step, we report studies on FB naturally used by the writer. The purpose is to determine which information is carried by each sensory modality, how it is used in handwriting control and how this control changes with practice and learning. In a second step, we report studies on supplementary FB provided to the writer to help them to better control and learn how to write. We suggest that, depending on their contents, certain sensory modalities will be more appropriate than others to assist handwriting motor control. We emphasize particularly the relevance of auditory modality as online supplementary FB on handwriting movements. Using real-time supplementary FB to assist in the handwriting process is probably destined for a brilliant future with the growing availability and rapid development of tablets. PMID:25750633

Observation Versus Embolization in Patients with Blunt Splenic Injury After Trauma: A Propensity Score Analysis.

Science.gov (United States)

Olthof, Dominique C; Joosse, Pieter; Bossuyt, Patrick M M; de Rooij, Philippe P; Leenen, Loek P H; Wendt, Klaus W; Bloemers, Frank W; Goslings, J Carel

2016-05-01

Non-operative management (NOM) is the standard of care in hemodynamically stable patients with blunt splenic injury after trauma. Splenic artery embolization (SAE) is reported to increase observation success rate. Studies demonstrating improved splenic salvage rates with SAE primarily compared SAE with historical controls. The aim of this study was to investigate whether SAE improves success rate compared to observation alone in contemporaneous patients with blunt splenic injury. We included adult patients with blunt splenic injury admitted to five Level 1 Trauma Centers between January 2009 and December 2012 and selected for NOM. Successful treatment was defined as splenic salvage and no splenic re-intervention. We calculated propensity scores, expressing the probability of undergoing SAE, using multivariable logistic regression and created five strata based on the quintiles of the propensity score distribution. A weighted relative risk (RR) was calculated across strata to express the chances of success with SAE. Two hundred and six patients were included in the study. Treatment was successful in 180 patients: 134/146 (92 %) patients treated with observation and 48/57 (84 %) patients treated with SAE. The weighted RR for success with SAE was 1.17 (0.94-1.45); for complications, the weighted RR was 0.71 (0.41-1.22). The mean number of transfused blood products was 4.4 (SD 9.9) in the observation group versus 9.1 (SD 17.2) in the SAE group. After correction for confounders with propensity score stratification technique, there was no significant difference between embolization and observation alone with regard to successful treatment in patients with blunt splenic injury after trauma.

Tumor affinity of technetium-99m labeled radiopharmaceuticals. II. Sup(99m)Tc-Sn-diphosphonate (sup(99m)Tc-EHDP), sup(99m)Tc-Sn-dimercaptosuccinic acid (sup(99m)Tc-DMSA), sup(99m)Tc-Sn-diethyl stilbestrol diphosphate (sup(99m)Tc-DSDP)

Energy Technology Data Exchange (ETDEWEB)

Itoh, K; Kobayashi, S; Hisada, K; Tonami, N [Kanazawa Univ. (Japan). School of Medicine; Ando, A

1976-10-01

The authors have examined the tumor affinity of various sup(99m)Tc-labelled radiopharmaceuticals to Ehrlich's tumor for the purpose of delineating human malignant neoplasm positively. The biologic distributions of sup(99m)Tc-Sn-diphosphonate (sup(99m)Tc-EHDP), sup(99m)Tc-Sn-dimercaptosuccinic acid (sup(99m)Tc-DMSA) and sup(99m)Tc-Sn-diethyl stilbestrol diphosphate (sup(99m)Tc-DSDP, sup(99m)Tc-Honvan) are included as the second report on the tumor affinity of Ehrlich-bearing mice. Tumor concentration of sup(99m)Tc-EHDP was lowest and the positive delineation of implanted tumor with sup(99m)Tc-EHDP was poorest in sequential images, though active accumulation in some soft tissues malignant neoplasms, breast cancer, and thyroid cancer, has been reported. Tumor concentration and the tumor-to-blood ratio of sup(99m)Tc-DMSA were not so high, contrary to our expectation that /sup 197/Hg-DMSA might show high tumor concentration and high tumor-to-blood ratio the same as /sup 197/Hg chlormerodrin of the renal scanning radiopharmaceuticals. Tumor concentration of sup(99m)Tc-DSDP was highest. The tumor-to-blood concentration ratio was lower than that of the above mentioned radiopharmaceuticals but the tumor-to-liver ratio and/or tumor-to-lung ratio was over 1.0 at the earlier time. Biologic distribution of sup(99m)Tc-DSDP was similar to that of /sup 32/P labeled DSDP. It is presumed that sup(99m)Tc is labeled at the phosphate ester of DSDP which is dephospholytated immediately by phospholylase in vivo following intravenous injection. Although it is not known precisely it may be assumed that the mechanism of accumulating sup(99m)Tc-DSDP in Ehrlich's tumor is related to the phospholylase activity in neoplasms.

Diversification of 99Mo/99mTc separation: non–fission reactor production of 99Mo as a strategy for enhancing 99mTc availability.

Science.gov (United States)

Pillai, Maroor R A; Dash, Ashutosh; Knapp, Furn F Russ

2015-01-01

This paper discusses the benefits of obtaining (99m)Tc from non-fission reactor-produced low-specific-activity (99)Mo. This scenario is based on establishing a diversified chain of facilities for the distribution of (99m)Tc separated from reactor-produced (99)Mo by (n,γ) activation of natural or enriched Mo. Such facilities have expected lower investments than required for the proposed chain of cyclotrons for the production of (99m)Tc. Facilities can receive and process reactor-irradiated Mo targets then used for extraction of (99m)Tc over a period of 2 wk, with 3 extractions on the same day. Estimates suggest that a center receiving 1.85 TBq (50 Ci) of (99)Mo once every 4 d can provide 1.48-3.33 TBq (40-90 Ci) of (99m)Tc daily. This model can use research reactors operating in the United States to supply current (99)Mo needs by applying natural (nat)Mo targets. (99)Mo production capacity can be enhanced by using (98)Mo-enriched targets. The proposed model reduces the loss of (99)Mo by decay and avoids proliferation as well as waste management issues associated with fission-produced (99)Mo.

THE COURT’S COMPETENCE TO DISMISS THE SUPPLEMENTARY SANCTION

Directory of Open Access Journals (Sweden)

Eugenia IOVĂNAȘ

2017-05-01

Full Text Available According to art. 34 par. 1 from the UGO no. 34/2001, the court settling the complaint against the offence notice, verifying the legality and substantiality of same, decides on the sanction without distinguishing between the main and the supplementary sanctions. From corroborating these legal provisions with the stipulations under art. 5 from the same normative act, according to which the established sanction must be proportional with the degree of social danger of the committed act, without making differences between the types of sanctions, as well as those of art. 5 and art. 6 according to which the supplementary sanctions are to be applied depending on the nature and seriousness of the fact, it results that the law enforcer has also decided on the right of the court to assess inclusively the proportionality of the sanction in case of applying the supplementary measures, not only in applying main sanctions. And this is so because the proportionality of the committed act and its consequences is one of the requirements demanded by the ECHR jurisprudence in the matter of applying any rights restrictive measures.

76 FR 64285 - Airworthiness Directives; Thielert Aircraft Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125...

Science.gov (United States)

2011-10-18

... Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125-01 Reciprocating Engines AGENCY: Federal Aviation... substance. But we have found it necessary to reduce the initial compliance time for TAE 125-02-99 engines... about 370 TAE 125-01 and TAE 125-02-99 reciprocating engines installed on products of U.S. registry. We...

Investigating the status of supplementary tuition in the teaching and learning of mathematics

Directory of Open Access Journals (Sweden)

David Mogari

2009-09-01

Full Text Available The study seeks to investigate the status of supplementary tuition in the teaching and learning of mathematics and mathematical literacy. The study followed a descriptive survey design involving the use of learner and teacher questionnaires. A convenient sample of mathematics and mathematical literacy teachers together with a stratified sample of their Grade 11 learners were drawn from a purposive sample of highperforming high schools in the East London district of the Eastern Cape, South Africa. The results show that supplementary tuition is popular, especially among girls, and it is in three forms (i.e. private tuition, vacation school and problem-solving classes: Problemsolving classes dominated by working on past/model examination papers is the most preferred; in some instances supplementary tuition is offered for a fee; it is not only confined to poor performing learners; and participation in supplementary tuition is influenced by a variety of factors.

Methodology for the determination of environmental technetium-99

International Nuclear Information System (INIS)

Anderson, T.J.

1979-01-01

A mass spectrometric isotope dilution technique was developed with 97 Tc as a yield tracer to measure as little as 0.1 pg of environmental 99 Tc. A unique aspect of the method is loading the sample into the mass spectrometer in the form of a single ion-exchange resin bead, thereby improving the signal-to-noise ratio over conventional solution loading. Application of a modified method detected 99 Tc in samples from around Savannah River Plant's seepage basins and confirmed its high mobility in the local water-saturated soil

Status of Tc-99m and 99Mo/99mTc generator production in Bangladesh

International Nuclear Information System (INIS)

Abedin, Md. Zainul; Haque, Md. Azizul; Ali, Md. Ramjan; Hossain, Md. Anwar; Razzaque, Md. Abdur; Yasmin, Lyzu; Waheed, M. Fatima; Akhter, Rabeya; Mondal, Rafiuddin

2007-01-01

Radioisotope Production Division (RIPD) produced instant technetium-99m by solvent extraction method for several years. On R and D basis, the division produced portable sterile Tc-99m sublimation generator by irradiating titanium molybdate in the reactor. The division produced (4/batch) from imported fission Mo-99 till June 2005. Since August 2005, as per demand of the government hospitals, the division have been producing 12-14 pieces of 15 GBq chromatographic 99m Tc-generators weekly by using the new generator production plant installed last year having online Mo-99 loading system with the of producing 50 generator per batch. Development of PZC and (n,γ) 99 Mo based generator holds potential in Bangladesh. (author)

Pharmaceutical grade sodium (99mTc) pertechnetate from 99Mo/99mTc-TCM-Autosolex generator

International Nuclear Information System (INIS)

Chattopadhyay, Sankha; Barua, Luna; Das, Sujata Saha

2014-01-01

Technetium-99m (T 1/2 = 6.02h; 140.51 keV (89%)) is the most useful radioisotope in diagnostic nuclear medicine. More than 80% of all diagnostic procedures done worldwide in nuclear medicine centre are performed with 99m Tc. Worldwide crisis of fission 99 Mo based generator in recent past had put the nuclear medicine fraternity in very harsh situation. In order to have an indigenous solution of this problem, we tried to develop a computer controlled semi automated 99 Mo/ 99m Tc generator using MEK solvent extraction technique, which utilizes abundantly available 99 Mo produced by (n,γ) reaction in BARC reactors. The aim of this work is to provide a more reliable, computer controlled module (TCM- AUTOSOLEX) for the recovery of pharmaceutical grade 99m Tc from low specific activity 99 Mo based on solvent extraction methodology

Supplementary household water sources to augment potable ...

African Journals Online (AJOL)

This paper addresses on-site supplementary household water sources with a focus on groundwater abstraction, rainwater harvesting and greywater reuse as available non-potable water sources to residential consumers. An end-use model is presented and used to assess the theoretical impact of household water sources ...

Supplementary data: Materials and methods RNA expression ...

Indian Academy of Sciences (India)

ritt8

Supplementary data: Materials and methods. RNA expression analysis. Freshly collected tissue was taken in TRIzol reagent for total RNA isolation according to the manufacturer's protocol. The cDNA synthesis was carried out in 1 μg total RNA using Random hexamer (Invitrogen, Carlsbad, USA) and Superscript III ...

49 CFR 805.735-17 - Supplementary statements.

Science.gov (United States)

2010-10-01

... SAFETY BOARD EMPLOYEE RESPONSIBILITIES AND CONDUCT § 805.735-17 Supplementary statements. Changes in, or additions to, the information contained in an employee's statement of employment and financial interests.... Notwithstanding the filing of the annual report required by this section, each employee shall at all times avoid...

The effect of receiving supplementary UI benefits on unemployment duration

DEFF Research Database (Denmark)

Tomi, Kyyrä,; Pierpaolo, Parrotta,; Rosholm, Michael

2013-01-01

insurance benefit receipt. We find evidence of a negative in-treatment effect and a positive post-treatment effect, both of which vary across different groups of individuals. The resulting net effect on the expected unemployment duration is positive for some groups (e.g. married women) and negative......We consider the consequences of working part-time and receiving supplementary benefits for part-time unemployment in the Danish labor market. Following the timing-of-events approach we estimate causal effects of part-time work with supplementary benefits on the hazard rate out of unemployment...

75 FR 7996 - Airworthiness Directives; Thielert Aircraft Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02...

Science.gov (United States)

2010-02-23

... Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02-99 Reciprocating Engines Installed in, But Not Limited...-99 engines, initial and repetitive replacements of the PPRV, and installation of a vibration isolator..., we estimate that this proposed AD would affect about 300 TAE 125-01 and TAE 125-02-99 reciprocating...

25 CFR 36.99 - Are immunizations required for residential program students?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Are immunizations required for residential program... SITUATIONS Homeliving Programs Program Requirements § 36.99 Are immunizations required for residential program students? Each student must have all immunizations required by State, local, or tribal governments...

Summary Report on the SAE 2016 Range Extenders for Electric Vehicles Symposium

Energy Technology Data Exchange (ETDEWEB)

Curran, Scott [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wagner, Robert M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Campbell, Russ [SRA International, Inc., Arlington, VA (United States)

2017-03-01

The SAE 2016 Range Extenders for Electric Vehicles Symposium was a 2-day technical meeting focused on the role of advanced internal combustion engines (ICEs) and other novel energy converter technologies for extending the range of electric vehicles (EVs). The first-of-its-kind symposium was notable for focusing solely on the range extender (REx) technologies and not the EVs. The technical program featured presentations from international leaders from industry, government, national laboratories, and academia. The opening keynote presentations covered a broad range of topics including consumer behavior, policy implications, regulatory considerations, and REx architectures as enablers for advanced technologies. The technical sessions focused on an array of REx technologies including conventional ICEs, as well as less conventional or emerging technologies such as microturbines, fuel cells, low-temperature combustion engines, and aluminum-air batteries. The symposium included two panel sessions. The trend toward increasing vehicle electrification and the changing role of ICEs and other auxiliary power unit technologies for use as REx’s is leading to new research and design development needs. The symposium captured the interest of the industry and research communities in exploring the opportunities and challenges associated with REx’s for EVs. This report includes key takeaways, summarized below, and draft notes for each presentation and panel discussion.

Technetium-99m-sestamibi scintigraphy in breast nodes; Estudo cintilografico de nodulos mamarios com tecnecio-99m-sestamibi

Energy Technology Data Exchange (ETDEWEB)

Pellini, Marcos Pinto; Fonseca, Lea Mirian Barbosa da [Universidade Federal, Rio de Janeiro, RJ (Brazil). Faculdade de Medicina; Balen, Jacir Luiz; Fabricio, Maria Ines Menescal [Universidade Federal, Rio de Janeiro, RJ (Brazil). Faculdade de Medicina. Inst. de Ginecologia; Amarante Junior, Jose Luiz de Medeiros

1997-01-01

The purpose was to was to determine if technetium-99m-sestamibi accumulates preferentially within the malignant palpable nodes of breast. Twenty-five patients, mean age 36.16 ({+-} 9.34) year, and without any other additional information, underwent breast scintigraphy and excisional biopsy. We had nineteen true-negative cases, four true-positive, two false-positive and none false-negative. Sensitivity, 100% specificity, 90.5%, accuracy, 92%; PPV, 66.7%, NPV, 100%. The four true positive were invasive intraductal carcinomas and one of them metastases in auxiliary lymph-nodes, confirmed in biopsy and well defined in scintigraphy. The two false-positives were a fibroadenoma with high cellularity and a fibrodisplasy surrounded by chronic inflammatory process. Two statistical tests were applied: chi-square and Fisher. Both rejected the antithesis at a confidence interval of 99% (p , 0.01) We concluded that technetium-99-sestamibi accumulates preferentially within the malignant nodes of breast. (author) 17 refs., 3 figs., 2 tabs.

75 FR 70268 - Submission for OMB Review; Comment Request; NIH NCI Central Institutional Review Board (CIRB...

Science.gov (United States)

2010-11-17

... each time the person contacts the helpdesk. Frequency of Response: Once, except for the SAE Reviewer... Statistical Reviewer Form 20 1 2 hours 40 (Attachment 6J). Board Members CIRB SAE Reviewer Worksheet 10 15 30... 4140-01-P ...

9 CFR 201.99 - Purchase of livestock by packers on a carcass grade, carcass weight, or carcass grade and weight...

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Purchase of livestock by packers on a carcass grade, carcass weight, or carcass grade and weight basis. 201.99 Section 201.99 Animals and Animal... livestock by packers on a carcass grade, carcass weight, or carcass grade and weight basis. (a) Each packer...

Diseño y construcción del múltiple de escape para el motor Yamaha FZR600 de la formula SAE

OpenAIRE

Calle Solís, Eloy Tarquino; Rivas Macero, Dorian Alberto

2014-01-01

El documento consiste en la búsqueda de un diseño óptimo de múltiple de escape para implementarlo en el motor Yamaha FZR600 del prototipo Formula SAE. Este elemento debe brindar un buen funcionamiento del motor, cumplir con las normas del reglamento en cuanto a: ubicación dentro del chasis del monoplaza, niveles de ruido del motor, costo y medidas de seguridad que impone la competencia Formula Student. The document consists in the way to search an optimal design of the exhaust system in th...

Accuracy of 99Molybdenum assays in /sup 99m/Technetium solutions

International Nuclear Information System (INIS)

Williams, C.C.; Kereiakes, J.G.; Grossman, L.W.

1981-01-01

A study was performed to determine the accuracy of 99 Mo measurements using three commercial dose calibrators with their 99 Mo assay shields. One 99 Mo assay shield allowed excessive penetration by the lower energy /sup 99m/Tc photons, resulting in the calibrator's falsely high interpretation of the activity of 99 Mo present in the high-activity /sup 99m/Tc eluates. All three calibrators performed adequately with a National Bureau of Standards 99 Mo standard in equilibrium with /sup 99m/Tc. By using low-activity aliquots of 99 Mo and /sup 99m/Tc, a low-level linearity test was performed. Only one of the calibrators was found to reflect accurately the activity of 99 Mo present under all conditions tested

34 CFR 99.60 - What functions has the Secretary delegated to the Office and to the Office of Administrative Law...

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false What functions has the Secretary delegated to the Office and to the Office of Administrative Law Judges? 99.60 Section 99.60 Education Office of the Secretary, Department of Education FAMILY EDUCATIONAL RIGHTS AND PRIVACY What Are the Enforcement Procedures? § 99.60 What functions has the Secretary...

Study of methodologies for quality control of 99Mo used in 99Mo/99mTc generators

International Nuclear Information System (INIS)

Said, Daphne de Souza

2016-01-01

99m Tc is the most used radionuclide in nuclear medicine. In Brazil, the 99 Mo/ 99m Tc generators are exclusively produced by Radiopharmacy Center at IPEN-CNEN/ SP, by importing 99 Mo from different suppliers. 99 Mo (t 1/2 = 66 h) is a fission product of 235 U and it can have radionuclidic impurities that are prejudicial for human health. For safe use of generators, it is necessary to perform the evaluation of 99 Mo by quality control tests in order to assess if 99 Mo complies with the specifications. The European Pharmacopoeia (EP) presents a monograph for evaluation of the quality of the [ 99 Mo] solution as sodium molybdate,that is used as raw material for 99 Mo/ 99m Tc generators production, including specification parameters (identification, radiochemical purity and radionuclidic purity), analysis methods and limits. However, it has been observed difficulties on the execution and implementation of these methods by the generators producers, with a few literature about this subject, probably due to complexity of the proposed methods. In this work, many quality control parameters of 99 Mo described in the EP monograph were evaluated. Separation methods for 99M o from its radionuclidic impurities by solid phase extraction (SPE) and TLC were studied. After SPE separation, the quantification of metals by ICP-OES to evaluate the percentage of retention of Mo and the percentage of recovery of Ru, Te and Sr using different types of cartridges were proposed, replacing radiotracers use. It was observed that the specific type of SPE cartridge recommended by the EP for separation of 99 Mo presented low recoveries for Ru, compared to other available anion exchange SPE cartridges. 99 Mo samples from different worldwide suppliers were analyzed. It was observed that quantification of 103 Ru in 99 Mo samples with decay time higher than 4 weeks is possible. An alternative method for separation of 131 I from 99 Mo showed promising results by TLC. The quantification of beta and

Comparison of Tc-99m maraciclatide and Tc-99m sestamibi molecular breast imaging in patients with suspected breast cancer.

Science.gov (United States)

O'Connor, Michael K; Morrow, Melissa M B; Hunt, Katie N; Boughey, Judy C; Wahner-Roedler, Dietlind L; Conners, Amy Lynn; Rhodes, Deborah J; Hruska, Carrie B

2017-12-01

Molecular breast imaging (MBI) performed with 99m Tc sestamibi has been shown to be a valuable technique for the detection of breast cancer. Alternative radiotracers such as 99m Tc maraciclatide may offer improved uptake in breast lesions. The purpose of this study was to compare relative performance of 99m Tc sestamibi and 99m Tc maraciclatide in patients with suspected breast cancer, using a high-resolution dedicated gamma camera for MBI. Women with breast lesions suspicious for malignancy were recruited to undergo two MBI examinations-one with 99m Tc sestamibi and one with 99m Tc maraciclatide. A radiologist interpreted MBI studies in a randomized, blinded fashion to assign an assessment score (1-5) and measured lesion size. Lesion-to-background (L/B) ratio was measured with region-of-interest analysis. Among 39 analyzable patients, 21 malignant tumors were identified in 21 patients. Eighteen of 21 tumors (86%) were seen on 99m Tc sestamibi MBI and 19 of 21 (90%) were seen on 99m Tc maraciclatide MBI (p = 1). Tumor extent measured with both radiopharmaceuticals correlated strongly with pathologic size ( 99m Tc sestamibi, r = 0.84; 99m Tc maraciclatide, r = 0.81). The L/B ratio in detected breast cancers was similar for the two radiopharmaceuticals: 1.55 ± 0.36 (mean ± S.D.) for 99m Tc sestamibi and 1.62 ± 0.37 (mean ± S.D.) for 99m Tc maraciclatide (p = 0.53). No correlation was found between the L/B ratio and molecular subtype for 99m Tc sestamibi (r s  = 0.12, p = 0.63) or 99m Tc maraciclatide (r s  = -0.12, p = 0.64). Of 20 benign lesions, 10 (50%) were seen on 99m Tc sestamibi and 9 of 20 (45%) were seen on 99m Tc maraciclatide images (p = 0.1). The average L/B ratio for benign lesions was 1.34 ±0.40 (mean ±S.D.) for 99m Tc sestamibi and 1.41 ±0.52 (mean ±S.D.) for 99m Tc maraciclatide (p = 0.75). Overall diagnostic performance was similar for both radiopharmaceuticals. AUC from ROC

Current status of production and supply of molybdenum-99 and 99Mo/99mTc generators in Indonesia

International Nuclear Information System (INIS)

Mutalib, A.

2003-01-01

Production of high-specific activity molybdenum-99 and 99 Mo/ 99m Tc Generators in Indonesia commenced when a new production facility supported by the presence of a 30 MW multipurpose reactor (RSG-GAS) was established in Serpong in 1990. This report describes the current production and supply of molybdenum-99m devoted mainly to fulfill the domestic demands in supplying 99 Mo/ 99m Tc Generators. Recent development on the use of LEU (Low Enriched Uranium) targets for replacing current HEU (High Enriched Uranium) targets in the production of 99 Mo will be reviewed briefly. (author)

Diversification of income in rural areas: the issue of supplementary activities on farms in Slovenia

Directory of Open Access Journals (Sweden)

Irma Potočnik Slavič

2002-12-01

Full Text Available The issue on supplementary activities on farms as also their impact on farm income does not represent a new phenomena in Slovenia, but a new fluorishing wave is to be seen in the last decade in the area of diversification and extent. The article analyses the motives of accelerated development of supplementary activities, reveals the newest legislation and through the case study of farms in Ljubljana basin indicates the geographical aspect of supplementary activities on farms.

Supplementary data: Eucalyptus microsatellites mined in silico ...

Indian Academy of Sciences (India)

Supplementary data: Eucalyptus microsatellites mined in silico: survey and evaluation. R. Yasodha, R. Sumathi, P. Chezhian, S. Kavitha and M. Ghosh. J. Genet. 87, XX-XX. Tm. CT. 2222. NA. 60 125. 192. Table 1. List of EST-SSR primers developed for E. globulus. No. of. Tm Product. Acc. no. SSR repeats. Forward primer.

Measurement of Mo-99 column activity in the evaluation of Mo-99/Tc-99m generator

International Nuclear Information System (INIS)

Kuster, Z.

1994-01-01

In order to calculate the real elution efficiency of Mo-99/Tc-99m generator the Mo-99 content on the column has to be previously determined. As found in this work, the external measurement of Mo-99-column activity by means of Geiger-Mueller counter is a simple, fast and reliable method. Generally, Mo-99-column is placed slightly out of the center of the generator; therefore the externally measured flux of photons (φ) is an angular-dependent function. If the thickness of the lead container is radially uniform, the flux measured at some distance from the generator (which is rotated in 2π/3 steps) is given by the equation φ = A (1 + Bcos (α-2π(i - 2)/3)) -1 , i=1,2 or 3 (Eq.1) where A is a numerical constant depending on the Mo-99-column activity, B is a numerical constant depending on the Mo-99- column position within the lead container, the angle α depends on the initial orientation of the generator. A total of 20 generator were studied. The measured Mo-99-column activities (Capintec dose calibrator) were in the range 13.1- 35.11 GBq. Contrary to the findings of Vinberg and Kristensen (Eur J Nucl Med 1/1976(219), values of A (Eq. 1) are in good correlation (r 2 =0.9794) with the measured Mo-99-column activities. (author)

Failure of supplementary ultraviolet radiation to enhance flower color under greenhouse conditions

Energy Technology Data Exchange (ETDEWEB)

Klein, R. M. [University of Vermont, Burlington, VT (United States)

1990-03-15

In order to determine whether the concentration of floral petal anthocyanin pigments could be increased, ultraviolet radiations in the UV-A and UV-B wavelength bands were presented to a variety of flowering plants to partly restore those wavelengths filtered out by greenhouse glass. In no tested plant did the supplementary ultraviolet radiation enhance floral anthocyanin content. Supplementary UV radiation has no economic value in greenhouse production of flowering plants. (author)

Blood cell labeling with technetium-99m, (2)

International Nuclear Information System (INIS)

Uchida, Tatsumi; Yoshida, Hiroshi; Matsuda, Shin; Kimura, Hideo; Miura, Nobuo

1978-01-01

Using a labeling method with sup(99m)Tc-pertechnetate to red blood cells (RBC), circulating blood volume was measured in comparison with that from 51 Cr-labeled RBC method. The technique is easier than already published methods, because CIS kit for sup(99m)Tc-RBC labeling (TCK-11) became to be available recently. Two mls of ACD-anticoagulated blood were withdrawn and 0.5 ml of reducing reagent prepared just before use was added to blood, waiting 5 minutes and discarding the serum after centrifugation, then adding 100 μCi of sup(99m)Tc. After washing the labeled cells by isotonic saline, cells were re-suspended in 10 ml of saline and injected to the subject. Blood specimen was obtained 10, 30, 60 and 120 minutes after infusion and blood volume was calculated by the usual way. Circulating blood volume by sup(99m)Tc was well correlated with that by 51 Cr (=0.98, p 0.01), however, the value calculated from sup(99m)Tc were 4.8 percent higher than those by 51 Cr, which suggested the elution of sup(99m)Tc from labeled RBC. sup(99m)Tc method has the advantages that higher radioactivity can be obtained in small amount of blood, which is useful in the determination of blood volume in children or in small animals in the laboratory. The measurement of blood volume of the mouse was done by using sup(99m)Tc method. The results were 1.70 +- 0.06 ml (6.35 +- 0.18%/gm), which coincided with the values reported previously. Because of it's short half life and low radiation dosage to the patients, sup(99m)Tc method will be recommended in the field of pediatrics or in patients with polycythemia or congestive heart failure, who are requested the repeated measurement of blood volume. (auth.)

1 SUPPLEMENTARY INFORMATION A novel zinc(II) complex ...

Indian Academy of Sciences (India)

BİLGİSAYAR

1. SUPPLEMENTARY INFORMATION. A novel zinc(II) complex containing square pyramidal, octahedral and tetrahedral geometries on the same polymeric chain constructed from pyrazine-2,3-dicarboxylic acid and 1-vinylimidazole. HAKAN YILMAZ* and OMER ANDAC. Department of Chemistry, Ondokuz Mayis University, ...

Different uptake of {sup 99m}Tc-ECD and {sup 99m}Tc-HMPAO in the same brains: analysis by statistical parametric mapping

Energy Technology Data Exchange (ETDEWEB)

Hyun, I.Y. [Dept. of Nuclear Medicine, Inha University College of Medicine, Incheon (Korea); Lee, J.S.; Lee, D.S. [Dept. of Nuclear Medicine, Seoul National University College of Medicine, Seoul (Korea); Rha, J.H.; Lee, I.K.; Ha, C.K. [Dept. of Neurology, Inha University College of Medicine, Incheon (Korea)

2001-02-01

The purpose of this study was to investigate the differences between technetium-99m ethyl cysteinate dimer ({sup 99m}Tc-ECD) and technetium-99m hexamethylpropylene amine oxime ({sup 99m}Tc-HMPAO) uptake in the same brains by means of statistical parametric mapping (SPM) analysis. We examined 20 patients (9 male, 11 female, mean age 62{+-}12 years) using {sup 99m}Tc-ECD and {sup 99m}Tc-HMPAO single-photon emission tomography (SPET) and magnetic resonance imaging (MRI) of the brain less than 7 days after onset of stroke. MRI showed no cortical infarctions. Infarctions in the pons (6 patients) and medulla (1), ischaemic periventricular white matter lesions (13) and lacunar infarction (7) were found on MRI. Split-dose and sequential SPET techniques were used for {sup 99m}Tc-ECD and {sup 99m}Tc-HMPAO brain SPET, without repositioning of the patient. All of the SPET images were spatially transformed to standard space, smoothed and globally normalized. The differences between the {sup 99m}Tc-ECD and {sup 99m}Tc-HMPAO SPET images were statistically analysed using statistical parametric mapping (SPM) 96 software. The difference between two groups was considered significant at a threshold of uncorrected P values less than 0.01. Visual analysis showed no hypoperfused areas on either {sup 99m}Tc-ECD or {sup 99m}Tc-HMPAO SPET images. SPM analysis revealed significantly different uptake of {sup 99m}Tc-ECD and {sup 99m}Tc-HMPAO in the same brains. On the {sup 99m}Tc-ECD SPET images, relatively higher uptake was observed in the frontal, parietal and occipital lobes, in the left superior temporal lobe and in the superior region of the cerebellum. On the {sup 99m}Tc-HMPAO SPET images, relatively higher uptake was observed in the medial temporal lobes, thalami, periventricular white matter and brain stem. These differences in uptake of the two tracers in the same brains on SPM analysis suggest that interpretation of cerebral perfusion is possible using SPET with {sup 99m}Tc-ECD and

Provision of supplementary food for wild birds may increase the risk of local nest predation

OpenAIRE

Hanmer, Hugh J.; Thomas, Rebecca L.; Fellowes, Mark D. E.

2017-01-01

In countries such as the UK, USA and Australia, approximately half of households provide supplementary food for wild birds, making this the public’s most common form of active engagement with nature. Year round supplementary feeding is currently encouraged by major conservation charities in the UK as it is thought to be of benefit to bird conservation. However, little is understood of how the provision of supplementary food affects the behaviour and ecology of target and non-target species. G...

Quality assurance of Mo-99/Tc-99m radionuclide generators

Science.gov (United States)

Uzunov, Nikolay; Yordanova, Galina; Salim, Seniha; Stancheva, Natalya; Mineva, Vanya; Meléndez-Alafort, Laura; Rosato, Antonio

2018-03-01

Gamma-ray spectrometry analyses of the radionuclide content of eluate from two Mo-99/Tc-99m radionuclide generators POLTECHNET have been performed. The relative activities of 99Mo 103Ru and 131I radioisotopes with respect to the activity of 99mTc at different time intervals after the primary pertechnetate elution of the generators have been analyzed. The relative activities of the isotopes were determined and compared to the radionuclidic purity requirements for 99mTc.

Supplementary data: Development of nuclear DNA markers for ...

Indian Academy of Sciences (India)

Supplementary data: Development of nuclear DNA markers for evolutionary studies in Plasmodium falciparum. Celia Thomas, Sneh Shalini, N. Raghavendra, Meenakshi Choudhary, Anju Verma, Hema Joshi,. A. P. Dash and Aparup Das. J. Genet. 86, 65–68. Primer sequences for amplification of putatively neutral ...

NCBI nr-aa BLAST: CBRC-XTRO-01-0124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0124 ref|YP_864419.1| inner-membrane translocator [Magnetococcus sp. M...C-1] gb|ABK43013.1| inner-membrane translocator [Magnetococcus sp. MC-1] YP_864419.1 1e-163 99% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-2639 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2639 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 2e-99 60% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

EVALUACIÓN EXPERIMENTAL DE LA RESISTENCIA A LA CORROSIÓN DE UN ACERO AISI-SAE 4140 IMPLANTADO CON IONES DE NITRÓGENO

OpenAIRE

PEÑA, DARIO; FONTALVO, PAOLA; ESTUPIÑAN, HUGO; NIÑO, DANNIER; VESGA, WILSON

2009-01-01

Se estudió la resistencia a la corrosión de un acero AISI-SAE 4140 implantado con iones de Nitrógeno mediante la técnica 3DII (Implantación Iónica Tridimensional). Se evaluaron diferentes rugosidades de las muestras implantadas mediante técnicas electroquímicas de Rp, EIS y Tafel en una salmuera al 3% de NaCl, donde se obtuvo la mayor resistencia a la corrosión para el material implantado con menor rugosidad. Se produjo la formación de una posible capa protectora estable con la inmersión de l...

Tc-99 m-GSA liver scintigraphy in alcoholic liver cirrhosis

International Nuclear Information System (INIS)

Itano, Satoshi; Harada, Masaru; Nagamatsu, Hiroaki

2003-01-01

We compared 15 alcoholic liver cirrhosis patients with 10 viral liver cirrhosis patients using technetium-99 m-galactosyl human serum albumin (Tc-99 m-GSA) liver scintigraphy and could clinically reveal the disorder of metabolism of asialoglycoprotein in alcoholic liver cirrhosis. Receptor index (LHL 15 = liver count divided by the sum of liver and heart counts at 15 minutes) was significantly (p <0.01) lower in patients with alcoholic cirrhosis (median: 0.821), compared with patients with viral cirrhosis (0.915). Grading score, which was an index showed by the difference in the isotope uptake patterns between liver and heart, was significantly (p <0.01) worse in patients with alcoholic cirrhosis, compared with patients with viral cirrhosis. These results suggested that alcoholic liver cirrhosis had a specific disorder of a metabolic function for asialoglycoprotein. (author)

ARC Researchers at 2016 SAE Congress

Science.gov (United States)

. Henein, Wayne State University 1:30 pm 2016-01-0310 An Engine Thermal Management System Design for ; Zissimos Mourelatos, Oakland University Session PFL370; Room 360 Holistic Session on Fuel Consumption and , powertrain, and supporting electromechanical subsystems related to energy management. 4:30 pm 2016-01-1239

Molybdenum-99/technetium-99M generators

International Nuclear Information System (INIS)

Morcos, N.A.; Bruno, G.A.; Haney, T.A.

1981-01-01

A 99 Mo/sup(99m)Tc generator is described which has an alumina support medium consisting of multiple beds of controlled pH and in which no bed has a pH value higher than the bed preceding it. It is claimed that by using this method low yield problems of such generators can be mitigated. (U.K.)

Generators of 99Mo-99mTc

International Nuclear Information System (INIS)

Robles, A.M.

1994-01-01

Between the radioisotopes family pairs we find the 99 Molibdenum - 99m technetium pairs. Such as isotope production,decay and chemical toxic, humid and dry generators,radiation protection handling practice and blinding had been sudied in this work.Tabs

Development of 99Mo/99mTc Generator System for Production of Medical Radionuclide 99mTc using a Neutron-activated 99Mo and Zirconium Based Material (ZBM as its Adsorbent

Directory of Open Access Journals (Sweden)

I. Saptiama

2016-12-01

Full Text Available Molybdenum produced from fission of U-235 is the most desirable precursor for 99Mo/99mTc generator system as it is non-carrier added and has high specific activity. However, in the last decade there has been short supply of 99Mo due to several constrains. Therefore, there have been many works performed for development of 99Mo/99mTc generator system using 99Mo which is not produced from either LEU or HEU. This report deals with development of 99Mo/99mTc generator system where zirconium-based material (ZBM is used as adsorbent of neutron-activated 99Mo. The system was prepared by firstly irradiating natural Mo in the G. A. Siwabessy reactor to produce neutron-activated 99Mo. The target was dissolved in NaOH 4N and then neutralized with 12 M HCl. The 99Mo solution was then mixed with a certain amount of ZBM followed by heating at 90°C for three hours to allow the 99Mo adsorbed on ZBM. The 99Mo-ZBM (9.36 GBq of 99Mo was Mo/ 4.2 g ZBM was packed on a fritz-glass column. This column was then fitted serially with an alumina column for trapping 99Mo breakthrough. The columns were then eluted daily with saline solution for up to one week. The yield of 99mTc was found to be between 53.7 – 74% (n= 5. All 99mTc eluates were clear solutions with pH of 5. Breakthrough of 99Mo in 99mTc eluates was found to be 0.031 ± 0.019 μCi 99Mo/ mCi 99mTc (n= 5 which was less than the maximum activity of 99Mo allowed in 99mTc solution ( 99%. Radiolabeling of this 99mTc towards methylene diphosphonate (MDP kit gave a radiolabelling efficiency of 99%. In summary, a new 99Mo/99mTc generator system that used neutron-activated 99Mo and ZBM as its adsorbent has been successfully prepared. The 99mTc produced from this new 99Mo/99mTc generator system attained the quality of 99mTc required for medical purposes.

Liver scintigraphy with sup(99m)Tc-Sn-colloid

International Nuclear Information System (INIS)

Suzuki, Masaaki

1976-01-01

Basic and clinical studies of sup(99m)Tc-Sn-colloid (Tc-Sn-C) were made on liver scintigraphy for comparison with 198 Au-colloid in blood clearance, liver accumulation, and spleen imaging strength. Tc-Sn-C was excellent in ease of sterilization, simplicity of preparation, reduction in the exposure dose for the examiner, labeling rate, and stability, and it was effective as a drug for liver scintigraphy. The blood clearance T1/2 can be an indicator for the blood flow rate in the liver, similarly to the Au-C method. Although a decrease in the liver radioactivity after liver accumulation was observed, it was not thought to affect liver scintigraphy. A clear shadow of the liver was obtained in all cases, and there seemed to be no differences between the commercially prepared Tc-Sn-C and the Tc-Sn-C which must be prepared each time. The spleen imaging strength was thought to be effective as a supplementary diagnosis for splenic diseases. No allergic symptoms appeared immediately after examination. (Chiba, N.)

Cost basis for hydroelectric power plants. Price level of 01.01.1995; Kostnadsgrunnlag for vannkraftanlegg. Prisnivaa pr 01.01.1995

Energy Technology Data Exchange (ETDEWEB)

Stensby, H.; Slapgaard, J.

1995-08-01

This publication provides a basis for calculation of expected average construction costs and equipment costs for large hydroelectric power plants in Norway. The publication is not intended to be a tool for projecting with regard to optimization or choice of construction types, but should be useful at an early stage of planning. There is a supplementary publication (Publication no. 20/1995) for small plants. 80 figs., 12 tabs.

Supplementary data: A complete mitochondrial genome of wheat ...

Indian Academy of Sciences (India)

Supplementary data: A complete mitochondrial genome of wheat (Triticum aestivum cv. Chinese Yumai), and fast evolving mitochondrial genes in higher plants. Peng Cui, Huitao Liu, Qiang Lin, Feng Ding, Guoyin Zhuo, Songnian Hu, Dongcheng Liu, Wenlong Yang, Kehui Zhan,. Aimin Zhang and Jun Yu. J. Genet.

Supplementary data: Genotype–phenotype relationship of F7 ...

Indian Academy of Sciences (India)

Supplementary data: Genotype–phenotype relationship of F7 R353Q polymorphism and plasma FVII.c levels in Asian Indian families predisposed to coronary artery disease. Jayashree Shanker, Ganapathy Perumal, Arindam Maitra, Veena S. Rao, B. K. Natesha, Shibu John,. Sridhar Hebbagodi and Vijay V. Kakkar.

Supplementary data: Development of SSR markers and construction ...

Indian Academy of Sciences (India)

Supplementary data: Development of SSR markers and construction of a linkage map in jute. Moumita Das, Sumana Banerjee, Raman Dhariwal, Shailendra Vyas, Reyazul R. Mir, Niladri Topdar, Avijit Kundu, Jitendra P. Khurana, Akhilesh K. Tyagi,. Debabrata Sarkar, Mohit K. Sinha, Harindra S. Balyan and Pushpendra K.

Supplementary material for: The adaptive synchronization of ...

Indian Academy of Sciences (India)

Supplementary material for: The adaptive synchronization of fractional-order Liu chaotic system with unknown parameters. ADELEH NOURIAN and SAEED BALOCHIAN. -50. -40. -30. -20. -10. 0. 10. 20. 30. 40. -25. -20. -15. -10. -5. 0. 5. 10. 15. 20. 25. Y. Z. -12. -10. -8. -6. -4. -2. 0. 2. 4. 6. 8. -25. -20. -15. -10. -5. 0. 5. 10. 15.

The new 99mTc myocardial perfusion imaging agents: 99mTc-sestamibi and 99mTc-teboroxime

International Nuclear Information System (INIS)

Berman, D.S.; Kiat, H.; Maddahi, J.

1991-01-01

The two new 99m (99mTc) labeled myocardial perfusion agents, 99mTc-Sestamibi and 99mTc-Teboroxime, are now available for routine clinical application. Both agents allow assessment of ejection fraction by the first-pass technique at rest or during exercise, thus providing additional information not available with thallium-201. 99mTc-Sestamibi has long myocardial residence time, as well as adequate myocardial extraction, providing images of higher count density and superior quality compared with thallium-201. 99mTc-Teboroxime has excellent myocardial uptake characteristics but is cleared very rapidly from the myocardium. Both tracers have shown results similar to those obtained with thallium-201 for detection of coronary artery disease and the assessment of defect reversibility. 99mTc-Sestamibi studies using the rest/stress imaging sequence can be accomplished in approximately 5 hours; studies using dual-isotope imaging (rest thallium-201 and stress 99mTc-Sestamibi injection) can be completed in 1 to 2 hours. Gated stress images can be performed with 99mTc-Sestamibi, providing simultaneous information of myocardial perfusion at stress and resting wall motion or thickening and allowing rapid differentiation of ischemic from infarcted tissue. Because of its slow myocardial clearance and absence of redistribution, 99mTc-Sestamibi allows uncoupling of the time of injection from the time of imaging and thus can be valuable in the evaluation of acute myocardial infarction and outcome of thrombolytic therapy. With 99mTc-Teboroxime, rapid serial studies are feasible. Pharmacologic stress and rest studies with 99mTc-Teboroxime single photon emission computed tomography potentially can be completed in under 30 minutes. 73 references

A comparison of results of empirical studies of supplementary search techniques and recommendations in review methodology handbooks: a methodological review.

Science.gov (United States)

Cooper, Chris; Booth, Andrew; Britten, Nicky; Garside, Ruth

2017-11-28

The purpose and contribution of supplementary search methods in systematic reviews is increasingly acknowledged. Numerous studies have demonstrated their potential in identifying studies or study data that would have been missed by bibliographic database searching alone. What is less certain is how supplementary search methods actually work, how they are applied, and the consequent advantages, disadvantages and resource implications of each search method. The aim of this study is to compare current practice in using supplementary search methods with methodological guidance. Four methodological handbooks in informing systematic review practice in the UK were read and audited to establish current methodological guidance. Studies evaluating the use of supplementary search methods were identified by searching five bibliographic databases. Studies were included if they (1) reported practical application of a supplementary search method (descriptive) or (2) examined the utility of a supplementary search method (analytical) or (3) identified/explored factors that impact on the utility of a supplementary method, when applied in practice. Thirty-five studies were included in this review in addition to the four methodological handbooks. Studies were published between 1989 and 2016, and dates of publication of the handbooks ranged from 1994 to 2014. Five supplementary search methods were reviewed: contacting study authors, citation chasing, handsearching, searching trial registers and web searching. There is reasonable consistency between recommended best practice (handbooks) and current practice (methodological studies) as it relates to the application of supplementary search methods. The methodological studies provide useful information on the effectiveness of the supplementary search methods, often seeking to evaluate aspects of the method to improve effectiveness or efficiency. In this way, the studies advance the understanding of the supplementary search methods. Further

Measurement of technetium-99 in soil samples collected in Marshall Islands

Energy Technology Data Exchange (ETDEWEB)

Tagami, K.; Uchida, S. [National Inst. of Radiological Sciences, Environmental and Toxicological Sciences Research Group, Chiba (Japan)

2000-07-01

Extraction techniques for recovery of technetium-99 ({sup 99}Tc) for ICP-MS measurements were evaluated using soil samples collected from the Marshall Islands. The results of three different extraction techniques were compared: (M1) acid leaching of Tc from ashed soil; (M2) acid leaching of Tc from raw dry soil; and (M3) Tc volatilization from ashed soil using a combustion apparatus. Total Tc recoveries varied considerably between the extraction techniques but each method yielded similar analytical results for {sup 99}Tc. Applications of these extraction techniques to a series of environmental samples and ICP-MS measurements have yielded first data on the {sup 99}Tc content of Marshall Islands soil samples contaminated with close-in radioactive fallout from nuclear weapons testing. The {sup 99}Tc activity concentration in the soil samples ranged between 0.1 and 1.1 mBq/g-dw. The limit of detection for {sup 99}Tc by ICP-MS was 0.17 mBq per sample or 0.014 mBq/g-dw under standard operating conditions. (author)

Measurement of technetium-99 in soil samples collected in Marshall Islands

International Nuclear Information System (INIS)

Tagami, K.; Uchida, S.

2000-01-01

Extraction techniques for recovery of technetium-99 ( 99 Tc) for ICP-MS measurements were evaluated using soil samples collected from the Marshall Islands. The results of three different extraction techniques were compared: (M1) acid leaching of Tc from ashed soil; (M2) acid leaching of Tc from raw dry soil; and (M3) Tc volatilization from ashed soil using a combustion apparatus. Total Tc recoveries varied considerably between the extraction techniques but each method yielded similar analytical results for 99 Tc. Applications of these extraction techniques to a series of environmental samples and ICP-MS measurements have yielded first data on the 99 Tc content of Marshall Islands soil samples contaminated with close-in radioactive fallout from nuclear weapons testing. The 99 Tc activity concentration in the soil samples ranged between 0.1 and 1.1 mBq/g-dw. The limit of detection for 99 Tc by ICP-MS was 0.17 mBq per sample or 0.014 mBq/g-dw under standard operating conditions. (author)

Production response of lambing ewes receiving supplementary feed ...

African Journals Online (AJOL)

Unknown

Introduction. In the past, several experiments were conducted at the Langgewens Experimental Farm in the Swartland area of the Western Cape to evaluate different types of supplementary feed for producing ewes while grazing low quality crop residues during the dry summer and early autumn months (Brand, et al, 2000).

Characteristics, Effectiveness, and Prospects of Supplementary Professional Education

Science.gov (United States)

Kliucharev, Grigorii Arturovich

2010-01-01

Today the system of supplementary professional education (SPE) is the main institutionalized subunit that is oriented toward "adult learners". Surveys have shown that in many cases investment in SPE is more profitable, predictable, reliable, and short term than that in any other form of education. Data on supplemental professional…

NCBI nr-aa BLAST: CBRC-HSAP-01-0032 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-01-0032 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 0.0 99% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-0806 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0806 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-175 99% ...

99Mo-99mTc production development by (n, γ) reaction

International Nuclear Information System (INIS)

Izumo, Hironobu; Nishikata, Kaori; Kimura, Akihiro; Tanimoto, Masataka; Tsuchiya, Kunihiko; Ishihara, Masahiro; Kaminaga, Masanori

2012-01-01

The renewed JMTR will be started from the later half of JFY2012, and it is expected to various fields. Supply of 99 Mo in Japan depends only on imports from foreign countries. JAEA has a plan to produce 99 Mo, a parent nuclide of 99m Tc. JMTR will contribute to produce 99 Mo by (n, r) method as one of effective uses of the JMTR. In this paper, outline of the technical study items for production method of 99 Mo- 99m Tc in JMTR will be described. (author)

A modified {sup 99} Mo- {sup 99} Tc generator on Zirconium molybdo- phosphate-{sup 99} Mo gel. Vol. 3

Energy Technology Data Exchange (ETDEWEB)

El-Kolaly, M T; Talaat, H [Labelled Compounds Department, Cairo (Egypt); Botros, N [Radioistspe and Generator Department, Radioisotope Production and Sealed Source Division, Hot Laboratories Center, Atomic Energy Authority, Cairo (Egypt)

1996-03-01

A modified {sup 99} Mo - {sup 99} Tc gel generator is described. The new generator is based on the use of zirconium molybdophosphate - {sup 99} Mo gel in which {sup 99} Mo chemically combined in the gel structure, where {sup 99m}Tc can be easily eluted with distilled water or saline. The gel was prepared via chemical reaction between zirconyl chloride and molybdophosphate - {sup 99} Mo solution. The PH of the reaction mixture was adjusted with NaOH. Different gels have been prepared by varying the molar ratio of Mo:Zr:p. The PH and time of digeston on complete gel formation was also investigated in order to optimize the condition of gel preparation. Molybdophosphate {sup 32} P solution was used to determine the phosphorous content in the gel and in the {sup 99m}Tc eluate. The temperature and time of drying of the gel and their effect on {sup 99m}Tc elution efficiency were also studied. From the data obtained, the optimum conditions for routine production of {sup 99} Mo - {sup 99m}Tc generator are presented and discussed. 2 figs., 6 tabs.

Analüüs SAE tase 4 ja 5 sõidukite kasutusele võtmiseks koos seaduseelnõu väljatöötamiskavatsuse kirjeldustega : vaheraport 2017 08 24 [Võrguteavik] / Karmen Turk, Maarja Pild, Ergo Blumfeldt

Index Scriptorium Estoniae

Turk, Karmen, 1982-

2017-01-01

Analüüsitakse äärmiselt intelligentsete SAE tase 4 ja 5 sõidukite kasutusele võtmist ning sellega seotud seaduseelnõu väljatöötamist. Ülevaade robootika olemusest ning põhiprobleemidest, mis seonduvad tehisintellektiga ja isejuhtivate sõidukitega

29 CFR 2509.99-1 - Interpretive Bulletin Relating to Payroll Deduction IRAs.

Science.gov (United States)

2010-07-01

... 29 Labor 9 2010-07-01 2010-07-01 false Interpretive Bulletin Relating to Payroll Deduction IRAs... SECURITY ACT OF 1974 § 2509.99-1 Interpretive Bulletin Relating to Payroll Deduction IRAs. (a) Scope. This...), as applied to payroll deduction programs established by employers 1 for the purpose of enabling...

Concentration of sup(99m)Tc from the eluate of 99Mo-sup(99m)Tc generators

International Nuclear Information System (INIS)

Saucedo, T.; Mora, M.; Fraga de Suarez, A.H.; Mitta, A.E.A.

1976-04-01

A method is described to concentrate sup(99m)Tc solutions, originated in 99 Mo-sup(99m)Tc generators, independent of its age. The techniques of preparation of the different radiopharmaceuticals used in nuclear medicine are also described. (author) [es

Problems in clinical practice of domestic supply of 99Mo/99mTc. Considerations on the domestic production of 99Mo/99mTc

International Nuclear Information System (INIS)

Yamabayashi, Hisamichi

2012-01-01

At present, a bulky import product, 99 Mo supplied in Japan is produced by a nuclear fission method which enables to produce a generator system with no need of commercially preparing 99m Tc-labeled radiopharmaceuticals due to its high specific activity. However its usage of enriched uranium target leads to avoiding the fission method from the option of domestic production. In order to secure the domestic supply of 99 Mo/ 99m Tc, the neutron activation method, aiming to meet about 20% of domestic demand, is under development along with the re-start program of JMTR. Development of various production methods using accelerators are also in progress. In those non-fission methods with reactors or accelerators, rapid and effective procedures for concentration and refinement of 99m Tc solution eluted from 99 Mo of low specific activity are the subjects to be considered for attaining the stable labeling performances. (author)

Specifications for Supplementary Classroom Units, Stressed Skin Panel.

Science.gov (United States)

Waring, Robert B.; And Others

Complete outline specifications are given for the construction of supplementary classroom units using stressed skin panels. Sections included are--(1) concrete and related work, (2) masonry, (3) structural and miscellaneous metal, (4) curtain walls and metal windows, (5) carpentry and related work, (6) roofing, sheet metal, and related work, (7)…

Thermochemical studies on two alkyl-bulky substituted xanthene derivatives: 9,9-dimethylxanthene and 2,7-di-tert-butyl-9,9-dimethylxanthene

International Nuclear Information System (INIS)

Freitas, Vera L.S.; Gomes, José R.B.; Ribeiro da Silva, Maria D.M.C.

2017-01-01

Highlights: • Energetic characterization of two alkyl-bulky substituted xanthene derivatives. • Massic energies of combustion of xanthene derivatives. • Enthalpies of sublimation determined by vacuum drop microcalorimetry technique. • Temperature-vapour pressure dependence by mass-loss Knudsen effusion method. • Gas-phase enthalpies of formation of alkyl xanthene derivatives. - Abstract: Thermodynamic properties of 9,9-dimethylxanthene and 2,7-di-tert-butyl-9,9-dimethylxanthene for the condensed and gas states were derived from experimental and computational studies. Static-bomb combustion calorimetry, vacuum drop microcalorimetry and the Knudsen effusion techniques were used. Computational calculations of the enthalpies of hypothetical reactions in the gaseous phase, using the G3(MP2)//B3LYP composite method, were performed for the two xanthene derivatives. Natural bond orbital (NBO) calculations were also performed to ascertain the structure and reactivity of these compounds. The energetic effects caused by replacing hydrogen atoms in the xanthene moiety by methyl and tert-butyl groups yielding 9,9-dimethylxanthene and 2,7-di-tert-butyl-9,9-dimethylxanthene species were determined from direct comparison of their standard (p o = 0.1 MPa) molar enthalpies of formation in the gaseous phase, at T = 298.15 K.

NCBI nr-aa BLAST: CBRC-VPAC-01-0194 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-0194 ref|ZP_04121235.1| Transporter, MFS superfamily [Bacillus thuringiensis serovar pakistan...i str. T13001] gb|EEM47055.1| Transporter, MFS superfamily [Bacillus thuringiensis serovar pakistani str. T13001] ZP_04121235.1 0.99 23% ...

Labeling bombesin-like peptide with 99mTc via hydrazinonicotinamide. Description of optimized radiolabeling conditions

International Nuclear Information System (INIS)

Yurt Lambrecht, F.; Durkan, K.; Bayrak, E.

2010-01-01

Bombesin (BNN)-like peptides have very high binding affinity for the gastrin-releasing peptide (GRP) receptor. The goal of the current study was to optimize the labeling conditions of a new 99m Tc-radiolabeled BNN-like peptide based on the bifunctional chelating ligand HYNIC using different co-ligands (EDDA and tricine). The radiolabeling conditions (pH, amount of co-ligand, amount of stannous chloride, temperature and reaction time) for newly-formed 99m Tc-tricine-HYNIC-Q-Litorin and 99m Tc-EDDA-HYNIC-Q-Litorin were optimized and evaluated by RHPLC and RTLC. Radiochemical yields for 99m Tc-tricine-HYNIC-Q-Litorin and 99m Tc-EDDA-HYNIC-Q-Litorin were 98.0 ± 1.7 and 97.5 ± 2.5%, respectively. When EDDA was used as co-ligand, the labeling of 99m Tc-EDDA-HYNIC-Q-Litorin was optimal in the following reaction mixture: HYNIC-peptide: EDDA: 10 μg/5 mg, pH 3, SnCl 2 concentration: 12 μg/0.1 mL, reaction temperature: 100 deg C, reaction time: 15 min. Besides, the optimum conditions were HYNIC-peptide:tricine: 10 μg/50 mg, pH 5, SnCl 2 concentration: 12 μg/0.1 mL, reaction temperature: 100 deg C, reaction time: 15 min for preparing 99m Tc-tricine-HYNIC-Q-Litorin. The manufactured 99m Tc-HYNIC-Q-Litorin conjugates may offer new possibilities for imaging cancer cells expressing bombesin receptors. (author)

Labelled Preformed liposomes with 99MTC-DTPA, 99 MTC-ECD, 99MTC-MDP and 99MTC-MIBI : Labelling procedures and stability studies

International Nuclear Information System (INIS)

Savio, E.O.; Teran, M.A.; Vales, M.E.; Frier, M.

2004-01-01

Liposomes labelled with gamma e miters like 99mTc, can be used for scintigraphic imaging to non-invasively track and quantify the distribution of liposomes in the body. In vitro studies were done to choose a suitable radiopharmaceutical (RF) to be attached to performed liposomes. 99mTc-Complexes (DTPA, ECD, MDP, MIBI) were used to label collagen liposomes. Commercial kits were labelled with 99mTc04-(TechnoNuclear). Quality controls of the RF were performed. Collagen liposomes suspended in saline 0.9% were incubated at 4.25.37 and 60 for 30 min. Efficiency of the labelling procedure was determined by gel filtration using Sephadex G25 (Pharmacia) and NaC10.9%. Samples of 100mL (74MBq), were seeded and fractions of 0.5mL were colleted and measured in an ionisation chamber (Capintec CRC). Stability of the labelled liposomes was assessed incubating 0.5mL, of the suspension with 1mL of human serum during 30 min at 37 . Dialysis was performed using dialysis bags of 64 K pore size and NaCI 0.9% at room temperature. Samples of the saline bath were collected at 30.60 and 90 min. and measured in a solid scintillation counter Ortec.Liposomes labelled with 99mTc-DTPA and 99mTcMIBI showed a labelling efficiency of 80%; liposomes incubated with 99mTc-MDP were labelled in a 50% and 99mTc-ECD did not bind to liposomes in the conditions of study. Incubation of labelled liposomes with human serum showed 50% of strong binding to the plasmatic proteins for 99mTc-DTPA but low values (5%) for the other specimens. Labelled liposomes were achieved, with different RF, showing a suitable in vitro stability to perform in vivo studies

Physicochemical and Biological Analysis of 99mTc-Glutathione Radiopharmaceuticals

International Nuclear Information System (INIS)

ME- Sriyani; N- Zainuddin

2013-01-01

99m Tc-glutathion ( 99m Tc-GSH) radiopharmaceutical is available in the GSH lyophilized-kit in which ready to use directly after adding 99m Tc radionuclide. In nuclear medicine, 99m Tc-GSH diagnostic kit is a radiopharmaceutical commonly utilized for cancer diagnoses using imaging method. This paper described the physicochemical and biological characteristics as well as the quality of 99m Tc-GSH diagnostic kit prepared from the GSH lyophilized-kit. The radiochemical purity was determined with thin layer chromatography (TLC) method, performed on a TLC-SG stationary phase with a mobile phase of a dried acetone and 0,9% of NaCl solution. Studies on the effect of volume and radioactivity of Na 99m TcO 4 solution to the radiochemical purity of 99m Tc-GSH were carried out. The sterility of GSH-lyophilized kit and toxicity of 99m Tc-GSH were also investigated. The stability test on GSH lyophilized kit and 99m Tc-GSH in several storage conditions, as well as the plasma stability of 99m Tc-GSH was performed. The analysis result showed that the GSH lyophilized-kit was sterile; the 99m Tc-GSH was non toxic with 99.54 ± 0.01% of radiochemical purity and remained stable 5 hours either at room temperature or 4℃. The volume more than 4 mL of Na 99m TcO 4 solution on the labeling of GSH could decreased the 99m Tc-GSH radiochemical purity, while the radioactivity more than 20 mCi in 7 mL of volume extended the incubation time. In-vitro stability test of 99m Tc-GSH in plasma showed that in the two hours of storage, the radiochemical purity decreased to 51.84 ± 2.52%, and until 5 hours of storage it did not change significantly. From the result, it can be concluded that the GSH lyophilized-kit was remained stable after 13 month of storage either at room temperature or 4℃ with 99% of 99m Tc-GSH radiochemical purity. (author)

Comparative study of 99Mo/99mTc generators at base of synthesized gels starting from activation and fission 99Mo

International Nuclear Information System (INIS)

Lopez M, I.Z.; Monroy G, F.; Rivero G, T.; Rojas N, P.

2007-01-01

The 99m Tc is used for diagnostic and therapy. It is produced starting from 99 Mo, absorbed in chromatographic columns, loaded with alumina that absorb only 0.2% of 99 Mo with high specific activities of 99 Mo, obtained from the 235 U fission. Given these conditions and limitations, new preparation procedures of 99 Mo/ 99m Tc generators, its have been developed, using zirconium molybdates gels that incorporates until 30% of 99 Mo, conserve similar characteristics of quality and purity that the traditional generator. The radiochemical characteristics of the 99m Tc elution, depend strongly on the gel preparation conditions. In particular, the present work has by object to determine the influence of the 99 Mo used type, fission or activation product, during the gels synthesis, as well as the used air flow for the agitation in the gels preparation and its influence in the 99 Mo/ 99m Tc generators quality. When diminishing the flow of agitation air the efficiency it increases and in the radionuclide purity of the eluates and when using 99 Mo from fission for the gels production it increases in an important way the elutriation efficiency, the radiochemical and radionuclide purity of the 99m Tc eluates. (Author)

NCBI nr-aa BLAST: CBRC-DDIS-01-0132 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-01-0132 ref|XP_646256.1| cellulose synthase [Dictyostelium discoideum AX4...] gb|AAF00200.1|AF163835_1 cellulose synthase [Dictyostelium discoideum] gb|EAL71912.1| cellulose synthase [Dictyostelium discoideum AX4] XP_646256.1 0.0 99% ...

Gentc99m, computational system for the technetium-99m generator

International Nuclear Information System (INIS)

Suparman, I.

1997-01-01

The technetium-99m generator is one of the main products of the PPR, as the continuity of the technetium-99m generator production is important for supporting the development of nuclear medicine. GENTC99M has been made for computational for the technetium-99m generator and includes data processing, documentation and information GENTC99M is also very useful in quality control application especially for the determinations of yield and radionuclidic impurities which consume much time. microsoft visual basic for MS-DOS and visual basic for windows have been used for making GENTC99M. Microsoft visual basic has several features that make it an ideal development language for both MS-DOS and Microsoft Windows. These features not only increase productivity, they also provide all the tools and hooks needed to develop some very sophisticated applications. for a production centre like PPR, GENTC99M is very useful to support the data processing, documentation and information system of the technetium-99m generator and it can also be modified for other products

Medical Progress and Supplementary Private Health Insurance

OpenAIRE

Reiner Leidl

2003-01-01

In many welfare states, tightening financial constraints suggest excluding some medical services, including new ones, from social security coverage. This may create opportunities for private health insurance. This study analyses the performance of supplementary private health insurance (SPHI) in markets for excluded services in terms of population covered, risk selection and insurer profits. Using a utility-based simulation model, the insurance market is described as a composite of sub-market...

MCBS Highlights: Ownership and Average Premiums for Medicare Supplementary Insurance Policies

Science.gov (United States)

Chulis, George S.; Eppig, Franklin J.; Poisal, John A.

1995-01-01

This article describes private supplementary health insurance holdings and average premiums paid by Medicare enrollees. Data were collected as part of the 1992 Medicare Current Beneficiary Survey (MCBS). Data show the number of persons with insurance and average premiums paid by type of insurance held—individually purchased policies, employer-sponsored policies, or both. Distributions are shown for a variety of demographic, socioeconomic, and health status variables. Primary findings include: Seventy-eight percent of Medicare beneficiaries have private supplementary insurance; 25 percent of those with private insurance hold more than one policy. The average premium paid for private insurance in 1992 was $914. PMID:10153473

Surface Chemistry of La0.99Sr0.01NbO4-d and Its Implication for Proton Conduction.

Science.gov (United States)

Li, Cheng; Pramana, Stevin S; Ni, Na; Kilner, John; Skinner, Stephen J

2017-09-06

Acceptor-doped LaNbO 4 is a promising electrolyte material for proton-conducting fuel cell (PCFC) applications. As charge transfer processes govern device performance, the outermost surface of acceptor-doped LaNbO 4 will play an important role in determining the overall cell performance. However, the surface composition is poorly characterized, and the understanding of its impact on the proton exchange process is rudimentary. In this work, the surface chemistry of 1 atom % Sr-doped LaNbO 4 (La 0.99 Sr 0.01 NbO 4-d , denoted as LSNO) proton conductor is characterized using LEIS and SIMS. The implication of a surface layer on proton transport is studied using the isotopic exchange technique. It has shown that a Sr-enriched but La-deficient surface layer of about 6-7 nm thick forms after annealing the sample under static air at 1000 °C for 10 h. The onset of segregation is found to be between 600 and 800 °C, and an equilibrium surface layer forms after 10 h annealing. A phase separation mechanism, due to the low solubility of Sr in LaNbO 4 , has been proposed to explain the observed segregation behavior. The surface layer was concluded to impede the water incorporation process, leading to a reduced isotopic fraction after the D 2 16 O wet exchange process, highlighting the impact of surface chemistry on the proton exchange process.

On-Track Testing as a Validation Method of Computational Fluid Dynamic Simulations of a Formula SAE Vehicle

Science.gov (United States)

Weingart, Robert

This thesis is about the validation of a computational fluid dynamics simulation of a ground vehicle by means of a low-budget coast-down test. The vehicle is built to the standards of the 2014 Formula SAE rules. It is equipped with large wings in the front and rear of the car; the vertical loads on the tires are measured by specifically calibrated shock potentiometers. The coast-down test was performed on a runway of a local airport and is used to determine vehicle specific coefficients such as drag, downforce, aerodynamic balance, and rolling resistance for different aerodynamic setups. The test results are then compared to the respective simulated results. The drag deviates about 5% from the simulated to the measured results. The downforce numbers show a deviation up to 18% respectively. Moreover, a sensitivity analysis of inlet velocities, ride heights, and pitch angles was performed with the help of the computational simulation.

Improving supplementary feeding in species conservation

Science.gov (United States)

Ewen, John G; Walker, Leila; Canessa, Stefano; Groombridge, Jim J

2015-01-01

Supplementary feeding is often a knee-jerk reaction to population declines, and its application is not critically evaluated, leading to polarized views among managers on its usefulness. Here, we advocate a more strategic approach to supplementary feeding so that the choice to use it is clearly justified over, or in combination with, other management actions and the predicted consequences are then critically assessed following implementation. We propose combining methods from a set of specialist disciplines that will allow critical evaluation of the need, benefit, and risks of food supplementation. Through the use of nutritional ecology, population ecology, and structured decision making, conservation managers can make better choices about what and how to feed by estimating consequences on population recovery across a range of possible actions. This structured approach also informs targeted monitoring and more clearly allows supplementary feeding to be integrated in recovery plans and reduces the risk of inefficient decisions. In New Zealand, managers of the endangered Hihi (Notiomystis cincta) often rely on supplementary feeding to support reintroduced populations. On Kapiti island the reintroduced Hihi population has responded well to food supplementation, but the logistics of providing an increasing demand recently outstretched management capacity. To decide whether and how the feeding regime should be revised, managers used a structured decision making approach informed by population responses to alternative feeding regimes. The decision was made to reduce the spatial distribution of feeders and invest saved time in increasing volume of food delivered into a smaller core area. The approach used allowed a transparent and defendable management decision in regard to supplementary feeding, reflecting the multiple objectives of managers and their priorities. Mejoría de la Alimentación Suplementaria en la Conservación de Especies Resumen La alimentaci

Brachytherapy model with sodium pertechnetate-"9"9"mTc balloon (Na"9"9"mTcO_4"-) for breast cancer: evaluation of dosimetry and cell response

International Nuclear Information System (INIS)

Lima, Carla Flavia de

2016-01-01

Breast cancer is the most common type of cancer that affects more women worldwide. Among various treatment options, radiotherapy which is often used as a treatment for locoregional recurrences control or to decrease tumor size. In patients with breast cancer at an early stage, a booster dose (boost) in the primary tumor area can be applied after conventional radiation therapy. There are several drawbacks to applying this technique. In this work we aimed to perform a dosimetric analysis in a breast model, where it put a balloon filled with sodium pertechnetate-"9"9"mTc (Na"9"9"mTcO_4"-) which in future could be used in preference to other possible therapies. The methodology involved the development of dosimetry in water based on radiochromic films and in a computational voxel thorax model. Calibration protocol achieved a mathematical relation between absorbed dose versus optical density (OD) measured at a set of radiochromic sample films placed at the surface of the balloon plus 1 cm up to 10 cm far, in which theoretical dose values were provided by MCNP modeling, reproducing the water equivalent physical simulator. A voxel model of a female thorax, developed at the SISCODES/MCNP codes, received a filled balloon inside. Spatial dose distribution was generated, illustrating the dose received in the chest wall, glandular tissue, breast skin and lung. The dosimetric findings contribute to present the Na"9"9"mTcO_4"- balloon modality which provides a suitable spatial dose distribution in the tumor bed preserving adjacent health tissues. We also studied the radiobiological response radio resistant mammary adenocarcinoma cells (MDAMB231) by exposure of these cells to Na"9"9"mTcO_4"- balloon. The findings include the presence of apoptotic cells in the balloon around point out a favorable response. In conclusion, the balloon may represent a viable option in the supplementary therapy of breast cancer in patients who have appropriate indication. Irradiation with Na"9"9"mTcO_4

Mismatched uptake of Tc-99m-ECD and Tc-99m-HMPAO in subacute cerebral infarction: Tc-99m-ECD for viability and Tc-99m-HMPAO for flow restoration

Energy Technology Data Exchange (ETDEWEB)

Lee, D. S.; Hyun, I. Y.; Kim, S. K. [College of Medicine, Seoul National Univ., Seoul (Korea, Republic of)] [and others

1997-07-01

Tc-99m-HMPAO reflects tissue perfusion but Tc-99m-ECD uptake is affected by tissue viability in addition to tissue perfusion which the varied state of cellular retention of Tc-99m-ECD reflects. Luxuriously perfused area on Tc-99m-HMPAO SPECT implies that this cortex was already reperfused either spontaneously or after thrombolysis and that accompanied paralysis of vascular reactivity in those zones warms progressive deterioration. We tried to find out if we can use sequential Tc-99m-ECD/Tc-99m-HMPAO SPECT to reveal cortical perfusion and severity and range of risky areas of cerbral cortex despite reperfusion in sub-acute infarction. In 13 patients (M ; F =7 : 6, mean age 57 (range: 26-84)) with cortical (n=12) and basal ganglia infarction (1), we performed sequential Tc-99m-ECD/Tc-99m-HMPAO SPECT at the same position. At first, 555 MBq of Tc-99m-ECD was injected and imaged and then 1110 MBq of Tc-99m-HMPAO was injected again and imaged with the patients in situ, and the first image (Tc-99m-ECD) and the subtracted image (2nd- 1st : Tc-99m-HMPAO) were compared slice by slice. Study was done from 3 days to 31 days (16{+-}9) after ictus. Tc-99m-ECD uptake was always less than or equal to Tc-99m-HMPAO uptake at the lesion in all cases. Luxury perfusion was prominent in four patients. Mismatched uptake was found in 10 patients. Severity of mismatch showed diverse spectrum and was ranged from total middle cerebral artery territory (1 case) to peripheral thin zones around infarction (2 cases). The other 7 showed intermediate amount of tissues with mismatch , i.e., Tc-99m-ECD defects where Tc-99m-HMPAO uptake is in part increased, normal or decreased. Upon discharge, patients having more uptake with Tc-99m-ECD predicted improvement. Patients having mismatched uptake went dichotomous way. In conclusion, Tc-99m-ECD/Tc-99m-HMPAO sequential SPECT is feasible and reveal both tissue perfusion (Tc-99m-HMPAO ) and discrepant Tc-99m-ECD uptake probably reflecting viability in acute

Impact of supplementary feeding on reproductive success of white storks.

Directory of Open Access Journals (Sweden)

Roland Hilgartner

Full Text Available European white stork (Ciconia ciconia populations have been object to several conservation measures such as reintroduction programs, habitat improvement or supplementary feeding in the last decades. Although recent white stork censuses revealed an upward trend of most of the western populations, evaluations of the relative importance of certain conservation measures are still scarce or even lacking. In our study we analyzed the effect of supplementary feeding on the reproductive success of white storks in conjunction with other factors such as weather or nest site characteristics. We present data of 569 breeding events at 80 different nest sites located in variable distances to an artificial feeding site at Affenberg Salem (south-western Germany collected from 1990-2012. A multilevel Poisson regression revealed that in our study population (1 reproductive success was negatively affected by monthly precipitation in April, May and June, (2 pairs breeding on power poles had a lower reproductive success than pairs breeding on platforms or trees and (3 reproductive success was significantly higher in pairs breeding in close distance to the feeding site. The number of fledglings per nest decreased by 8% per kilometer distance to the feeding site. Our data suggest that supplementary feeding increases fledgling populations which may be a tool to attenuate population losses caused by factors such as habitat deterioration or unfavorable conditions in wintering habitats.

The treatment of spleen injuries: a retrospective study.

Science.gov (United States)

Dehli, Trond; Bågenholm, Anna; Trasti, Nora Christine; Monsen, Svein Arne; Bartnes, Kristian

2015-10-29

Hemorrhage after blunt trauma is a major contributor to death after trauma. In the abdomen, an injured spleen is the most frequent cause of major bleeding. Splenectomy is historically the treatment of choice. In 2007, non-operative management (NOM) with splenic artery embolization (SAE) was introduced in our institution. The indication for SAE is hemodynamically stable patients with extravasation of contrast, or grade 3-5 spleen injury according to the Abbreviated Organ Injury Scale 2005, Update 2008. We wanted to examine if the introduction of SAE increased the rate of salvaged spleens in our trauma center. All patients discharged with the diagnosis of splenic injury in the period 01.01.2000 - 31.12.2013 from the University Hospital of North Norway Tromsø were included in the study. Patients admitted for rehabilitation purposes or with an iatrogenic injury were excluded. A total of 109 patients were included in the study. In the period 2000-7, 20 of 52 patients were splenectomized. During 2007-13, there were 6 splenectomies and 24 SAE among 57 patients. The reduction in splenectomies is significant (p < 0.001). There is an increase in the rate of treated patients (splenectomy and SAE) from 38 to 53 % in the two time periods, but not significantly (p = 0.65). The rate of salvaged spleens has increased after the introduction of SAE in our center. The study is registered at www.clinicaltrials.gov with the identification number NCT01965548.

Preparation of 99Mo/99mTc generators based on 99Mo zirconium molybdates in the Gel Synthesis Device for Generators

International Nuclear Information System (INIS)

Lopez M, I. Z.; Monroy G, F.; Rivero G, T.; Rojas N, P.

2008-01-01

The 99m Tc is used for diagnosis and therapy. It is produced commercially from 99 Mo obtained from the fission of 235 U, which is retained in chromatographic columns filled with alumina whose maximum capacity is 0.2%. Given these constraints new methods of preparation 99 Mo/ 99m Tc generators have been developed using zirconium molybdates gels containing up to 30% of Mo, which is part of the generator matrix, and retaining quality and purity similar characteristics to those commercial generators. The present study aims to determine the flow of agitation, temperature and drying time optimal to prepare 99 Mo/ 99m Tc generators based on 99 Mo zirconium molybdates in the Gel Synthesis Device 99 Mo/ 99m Tc Generators designed and built by groups of the Radioactive Materials Research Laboratory and Automation and Instrumentation Department of the National Institute of Nuclear Research. (Author)

Early detection and monitoring of cartilage alteration in the experimental meniscectomised guinea pig model of osteoarthritis by 99mTc-NTP 15-5 scintigraphy

International Nuclear Information System (INIS)

Miot-Noirault, Elisabeth; Vidal, Aurelien; Bonafous, Jacques; Audin, Laurent; Madelmont, Jean-Claude; Moins, Nicole; Pastoureau, Philippe; Chomel, Agnes; Sarry, Laurent

2007-01-01

This study in the meniscectomised guinea pig aimed to demonstrate that the radiotracer 99m Tc-NTP 15-5 would have pathophysiological validity for in vivo osteoarthritis imaging. The specificity of 99m Tc-NTP 15-5 for cartilage was determined in healthy animals (n = 13), by tissue radioactivity counting, joint autoradiography and scintigraphy. 99m Tc-NTP 15-5 scintigraphy was performed at 20, 50, 80, 115, 130, 150 and 180 days after medial meniscectomy (n = 10 MNX) or sham operation (n = 5), and scintigraphic ratios (operated/contralateral) were calculated for femoral (F) and tibial (T) areas. F and T ratios were compared with those of 99m Tc-MDP bone scintigraphy. At the study end-point, autoradiographic analysis of joint 99m Tc-NTP 15-5 distribution and macroscopic scoring of cartilage integrity were performed. The high and specific accumulation of 99m Tc-NTP 15-5 in normal cartilage (about 5.5 ± 1.7 % of injected dose/g of tissue), which permitted joint imaging with high contrast, was affected by osteoarthritis. In the MNX group, 99m Tc-NTP 15-5 accumulation in cartilage within the operated joint, relative to the contralateral joint, was observed to change in the same animals as pathology progressed. Although F and T ratios were significantly higher in MNX (F = 1.7 ± 0.2; T = 1.6 ± 0.1) than in shams (F = 1.0 ± 0.1; T = 1.0 ± 0.1) at day 50, they were significantly lower in MNX (F = 0.6 ± 0.1; T = 0.7 ± 0.1) than in shams (F = 1.0 ± 0.1; T = 0.9 ± 0.1) at day 180. No change in 99m Tc-MDP uptake was observed over 6 months. Macroscopic analysis confirmed features of osteoarthritis only in MNX knees. These results in MNX guinea pigs provide additional support for the use of 99m Tc-NTP 15-5 for in vivo imaging of osteoarthritis. (orig.)

Measurement of technetium-99 in Marshall Islands soil samples by ICP-MS

Science.gov (United States)

Tagami; Uchida; Hamilton; Robison

2000-07-01

Extraction techniques for recovery of technetium-99 (99Tc) for Inductively Coupled Plasma Mass Spectrometry (ICP-MS) measurements were evaluated using soil samples collected from the Marshall Islands. The results of three different extraction techniques were compared: (MI) acid leaching of Tc from ashed soil; (M2) acid leaching of Tc from raw dry soil; and (M3) Tc volatilization from ashed soil using a combustion apparatus. Total Tc recoveries varied considerably between the extraction techniques but each method yielded similar analytical results for 99Tc. Applications of these extraction techniques to a series of environmental samples and ICP-MS measurements have yielded first data on the 99Tc content of Marshall Islands soil samples contaminated with close-in radioactive fallout from nuclear weapons testing. The 99Tc activity concentration in the soil samples ranged between 0.1 and 1.1 mBq g(-1) dry weight (dw). The limit of detection for 99Tc by ICP-MS was 0.17 mBq per sample or 0.014 mBq g(-1) dw under standard operating conditions.

Measurement of technetium-99 in Marshall Islands soil samples by ICP-MS

International Nuclear Information System (INIS)

Tagami, K.; Uchida, S.; Hamilton, T.; Robison, W.

2000-01-01

Extraction techniques for recovery of technetium-99 ( 99 Tc) for Inductively Coupled Plasma Mass Spectrometry (ICP-MS) measurements were evaluated using soil samples collected from the Marshall Islands. The results of three different extraction techniques were compared: (M1) acid leaching of Tc from ashed soil; (M2) acid leaching of Tc from raw dry soil; and (M3) Tc volatilization from ashed soil using a combustion apparatus. Total Tc recoveries varied considerably between the extraction techniques but each method yielded similar analytical results for 99 Tc. Applications of these extraction techniques to a series of environmental samples and ICP-MS measurements have yielded first data on the 99 Tc content of Marshall Islands soil samples contaminated with close-in radioactive fallout from nuclear weapons testing. The 99 Tc activity concentration in the soil samples ranged between 0.1 and 1.1 mBq g -1 dry weight (dw). The limit of detection for 99 Tc by ICP-MS was 0.17 mBq per sample or 0.014 mBq g -1 dw under standard operating conditions

Temperature-dependent viscosity analysis of SAE 10W-60 engine oil with RheolabQC rotational rheometer

Directory of Open Access Journals (Sweden)

Zahariea Dănuț

2017-01-01

Full Text Available The purpose of this work was to determine a viscositytemperature relationship for SAE 10W-60 engine oil. The rheological properties of this engine oil, for a temperature range of 20÷60 °C, were obtained with RheolabQC rotational rheometer. For the first reference temperature of 40 °C, the experimental result was obtained with a relative error of 1.29%. The temperature-dependent viscosity was modelled, comparatively, with the Arrhenius and the 3rd degree polynomial models. Comparing the graphs of the fits with prediction bounds for 95% confidence level, as well as the goodness-of-fit statistics, the preliminary conclusion was that the 3rd degree polynomial could be the best fit model. However, the fit model should be used also for extrapolation, for the second reference temperature of 100 °C. This new approach changes the fit models order, the Arrhenius equation becoming the best fit model, because of the completely failed to predict the extrapolated value with the polynomial model.

Game farming as a supplementary farming activity in the Karoo ...

African Journals Online (AJOL)

Game farming as a supplementary farming activity in the Karoo. ... Veld management in a game farming situation poses problems due to the ineffectiveness of rotational grazing systems. Simplification of natural ... AJOL African Journals Online.

Altered [99mTc]Tc-MDP biodistribution from neutron activation sourced 99Mo.

Science.gov (United States)

Demeter, Sandor; Szweda, Roman; Patterson, Judy; Grigoryan, Marine

2018-01-01

Given potential worldwide shortages of fission sourced 99 Mo/ 99m Tc medical isotopes there is increasing interest in alternate production strategies. A neutron activated 99 Mo source was utilized in a single center phase III open label study comparing 99m Tc, as 99m Tc Methylene Diphosphonate ([ 99m Tc]Tc-MDP), obtained from solvent generator separation of neutron activation produced 99 Mo, versus nuclear reactor produced 99 Mo (e.g., fission sourced) in oncology patients for which an [ 99m Tc]Tc-MDP bone scan would normally have been indicated. Despite the investigational [ 99m Tc]Tc-MDP passing all standard, and above standard of care, quality assurance tests, which would normally be sufficient to allow human administration, there was altered biodistribution which could lead to erroneous clinical interpretation. The cause of the altered biodistribution remains unknown and requires further research.

Effect of supplementary zinc on body mass index, pulmonary function and hospitalization in children with cystic fibrosis.

Science.gov (United States)

Ataee, Pedram; Najafi, Mehri; Gharagozlou, Mohammad; Aflatounian, Majid; Mahmoudi, Maryam; Khodadad, Ahmad; Farahmand, Fatemeh; Motamed, Farzaneh; Fallahi, Glolam Hossein; Kalantari, Najmoddin; Soheili, Habib; Modarresi, Vajiheh; Modarresi, Mozhgan Sabbaghian; Rezaei, Nima

2014-01-01

Zinc deficiency, which is common in patients with cystic fibrosis (CF), can lead to several complications that may increase the number of hospital admissions in this group of patients. As supplementary zinc can prevent such complications, this study was performed to evaluate the effect of supplementary zinc on body mass index (BMI), forced expiratory volume in one second (FEV1) and number of hospitalizations in CF patients. In this study, 30 children with CF, who were referred to the Digestive Diseases Clinic of the Children's Medical Center in Tehran, were enrolled. Supplementary zinc of 2 mg/kg per day was administered to all patients. Serum level of zinc, alkaline phosphatase, and albumin as well as BMI, FEV1, and number of hospitalizations were compared before and after zinc administration. Height (p<0.001), weight (p<0.001) and BMI (p=0.001) were significantly increased after zinc, while the number of hospitalizations was significantly decreased (p=0.023). In contrast to patients with normal pulmonary function tests who received supplement therapy, BMI was not increased in those with abnormal pulmonary function after supplementary zinc. Supplementary zinc can increase BMI in CF patients, mostly in those with normal pulmonary function. While supplementary zinc may decrease the number of hospitalizations, other factors can also influence the hospitalization number.

Blood cell labeling with technetium-99m. II. Measurement of circulating blood volume by sup(99m)Tc-labeled red blood cells

Energy Technology Data Exchange (ETDEWEB)

Uchida, T; Yoshida, H; Matsuda, S; Kimura, H; Miura, N [Fukushima Medical Coll. (Japan)

1978-02-01

Using a labeling method with sup(99m)Tc-pertechnetate to red blood cells (RBC), circulating blood volume was measured in comparison with that from /sup 51/Cr-labeled RBC method. The technique is easier than already published methods, because CIS kit for sup(99m)Tc-RBC labeling (TCK-11) became to be available recently. Two mls of ACD-anticoagulated blood were withdrawn and 0.5 ml of reducing reagent prepared just before use was added to blood, waiting 5 minutes and discarding the serum after centrifugation, then adding 100 ..mu..Ci of sup(99m)Tc. After washing the labeled cells by isotonic saline, cells were re-suspended in 10 ml of saline and injected to the subject. Blood specimen was obtained 10, 30, 60 and 120 minutes after infusion and blood volume was calculated by the usual way. Circulating blood volume by sup(99m)Tc was well correlated with that by /sup 51/Cr (=0.98, p 0.01), however, the value calculated from sup(99m)Tc were 4.8 percent higher than those by /sup 51/Cr, which suggested the elution of sup(99m)Tc from labeled RBC. sup(99m)Tc method has the advantages that higher radioactivity can be obtained in small amount of blood, which is useful in the determination of blood volume in children or in small animals in the laboratory. The measurement of blood volume of the mouse was done by using sup(99m)Tc method. The results were 1.70 +- 0.06 ml (6.35 +- 0.18%/gm), which coincided with the values reported previously. Because of it's short half life and low radiation dosage to the patients, sup(99m)Tc method will be recommended in the field of pediatrics or in patients with polycythemia or congestive heart failure, who are requested the repeated measurement of blood volume.

Defect chemistry and oxygen transport of (La0.6Sr0.4-xMx)(0.99)Co0.2Fe0.8O3-delta, M = Ca (x=0.05, 0.1), Ba (x=0.1, 0.2), Sr Part I: Defect chemistry

DEFF Research Database (Denmark)

Dalslet, Bjarke Thomas; Søgaard, Martin; Bouwmeester, Henry J.M.

2009-01-01

This paper is the first part of a two part series, where the effects of varying the A-site dopant on the defect chemistry, the diffusion coefficient and the surface catalytic properties of the materials (La0.6Sr0.4 − xMx)0.99Co0.2Fe0.8O3 − δ, M = Sr, Ca (x = 0.05, 0.1), Ba (x = 0.1, 0.2) (LSMFC......) have been investigated. In part I, the findings on the defect chemistry are reported, while the transport properties are reported in part II. Substitution of Sr2+ ions with Ca2+ ions (smaller ionic radius) and Ba2+ ions (larger ionic radius) strains the crystal structure differently for each...... composition while keeping the average valence of the cations constant. The Ba2+ containing materials show the largest oxygen loss at elevated temperatures, while the purely Sr2+ doped material showed the smallest oxygen loss. This was reflected in the partial oxidation entropy of the materials. The measured...

Preparation and biological profile of 99mTc-lidocaine as a cardioselective imaging agent using 99mTc eluted from 99Mo/99mTc generator based on Al-Mo gel

International Nuclear Information System (INIS)

Sakr, T.M.; October University of Modern Sciences and Arts; Ibrahim, A.B.; Rashed, H.M.; Fasih, T.W.

2017-01-01

The current study is aimed to prepare 99m Tc-lidocaine as a new myocardial perfusion-imaging agent. The used 99m Tc was obtained from Al- 99 Mo-molybdate(VI) gel matrix. 99m Tc-lidocaine showed higher (15.4 ± 0.11% ID/g) and faster (15 min post injection) cardiac uptake than the recently studied 99m Tc-valsartan and 99m Tc-procainamide. Consequently, 99m Tc-lidocaine will be a valuable myocardial SPECT agent for diagnosis of emergency patients. Besides, the receptor affinity study confirmed the selectivity of 99m Tc-lidocaine for sodium channels in the heart. (author)

Supplementary nitrogen in leeks based on crop nitrogen status

NARCIS (Netherlands)

Booij, R.; Meurs, E.J.J.

2002-01-01

From a number of basic relationships between several crop ecological components (Booij et al., 1996a) a system was developed for giving supplementary nitrogen application in leeks, that was based on the measurement of light interception. A description of the approach is given and a comparison is

75 FR 49938 - Proposed Collection; Comment Request; NIH NCI Central Institutional Review Board (CIRB...

Science.gov (United States)

2010-08-16

.... Frequency of Response: Once, except for the SAE Reviewer Worksheet. Affected Public: Includes the Federal...). Board Members CIRB SAE Reviewer Worksheet 10 15 30/60 (.5 hour) 75 (Attachment 6K). Total 2221 Request..., National Institutes of Health. [FR Doc. 2010-20167 Filed 8-13-10; 8:45 am] BILLING CODE 4140-01-P ...

Comparative study of 99Mo/99mTc generators at base of synthesized gels starting from 99Mo of activation and of fission

International Nuclear Information System (INIS)

Lopez M, I.Z.; Monroy G, F.; Rivero G, T.; Rojas N, P.

2007-01-01

At the present time the more used and diffused radionuclide in nuclear medicine it is the Technetium 99 metastable ( 99 mTc) it is used for diagnostic and therapy. It is produced starting from molybdenum 99 ( 99 Mo), which is absorbed in chromatographic columns, loaded with alumina that absorb only 0.2% of 99 Mo situation that forces to use high specific activities of 99 Mo that it is obtained starting from the fission of the 235 U. Given these conditions and limitations, new preparation procedures of 99 Mo/ 99m Tc generators, of low or medium specific activity, its have been developed, using gels of zirconium molybdates that incorporates until 30% in weight of 99 Mo in the gel, and also conserve similar characteristics of quality and purity that those obtained by the traditional generator; reducing by this way the cost of production of the 99m Tc, when using 99 Mo of low specific activity, in the preparation of 99 Mo/ 99m Tc generators. The radiochemical characteristics of the elution of 99m Tc, depends strongly on the gel preparation conditions. In particular, the present work has for object to determine the influence of the used type of 99 Mo, fission or activation product, during the gels synthesis, as well as the used air flow for the agitation in the gels preparation and its influence in the quality of the 99 Mo/ 99m Tc generators. When diminishing the agitation air flow the efficiency it increases and in the radionuclide purity of the eluates and when using 99 Mo of fission for the gels production it increases in an important way the elution efficiency, the radiochemical purity and radionuclide of the eluates of 99m Tc. (Author)

Technetium-99 in ''instant'' sup(99m)Tc-pertechnetate

International Nuclear Information System (INIS)

Mattsson, S.

1978-01-01

The 99 Tc-content in sup(99m)Tc-pertechnetate separated from 99 Mo by distillation or extraction has been studied with a plastic scintillation detector. The identification of the measured activity was achieved by beta-spectrometry, chemical separation and half-life studies. The frequency distribution of the sup(99)Tc/sup(99m)Tc-ratios in the different samples was observed to be log-normal. The most likely activity ratio was 0.4x10 -6 , the maximum value being 5x10 -6 . The specific activity of ''instant'' pertechnetate is approximately a factor of 60 lower than that normally recorded in pertechnetate derived from daily eluted column generators. The low specific activity of ''instant'' pertechnetate is primarily explained by the long time between separation and usage and secondly by the low yield of Tc in the distillation and extraction processes. In several of the ''instant'' pertechnetate solutions the carrier concentration exceeded the reductive capacity of the stannous ions in ''kits'' with small amounts of Sn(II) in usable form. (T.G.)

Potential Ways to Address Shortage Situations of 99Mo/99mTc.

Science.gov (United States)

Filzen, Leah M; Ellingson, Lacey R; Paulsen, Andrew M; Hung, Joseph C

2017-03-01

99m Tc, the most common radioisotope used in nuclear medicine, is produced in a nuclear reactor from the decay of 99 Mo. There are only a few aging nuclear reactors around the world that produce 99 Mo, and one of the major contributors, the National Research Universal (Canada), ceased production on October 31, 2016. The National Research Universal produced approximately 40% of the world's 99 Mo supply, so with its shut down, shortages of 99 Mo/ 99m Tc are expected. Methods: Nuclear pharmacies and nuclear medicine departments throughout the United States were contacted and asked to provide their strategies for coping with a shortage of 99 Mo/ 99m Tc. Each of these strategies was evaluated on the basis of its effectiveness for conserving 99m Tc while still meeting the needs of the patients. Results: From the responses, the following 6 categories of strategies, in order of importance, were compiled: contractual agreements with commercial nuclear pharmacies, alternative imaging protocols, changes in imaging schedules, software use, generator management, and reduction of ordered doses or elimination of backup doses. Conclusion: The supply chain of 99 Mo/ 99m Tc is quite fragile; therefore, being aware of the most appropriate coping strategies is crucial. It is essential to build a strong collaboration between the nuclear pharmacy and nuclear medicine department during a shortage situation. With both nuclear medicine departments and nuclear pharmacies implementing viable strategies, such as the ones proposed, the amount of 99m Tc available during a shortage situation can be maximized. © 2017 by the Society of Nuclear Medicine and Molecular Imaging.

A model to decompose the performance of supplementary private health insurance markets.

Science.gov (United States)

Leidl, Reiner

2008-09-01

For an individual insurance firm offering supplementary private health insurance, a model is developed to decompose market performance in terms of insurer profits. For the individual contract, the model specifies the conditions under which adverse selection, cream skimming, and moral hazard occur, shows the impact of information on contracting, and the profit contribution. Contracts are determined by comparing willingness to pay for insurance with the individual's risk position, and information on both sides of the market. Finally, performance is aggregated up to the total market. The model provides a framework to explain the attractiveness of supplementary markets to insurers.

Supplementary training of nuclear power plant occupational physicians

International Nuclear Information System (INIS)

Letard, H.; Carre, M.

1980-01-01

A short description is given of the supplementary training course given to nuclear power plant occupational physicians within the frame of the Division of occupational medicine at Electricite de France. Such training is necessary to deal with the specific problems involved. However, it is only a complement to medical studies and the special degree in occupational medicine and industrial hygiene [fr

Nanostructured metal oxides: promise opportunity and challenge to develop clinically useful 99Mo/99mTc generators using (n, gamma)99Mo

International Nuclear Information System (INIS)

Dash, Ashutosh

2014-01-01

The role of 99m Tc diagnostic nuclear medicine needs hardly to be reiterated. Today, it is the most widely used radionuclide for single photon emission computed tomography (SPECT) imaging procedures. The current strategy of availing 99m Tc is ensured from column chromatographic 99 Mo/ 99m Tc generators using a bed of acidic alumina. While the column chromatographic 99 Mo/ 99m Tc generator constitute a successful exemplar of availing 99m Tc, the limited capacity of alumina (2-20 mg Mo per g of alumina) for taking up molybdate ions necessitates the use of 99 Mo of the highest specific activity available, as can be found in fission produced 99 Mo (F 99 Mo). In order to reduce dependence of F 99 Mo, the scope of using low specific activity (n,γ) 99 Mo along with high capacity adsorbent is an interesting prospect. In this context, the scope of using nanomaterials as a viable adsorbent seemed attractive by virtue of their huge surface to volume ratios, altered physical properties, tailored surface chemistry, favorable adsorption characteristics, and enhanced surface reactivity resulting from the nanoscale dimensions. This emerging class of adsorbent represents an innovative paradigm and is expected to play an important role in the development of 99 Mo/ 99m Tc generators adaptable to the existing and foreseeable demands. This talk outlines a critical assessment on the role of nanostructured metal oxides, recent developments, the contemporary status, and key challenges and apertures to the near future. (author)

Early detection and monitoring of cartilage alteration in the experimental meniscectomised guinea pig model of osteoarthritis by {sup 99m}Tc-NTP 15-5 scintigraphy

Energy Technology Data Exchange (ETDEWEB)

Miot-Noirault, Elisabeth; Vidal, Aurelien; Bonafous, Jacques; Audin, Laurent; Madelmont, Jean-Claude; Moins, Nicole [UMR 484 INSERM, Rue Montalembert, BP 184, Clermont-Ferrand Cedex (France); Pastoureau, Philippe; Chomel, Agnes [Institut de Recherches Servier, Suresnes (France); Sarry, Laurent [ERI 14 INSERM - Faculte de Medecine, Clermont-Ferrand (France)

2007-08-15

This study in the meniscectomised guinea pig aimed to demonstrate that the radiotracer {sup 99m}Tc-NTP 15-5 would have pathophysiological validity for in vivo osteoarthritis imaging. The specificity of {sup 99m}Tc-NTP 15-5 for cartilage was determined in healthy animals (n = 13), by tissue radioactivity counting, joint autoradiography and scintigraphy. {sup 99m}Tc-NTP 15-5 scintigraphy was performed at 20, 50, 80, 115, 130, 150 and 180 days after medial meniscectomy (n = 10 MNX) or sham operation (n = 5), and scintigraphic ratios (operated/contralateral) were calculated for femoral (F) and tibial (T) areas. F and T ratios were compared with those of {sup 99m}Tc-MDP bone scintigraphy. At the study end-point, autoradiographic analysis of joint {sup 99m}Tc-NTP 15-5 distribution and macroscopic scoring of cartilage integrity were performed. The high and specific accumulation of {sup 99m}Tc-NTP 15-5 in normal cartilage (about 5.5 {+-} 1.7 % of injected dose/g of tissue), which permitted joint imaging with high contrast, was affected by osteoarthritis. In the MNX group, {sup 99m}Tc-NTP 15-5 accumulation in cartilage within the operated joint, relative to the contralateral joint, was observed to change in the same animals as pathology progressed. Although F and T ratios were significantly higher in MNX (F = 1.7 {+-} 0.2; T = 1.6 {+-} 0.1) than in shams (F = 1.0 {+-} 0.1; T = 1.0 {+-} 0.1) at day 50, they were significantly lower in MNX (F = 0.6 {+-} 0.1; T = 0.7 {+-} 0.1) than in shams (F = 1.0 {+-} 0.1; T = 0.9 {+-} 0.1) at day 180. No change in {sup 99m}Tc-MDP uptake was observed over 6 months. Macroscopic analysis confirmed features of osteoarthritis only in MNX knees. These results in MNX guinea pigs provide additional support for the use of {sup 99m}Tc-NTP 15-5 for in vivo imaging of osteoarthritis. (orig.)

Alleviation SSR and Low Frequency Power Oscillations in Series Compensated Transmission Line using SVC Supplementary Controllers

Science.gov (United States)

Kumar, Sanjiv; Kumar, Narendra

2017-06-01

In this work, supplementary sub-synchronous damping controllers (SSDC) are proposed for damping sub-synchronous oscillations in power systems with series compensated transmission lines. Series compensation have extensively been used as effective means of increasing the power transfer capability of a transmission lines and improving transient stability limits of power systems. Series compensation with transmission lines may cause sub-synchronous resonance (SSR). The eigenvalue investigation tool is used to ascertain the existence of SSR. It is shown that the addition of supplementary controller is able to stabilize all unstable modes for T-network model. Eigenvalue investigation and time domain transient simulation of detailed nonlinear system are considered to investigate the performance of the controllers. The efficacies of the suggested supplementary controllers are compared on the IEEE first benchmark model for computer simulations of SSR by means of time domain simulation in Matlab/Simulink environment. Supplementary SSDC are considered in order to compare effectiveness of SSDC during higher loading in alleviating the small signal stability problem.

Spoken Narrative Assessment: A Supplementary Measure of Children's Creativity

Science.gov (United States)

Wong, Miranda Kit-Yi; So, Wing Chee

2016-01-01

This study developed a spoken narrative (i.e., storytelling) assessment as a supplementary measure of children's creativity. Both spoken and gestural contents of children's spoken narratives were coded to assess their verbal and nonverbal creativity. The psychometric properties of the coding system for the spoken narrative assessment were…

Supplementary winter feeding and reproduction of beef heifers on ...

African Journals Online (AJOL)

Supplementary winter feeding and reproduction of beef heifers on Dohne sourveld. JA Erasmus, HH Barnard. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

Downsized Boosted Engine Benchmarking Method and Results (SAE Paper 2015-01-1266)

Science.gov (United States)

Light-duty vehicle greenhouse gas (GHG) and fuel economy (FE) standards for MYs 2012 -2025 are requiring vehicle powertrain to become much more efficient. One key technology strategy that vehicle manufacturers are using to help comply with GHG and FE standards is to replace natu...

EVALUACIÓN EXPERIMENTAL DE LA RESISTENCIA A LA CORROSIÓN DE UN ACERO AISI-SAE 4140 IMPLANTADO CON IONES DE NITRÓGENO

Directory of Open Access Journals (Sweden)

DARIO PEÑA

2009-01-01

Full Text Available Se estudió la resistencia a la corrosión de un acero AISI-SAE 4140 implantado con iones de Nitrógeno mediante la técnica 3DII (Implantación Iónica Tridimensional. Se evaluaron diferentes rugosidades de las muestras implantadas mediante técnicas electroquímicas de Rp, EIS y Tafel en una salmuera al 3% de NaCl, donde se obtuvo la mayor resistencia a la corrosión para el material implantado con menor rugosidad. Se produjo la formación de una posible capa protectora estable con la inmersión de las muestras en el electrolito de trabajo para tiempos superiores a 240 horas.

Decay of 99Mo

International Nuclear Information System (INIS)

Dickens, J.K.; Love, T.A.

1976-01-01

Relative intensities for K x-rays and gamma rays emanating from 99 Mo in equilibrium with its 99 Tc* daughter have been measured using several Ge photon detectors. Combining these intensities with an evaluated set of electron-conversion coefficients has provided a set of absolute intensities for the observed gamma rays. The absolute intensity for the dominant 140.5-keV gamma ray in 99 Tc was determined to be 90.7 +- 0.6/100 99 Mo disintegrations for 99 Mo decay in equilibrium with decay of the 99 Tc* daughter

Influence of splenectomy on the biodistribution of technetium-99m dimercaptosuccinic acid (99mTc-DMSA) in rats

International Nuclear Information System (INIS)

Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Villarim Neto, Arthur; Rego, Amalia Cinthia Meneses; Bernardo-Filho, Mario; Azevedo, Italo Medeiros; Araujo Filho, Irami; Medeiros, Aldo Cunha

2008-01-01

This study aimed to evaluate if the splenectomy alters the biodistribution of 99mTc-DMSA and renal function in Wistar rats. The animals were separated in the groups: splenectomy (n = 6) and control (n = 6). After splenectomy (15 days), the administration of 0.1 ml of 99mTc-DMSA IV (0.48 MBq) was carried out. Thirty minutes later, kidney, heart, lung, thyroid, stomach, bladder and femur and samples of blood were isolated. The organs were weighed, counted and the percentage of radioactivity /g (%ATI/g) determined. Serum urea and creatinine, hematocrit, leukocytes and platelets were measured. Statistics by t test (p<0.05) was done. There was a significant reduction in %ATI/g in kidney and blood (p<0.05) of splenectomized animals, a significant increase (p<0.05) of urea (88.8 ± 18.6 mg/dL) and creatinine (0.56 ± 0.08 mg/dL), compared to the controls (51.5±1.6, 0.37±0.02 mg/dL, respectively), as well as increase in platelets and leucocytes, and hematocrit reduction. The analysis of the results indicates that in rats, splenectomy seems to alter the renal function and the uptake of 99mTc-DMSA. (author)

Influence of splenectomy on the biodistribution of technetium-99m dimercaptosuccinic acid (99mTc-DMSA) in rats

Energy Technology Data Exchange (ETDEWEB)

Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Villarim Neto, Arthur; Rego, Amalia Cinthia Meneses [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Centro de Ciencias da Saude; Bernardo-Filho, Mario [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Dept. de Biofisica e Biometria; Azevedo, Italo Medeiros; Araujo Filho, Irami; Medeiros, Aldo Cunha [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. de Cirurgia]. E-mail: aldo@ufrnet.br

2008-12-15

This study aimed to evaluate if the splenectomy alters the biodistribution of 99mTc-DMSA and renal function in Wistar rats. The animals were separated in the groups: splenectomy (n = 6) and control (n = 6). After splenectomy (15 days), the administration of 0.1 ml of 99mTc-DMSA IV (0.48 MBq) was carried out. Thirty minutes later, kidney, heart, lung, thyroid, stomach, bladder and femur and samples of blood were isolated. The organs were weighed, counted and the percentage of radioactivity /g (%ATI/g) determined. Serum urea and creatinine, hematocrit, leukocytes and platelets were measured. Statistics by t test (p<0.05) was done. There was a significant reduction in %ATI/g in kidney and blood (p<0.05) of splenectomized animals, a significant increase (p<0.05) of urea (88.8 {+-} 18.6 mg/dL) and creatinine (0.56 {+-} 0.08 mg/dL), compared to the controls (51.5{+-}1.6, 0.37{+-}0.02 mg/dL, respectively), as well as increase in platelets and leucocytes, and hematocrit reduction. The analysis of the results indicates that in rats, splenectomy seems to alter the renal function and the uptake of 99mTc-DMSA. (author)

[Surgical treatment of gliomas involving the supplementary motor area in the superior frontal gyrus].

Science.gov (United States)

Liu, Wei; Lai, Jian-jun; Qu, Yuan-ming

2004-07-07

To explore surgical treatment of gliomas involving the supplementary motor area (SMA) in the superior frontal gyrus. Clinical data and follow-up outcome of 16 patients with low graded astrocytomas involving the supplementary motor area were analyzed. SMA syndrome was developed in 6 patients in whom the posterior tumor resection line was at a distance of more than 1 cm from the precentral sulcus and resolved after 12 months. Hemiplegia occurred however in 8 patients in whom the resection line was less than 1 cm to precentral sulcus and only resolved in 3 patients during follow period 12 months. When the resection is performed at a distance of less than 1 cm from the precentral sulcus, surgery for gliomas of involving the supplementary motor area in the superior frontal gyrus may be result in permanent morbidity.

Brachytherapy model with sodium pertechnetate-{sup 99m}Tc balloon (Na{sup 99m}TcO{sub 4}{sup -}) for breast cancer: evaluation of dosimetry and cell response; Modelo de braquiterapia com balao de pertecnetato de sodio-{sup 99m}Tc (Na{sup 99m}TcO{sub 4}{sup -}) para cancer de mama: avaliacao da dosimetria e resposta celular

Energy Technology Data Exchange (ETDEWEB)

Lima, Carla Flavia de

2016-07-01

Breast cancer is the most common type of cancer that affects more women worldwide. Among various treatment options, radiotherapy which is often used as a treatment for locoregional recurrences control or to decrease tumor size. In patients with breast cancer at an early stage, a booster dose (boost) in the primary tumor area can be applied after conventional radiation therapy. There are several drawbacks to applying this technique. In this work we aimed to perform a dosimetric analysis in a breast model, where it put a balloon filled with sodium pertechnetate-{sup 99m}Tc (Na{sup 99m}TcO{sub 4}{sup -}) which in future could be used in preference to other possible therapies. The methodology involved the development of dosimetry in water based on radiochromic films and in a computational voxel thorax model. Calibration protocol achieved a mathematical relation between absorbed dose versus optical density (OD) measured at a set of radiochromic sample films placed at the surface of the balloon plus 1 cm up to 10 cm far, in which theoretical dose values were provided by MCNP modeling, reproducing the water equivalent physical simulator. A voxel model of a female thorax, developed at the SISCODES/MCNP codes, received a filled balloon inside. Spatial dose distribution was generated, illustrating the dose received in the chest wall, glandular tissue, breast skin and lung. The dosimetric findings contribute to present the Na{sup 99m}TcO{sub 4}{sup -} balloon modality which provides a suitable spatial dose distribution in the tumor bed preserving adjacent health tissues. We also studied the radiobiological response radio resistant mammary adenocarcinoma cells (MDAMB231) by exposure of these cells to Na{sup 99m}TcO{sub 4}{sup -} balloon. The findings include the presence of apoptotic cells in the balloon around point out a favorable response. In conclusion, the balloon may represent a viable option in the supplementary therapy of breast cancer in patients who have appropriate

Comparative study of {sup 99}Mo/{sup 99m}Tc generators at base of synthesized gels starting from activation and fission {sup 99}Mo; Estudio comparativo de generadores {sup 99}Mo/{sup 99m}Tc a base de geles sintetizados a partir de {sup 99}Mo de activacion y de fision

Energy Technology Data Exchange (ETDEWEB)

Lopez M, I Z [UAEM, Paseo Colon esq. Paseo Tollocan, 50120 Toluca, Estado de Mexico (Mexico); Monroy G, F; Rivero G, T; Rojas N, P [ININ, Carretera Mexico -Toluca S/N, 52045 La Marquesa Ocoyoacac, Estado de Mexico (Mexico)

2007-07-01

The {sup 99m}Tc is used for diagnostic and therapy. It is produced starting from {sup 99}Mo, absorbed in chromatographic columns, loaded with alumina that absorb only 0.2% of {sup 99}Mo with high specific activities of {sup 99}Mo, obtained from the {sup 235}U fission. Given these conditions and limitations, new preparation procedures of {sup 99}Mo/{sup 99m}Tc generators, its have been developed, using zirconium molybdates gels that incorporates until 30% of {sup 99}Mo, conserve similar characteristics of quality and purity that the traditional generator. The radiochemical characteristics of the {sup 99m}Tc elution, depend strongly on the gel preparation conditions. In particular, the present work has by object to determine the influence of the {sup 99}Mo used type, fission or activation product, during the gels synthesis, as well as the used air flow for the agitation in the gels preparation and its influence in the {sup 99}Mo/{sup 99m}Tc generators quality. When diminishing the flow of agitation air the efficiency it increases and in the radionuclide purity of the eluates and when using {sup 99}Mo from fission for the gels production it increases in an important way the elutriation efficiency, the radiochemical and radionuclide purity of the {sup 99m}Tc eluates. (Author)

Results of regular study on radionuclidic purity of sup(99m)Tc obtained from 99Mo-sup(99m)Tc generators

International Nuclear Information System (INIS)

Vlcek, J.; Rohacek, J.; Husak, V.

1979-01-01

A total of 39 sup(99m)Tc eluates obtained from 9 99 Mo-sup(99m)Tc generators delivered by The Radiochemical Centre Amersham during one year was studied with regard to their radionuclide purity. Using a Ge(Li) spectrometer the contaminants 60 Co, 103 Ru, 131 I, 134 Cs, 140 La and 188 Re were found in sup(99m)Tc-eluates with average levels ranging from 2.9 x 10 -3 to 2.8 x 10 -1 per cent of sup(99m)Tc activity. The additional total body absorbed dose caused by these contaminants, as calculated from their average content in sup(99m)Tc eluates, was less than 1% of the dose due to sup(99m)Tc pertechnetate. (orig.) 891 MG/orig. 892 CS [de

Evaluation of 99mTc(CO)5I as a potential lung perfusion agent

International Nuclear Information System (INIS)

Miroslavov, Alexander E.; Gorshkov, Nikolay I.; Lumpov, Alexander L.; Yalfimov, Anatoly N.; Suglobov, Dmitrii N.; Ellis, Beverley L.; Braddock, Rattana; Smith, Anne-Marie; Prescott, Mary C.; Lawson, Richard S.; Sharma, Harbans L.

2009-01-01

Introduction: The use of 99m Tc-macroggregated albumin for lung perfusion imaging is well established in nuclear medicine. However, there have been safety concerns over the use of blood-derived products because of potential contamination by infective agents, for example, Variant Creutzfeldt Jakob Disease. Preliminary work has indicated that Tc(CO) 5 I is primarily taken up in the lungs following intravenous administration. The aim of this study was to evaluate the biodistribution and pharmacokinetics of 99m Tc(CO) 5 I and its potential as a lung perfusion agent. Methods: 99m Tc(CO) 5 I was synthesized by carbonylation of 99m TcO 4- at 160 atm of CO at 170 deg. C in the presence of HI for 40 min. Radiochemical purity was determined by HPLC using 99 Tc(CO) 5 I as a reference. 99m Tc(CO) 5 I was administered by ear-vein injection to three chinchilla rabbits, and dynamic images were acquired using a gamma camera (Siemens E-cam) over 20 min. Imaging studies were also performed with 99m Tc-labeled macroaggregated albumin ( 99m Tc-MAA) and 99m TcO 4- for comparison. 99m Tc(CO) 5 I was administered intravenously to Sprague-Dawley rats, and tissue distribution studies were obtained at 15 min and 1 h postinjection. Comparative studies were performed using 99m Tc-MAA. Results: Radiochemical purity, assessed by HPLC, was 98%. The retention time was similar to that of 99 Tc(CO) 5 I. The dynamic images showed that 70% of 99m Tc(CO) 5 I appeared promptly in the lungs and remained constant for at least 20 min. In contrast, 99m TcO 4- rapidly washed out of the lungs after administration. As expected 99m Tc-MAA showed 90% lung accumulation. The percentage of injected dose per gram of organ ±S.D. at 1 h for 99m Tc(CO) 5 I was as follows: blood, 0.22±0.02; lung, 12.8±2.87; liver, 0.8±0.15; heart, 0.15±0.01; kidney, 0.47±0.08. The percentage of injected dose per organ ±S.D. at 1 h was as follows: lung, 22.47±2.31; liver, 10.53±1.8; heart, 0.18±0.01; kidney, 1.2±0.17. Tissue

Radionuclidic contamination of 99Mo, 131I and 103Ru in the eluate of 99Mo-99mTc chromatographic generator: comparision on fission produced 99Mo from RPC, Nordio and ARI

International Nuclear Information System (INIS)

Soenarjo, Sunarhadijoso; Gunawan, Adang Hardi

1996-01-01

The 99 Mo- 99m Tc Chromatographic generators is the most popular system to provide 99m Tc medical radioisotope. Radioisotope Production Centre (RPC)- BATAN has routinely produced the generator loaded with 99 Mo prepared by 235 U fission. By using fission produced 99 Mo, the resulting 99m Tc is potentially contaminated by other fission products which are difficult to eliminate completely. In order to study the characteristic of the generator and radionuclidic impurity pattern of the 99m Tc eluates, an evaluation of gamma spectrometric determination has been carried out. The bulk solutions of 99 Mo produced by RPC BATAN (Indonesia), Nordion (Canada) and ARI (Australia) were loaded to generators manufactured between July 1993 to May 1994. The saline-eluate 99m Tc, in a total volume of 10 ml each, was subjected to gamma spectrometric determination. The radiation of 99m Tc was eliminated by lead shield of 0.6913 cm thickness. The 99m Tc yield fluctuation from 28 generators indicated that the characteristics of the generator columns were very good. The 99m Tc eluates were consistently contaminated by 99 Mo, 131 I and 103 Ru, although the contamination level in all cases did not exceed the maximum permissible levels. The fluctuation of radionuclidic impurities were probably caused by variation in the irradiation parameter or by variation in the 99 Mo separation methods. (author), 23 refs, 1 tab, 3 figs

49 CFR 1242.41 - Other and casualties and insurance (accounts XX-26-99 and 50-26-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Other and casualties and insurance (accounts XX-26... RAILROADS 1 Operating Expenses-Equipment § 1242.41 Other and casualties and insurance (accounts XX-26-99 and... administration (account XX-26-01). freight cars ...

Exploring the Relationship between Supplementary Schools and "Cohesive Communities"

Science.gov (United States)

Rose, Anthea

2013-01-01

The number of supplementary schools in England serving minority communities continues to grow. They are popular with the parents of such communities because they often feel their children are disadvantaged in mainstream schools and not afforded the opportunities or the learning environment that is conducive to their children achieving their full…

reaction of some rumen micro flora to different supplementary feeds

African Journals Online (AJOL)

Preferred Customer

purpose of this study was to evaluate rumen microbial changes as the function of varying supplementary .... conditions and altitude of 2400 m.a.s.l. Animal ... temperature in water bath with continuous supply ... llowed by boiling for 5 minutes.

Operation of plant to produce Mo-99 from fission products

International Nuclear Information System (INIS)

Marques, R.O.; Cristini, P.R.; Marziale, D.P.; Furnari, E.S.; Fernandez, H.O.

1987-01-01

As it is well known, the production of Mo-99/Tc-99m generators has an outstanding place in radioisotope programs of the Argentine National Atomic Energy Commission. The basic raw material is Mo-99 from fission of U-235. In 1985 the production plant of this radionuclide began to operate, according to an adaptation of the method that was developed in Kernforschungszentrum Karlsruhe. The present work describes the target irradiation conditions in the reactor RA-3 (mini plates of U/Al alloy with 90% enriched uranium), the flow diagram and the operative conditions of the production process. The containment, filtration and removal conditions of the generated fission gases and the disposal of liquid and solid wastes are also analyzed. On the basis of the experience achieved in the development of more than twenty production processes, process efficiency is analyzed, taking into account the theoretical evaluation resulting from the application of the computer program 'Origin'(ORML) to the conditions of our case. The purity characteristics of the final product are reported (Zr-95 0,1 ppm; Nb-95 1 ppm; Ru-103 20 ppm; I-131 10 ppm) as well as the chemical characteristics that make it suitable to be used in the production of Mo-99/I c-99m generators. (Author)

Experimental Investigation on Tool Wear Behavior and Cutting Temperature during Dry Machining of Carbon Steel SAE 1030 Using KC810 and KC910 Coated Inserts

Directory of Open Access Journals (Sweden)

Y. Tamerabet

2018-03-01

Full Text Available The removal of cutting fluids and lubrication in dry machining operations requires a good knowledge and full control of all the mechanisms that lead to tool damage. In order to optimize dry machining operations, it is necessary to clearly identify the wear patterns, determine the contact conditions and define the relationship between the contact parameters and the operating conditions. The idea is to choose optimal cutting conditions which lead to the best contact conditions limiting the triggering or aggravation of wear phenomena. The purpose of this paper is to determine the impact multilayer coatings and cutting parameters on tool wear and temperature at the tool-chip interface for two types of coated carbides (KC810 and KC910 Commercialized inserts during dry turning operation of carbon steel SAE 1030, in order to determine the ideal parameters and guarantee the best performances of the cutting tools. Cutting temperature, Crater and Flank wear have been systematically recorded in order to determine their influence on tool life time. To ensure the optimum choice of machining conditions; the TAGUCHI method associated to multi-factorial method were applied to plan the experiments. It has been noted that cutting speed was the most influential factor on temperature and wear evolution. We noted also that the KC810 insert was more suitable for machining of SAE 1030 Carbon Steel; where The best life time was registered (T=228 min. The KC810 inserts offer 30 min of additional machining time for the same work conditions.

'99Mo/99mTc Generator Based on High Radionuclidic Pure Zirconium Molybdate Gel

International Nuclear Information System (INIS)

Amin, M.; Mostafa, M.; El-Amir, M.A.; El-Absy, M.A.; Mohamed, O.I.; Farag, A.B.

2014-01-01

99 Mo / 99 mTc radioisotope generator was prepared using in-situ precipitated zirconium molybdate chromatographic column. Zirconium molybdate gel matrix was synthesized by precipitation of neutron activation molybdenum-99 from its solution after variety purification processes to prevent contamination of the 99m Tc eluate with cross-contaminants. Greeter than 82.7 ± 0.4 % of the generated 99m Tc was immediately and reproducible eluted by passing 10 ml 0.9 % NaCl solution through the 1 g zirconium molybdate- 99 Mo column matrix at a flow rate of 0.5 ml / min and room temperature with high chemical, radionuclide ( ≥ 99.9 % 99m Tc) and radiochemical purity ( ≥ 97.7 % % as 99 mTcO 4 - ) with ph value suitable for medical uses.

Measurement of technetium-99 in Marshall Islands soil samples by ICP-MS

Energy Technology Data Exchange (ETDEWEB)

Tagami, K. E-mail: k_tagami@nirs.go.jp; Uchida, S.; Hamilton, T.; Robison, W

2000-07-15

Extraction techniques for recovery of technetium-99 ({sup 99}Tc) for Inductively Coupled Plasma Mass Spectrometry (ICP-MS) measurements were evaluated using soil samples collected from the Marshall Islands. The results of three different extraction techniques were compared: (M1) acid leaching of Tc from ashed soil; (M2) acid leaching of Tc from raw dry soil; and (M3) Tc volatilization from ashed soil using a combustion apparatus. Total Tc recoveries varied considerably between the extraction techniques but each method yielded similar analytical results for {sup 99}Tc. Applications of these extraction techniques to a series of environmental samples and ICP-MS measurements have yielded first data on the {sup 99}Tc content of Marshall Islands soil samples contaminated with close-in radioactive fallout from nuclear weapons testing. The {sup 99}Tc activity concentration in the soil samples ranged between 0.1 and 1.1 mBq g{sup -1} dry weight (dw). The limit of detection for {sup 99}Tc by ICP-MS was 0.17 mBq per sample or 0.014 mBq g{sup -1} dw under standard operating conditions.

Radionuclide Basics: Technetium-99

Science.gov (United States)

Technetium-99 (chemical symbol Tc-99) is a silver-gray, radioactive metal. It occurs naturally in very small amounts in the earth's crust, but is primarily man-made. Technetium-99m is a short-lived form of Tc-99 that is used as a medical diagnostic tool.

Sorption of {sup 99}MoO{sub 4}{sup 2-} ions on commercial hydrotalcites

Energy Technology Data Exchange (ETDEWEB)

Serrano, J.; Gonzalez, H.; Lopez, H.; Aranda, N.; Granados, F.; Bulbulian, S. [Delegacion Miguel Hidalgo, Mexico (Mexico). Instituto Nacional de Investigaciones Nucleares

2005-07-01

{sup 99}MoO{sub 4}{sup 2-} sorption behavior on 3 commercial hydrotalcites, produced by Sasol Chemie, was studied through batch experiments. Only one of them showed high sorption capacity. This product, the MG70 was identified by XRD diffraction analysis as hydrotalcite (Mg{sub 6}Al{sub 2}(OH){sub 16}CO{sub 3} x 4H{sub 2}O), while the other two, MG50 and MG30, were identified mainly as magnesium aluminum hydroxide hydrate, MgAl{sub 2}(OH){sub 14} x 3H{sub 2}O. Calcined MG70 (CMG70) was used to retain about 298.17{+-}8.3 mg of {sup 99}Mo-MoO{sub 4}{sup 2-} (MG70-{sup 99}MoO{sub 4}). When this material was packed in a glass column, the generated {sup 99m}Tc was eluted by using NaCl or HNO{sub 3} aqueous solutions. Saline solutions eluted {sup 99m}Tc with considerable amounts of {sup 99}Mo while 0.1 M HNO{sub 3} eluted {sup 99m}Tc together with a such small amount of {sup 99}Mo that the {sup 99}Mo {mu}Ci/{sup 99m}Tc mCi ratios are close to the value recommended by the American Pharmacopeia. (orig.)

99Mo-99mTc generator - study of their performance and quality

International Nuclear Information System (INIS)

Acar, M.E.D.

1987-01-01

In this work the performance of the 99 Mo - 99m Tc generators produced at IPEN-CNEN/SP as well as the quality of the eluted solutions were analysed. The following parameters were studied: elution efficiency, chemical radiochemical, radionuclidic and microbiological purities and pH of the eluates. The 99m Tc yield ranged from 84,7 to 98,5%. The radioactivity due to the pertechnetate ion in the studied solutions was higher than 97,5%. The aluminium content in eluates, determined by spectrophotometry, was lower than 2,5 μg/ml and the pH of the solutions between 4,5 and 5,1. Radioactive impurities of the order of 10 -3 KBq 99 Mc/MBq 99m Tc and 10 -5 KBq 131 I/MBq 99m Tc were found in the eluates at the time of elution. Other γ emitting radioactive impurities were order of 10 -3 KBq/MBq 99m Tc. The eluates were sterile and pyrogen-free. From the results obtained in this work one can state that the IPEN-TEC generator is a reliable source of good quality 99m Tc-pertechnetate. (author) [pt

Provision of Supplementary Load Frequency Control via Aggregation of Air Conditioning Loads

Directory of Open Access Journals (Sweden)

Lei Zhou

2015-12-01

Full Text Available The integration of large-scale renewable energy poses great challenges for the operation of power system because of its increased frequency fluctuations. More load frequency control (LFC resources are demanded in order to maintain a stable system with more renewable energy injected. Unlike the costly LFC resources on generation side, the thermostatically controlled loads (TCLs on the demand side become an attractive solution on account of its substantial quantities and heat-storage capacity. It generally contains air conditioners (ACs, water heaters and fridges. In this paper, the supplementary LFC is extracted by the modeling and controlling of aggregated ACs. We first present a control framework integrating the supplementary LFC with the traditional LFC. Then, a change-time-priority-list method is proposed to control power output taking into account customers’ satisfaction. Simulations on a single-area power system with wind power integration demonstrate the effectiveness of the proposed method. The impact of ambient temperature changes and customer preferences on room temperature is also involved in the discussion. Results show that the supplementary LFC provided by ACs could closely track the LFC signals and effectively reduce the frequency deviation.

99Mo production by 100Mo(n,2n)99Mo using accelerator neutrons

International Nuclear Information System (INIS)

Sato, Nozomi; Kawabata, Masako; Nagai, Yasuki; Hashimoto, Kazuyuki; Hatsukawa, Yuichi; Saeki, Hideya; Motoishi, Shoji; Kin, Tadahiro; Konno, Chikara; Ochiai, Kentaro; Takakura, Kosuke; Minato, Futoshi; Iwamoto, Osamu; Iwamoto, Nobuyuki; Hashimoto, Shintaro

2013-01-01

We proposed a new route to produce a medical radioisotope 99 Mo by the 100 Mo(n,2n) 99 Mo reaction using accelerator neutrons. A high-quality 99 Mo with a minimum level of radioactive waste can be obtained by the proposed reaction. The decay product of 99 Mo, 99m Tc, is separated from 99 Mo by the sublimation method. The proposed route could bring a major breakthrough in the solution of ensuring a constant and reliable supply of 99 Mo. (author)

Report of the supplementary measuring program Chernobyl

International Nuclear Information System (INIS)

Vaas, L.H.

1988-06-01

In this report, which is a continuation of the report of the Dutch Coordination Commission for measurement of Radioactivity and Xenobiotic materials (CCRX) ''Radioactive contamination in the Netherlands caused by the reactor accident in Chernobylsk'' of October 1986, the results are discussed of the supplementary measuring programme, till October 1st 1987, and a survey is given of the state of affairs with regard to the execution of the recommendations from the first Chernobylsk report. (H.W.). 53 refs.; 28 figs.; 50 tabs

Present status of Mo-99/Tc-99m generator in Thailand

International Nuclear Information System (INIS)

Khongpetch, Pranom

2007-01-01

Isotop Production Program, Office of Atoms for Peace had produced technetium-99m by MEK extraction of Mo-99 obtained from (n,γ) reaction in TRIGA Mark III reactor and supplied to nuclear medicine centers in Bangkok from 1980 to 1997. Because of the difficulty to meet the increased demand and limitation of reactor operation, the production of technetium-99m was stopped in 1997. Presently, there are 21 nuclear medicine centers with 25 SPECT, 7 gamma camera and 3 PET. All nuclear medicine centers are currently using imported Tc-99m generator. (author)

Quality control studies of 99Mo used in 99Mo/99mTc generators produced at IPEN/CNEN-SP, Brazil

International Nuclear Information System (INIS)

Said, Daphne S.; Brambilla, Tania P.; Matsuda, Margareth M.N.; Osso Junior, Joao A.

2015-01-01

99m Tc is the most used radionuclide in nuclear medicine. In Brazil, the 99 Mo/ 99m Tc generators are produced exclusively by the Center of Radiopharmacy at IPEN-CNEN/SP, by importing 99 Mo from different suppliers. 99 Mo (t 1/2 = 66 h) is a fission product of 235 U, therefore, it can be accompanied by several radioisotopes that are highly prejudicial for human health, demanding a strict quality control of this product for generators safe use. The European Pharmacopoeia established some parameters and limits that evaluate the quality of the solution of sodium [ 99 Mo]molybdate, that is used as raw material for generator's production. The European Pharmacopoeia also recommends some analytical methods to perform these evaluations, however, it has been observed difficulties on the implementation of these methods by the generator's producers. These difficulties are probably related to the lack of practicability of the proposed methods and the extensive list of utilized reagents. In this work some procedures of the European Pharmacopoeia's quality control method for 99 Mo were evaluated. Different types of solid phase exchanger cartridges were tested for retention of 99 Mo in 3 different conditions. Cartridges that presented percentages of retention higher than 90% were also tested for separation of 99 Mo from possible contaminants (Ru e Te). The results shown that solid phase exchanger cartridges that presented percentages of retention of Mo higher than 90% also presented significant percentages of retention of Ru and Te. An alternative method for separation of 99 Mo from 131 I (other contaminant) are also proposed. (author)

Evaluación experimental de la resistencia a la corrosión de un acero aisi-sae 4140 implantado con iones de nitrógeno

OpenAIRE

PEÑA, DARIO; FONTALVO, PAOLA; ESTUPIÑAN, HUGO; NIÑO, DANNIER; VESGA, WILSON

2010-01-01

Se estudió la resistencia a la corrosión de un acero AISI-SAE 4140 implantado con iones de Nitrógeno mediante la técnica 3DII (Implantación Iónica Tridimensional). Se evaluaron diferentes rugosidades de las muestras implantadas mediante técnicas electroquímicas de Rp, EIS y Tafel en una salmuera al 3% de NaCl, donde se obtuvo la mayor resistencia a la corrosión para el material implantado con menor rugosidad. Se produjo la formación de una posible capa protectora estable con la inmersión de l...

Separation of 99Tc from irradiated molybdenum oxide by extraction with trioctilamine

International Nuclear Information System (INIS)

Carvalho, O.G. de.

1979-01-01

A separation method of sup( 99 m)Tc, from irradiated molybdenum oxide, by extraction with trioctilamino in 1,2 dichloroethane, 2% v/v is studied. Two preliminary studies are done: 1) Stablishment of the shaking time necessary to reach the equilibrium between the organic and the aqueous phase; 2) Choice of the concentration of solution of TOA in 1,2 dichloroethane to obtain the best separation conditions of sup( 99 m)Tc. After stablishing these two parameters, the study of extraction in solutions of hydrochloric nitric and sulfuric acids in different concentrations is done, followed by the study of the variation of extraction percentage of sup( 99 m)Tc in relation to the molybdenum oxide mass and the back-extraction of sup( 99 m)Tc to the aqueous phase with solutions of perchloric acid 1,0 and 0,1 N and ammonium hydroxide 1,0 N. (Author) [pt

Evaluation of '9{sup 9}Mo presence in eluates of {sup 99}mTc used in nuclear medicine; Avaliacao da presenca de {sup 99}Mo em eluatos de {sup 99m}Tc utilizados em medicina nuclear

Energy Technology Data Exchange (ETDEWEB)

Ribeiro, Bianca da Silva

2010-07-01

Tc-99m is used for diagnostic imaging in nuclear medicine through SPECT technique. It is obtained by the elution of {sup 99}Mo/{sup 99m}Tc generators. During the elution process {sup 99}Mo can be extracted becoming a radionuclidic impurity. One of the quality parameters of the eluate is the radionuclidic purity, MBT (molybdenum break through), defined as the ratio between {sup 99}Mo and {sup 99m}Tc activities in the eluate. The North-American and European pharmacopoeias restrict the {sup 99}Mo content, respectively, in 0.015 e 0.1% and, according to the International Atomic Energy Agency (IAEA), the activity ratio at the moment of administration of the radiopharmaceutical to the patient, should not exceed 0.015%. In Brazil, the control of such parameter is not obliged in official regulations. Thus, the objective of this work is to evaluate the occurrence of {sup 99}Mo in {sup 99m}Tc eluates. It was initially optimized a methodology to determine the activity of {sup 99}Mo in eluate samples. Efficiency curves were obtained for a NaI (Tl) 8'' x 4'' scintillation detector installed at the In Vivo Monitoring Laboratory (LABMIV-IRD). The methodology has been validated through the measurement of a {sup 99}Mo standard liquid source calibrated at the National Metrology Laboratory for Ionizing Radiation (LNMRI-IRD). The samples analyzed in this work were gently supplied by 5 Nuclear Medicine Clinics located in the city of Rio de Janeiro. The activities of {sup 99}mTc and {sup 99}Mo in those samples have been measured respectively at the clinics and at the LABMIV. By applying a standardized methodology, the ration between the activities were calculated. The results show that 147 out of 174 samples presented {sup 99}Mo activities above the minimum detectable activity of the technique. On the other hand, only 2 out of 147 samples surpassed the MBT limit suggested by the IAEA and have been detected in samples eluted from generators of 750 mCi. In one of the

49 CFR 1242.33 - Other expenses and casualties and insurance (accounts XX-17-99, XX-18-99, XX-19-99, 50-17-00, 50...

Science.gov (United States)

2010-10-01

... (accounts XX-17-99, XX-18-99, XX-19-99, 50-17-00, 50-18-00, and 50-19-00). 1242.33 Section 1242.33....33 Other expenses and casualties and insurance (accounts XX-17-99, XX-18-99, XX-19-99, 50-17-00, 50... separation of administrative—other (account XX-19-06). Operating Expenses—Equipment locomotives ...

NCBI nr-aa BLAST: CBRC-CJAC-01-0646 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-0646 ref|YP_100968.1| hemolysin III [Bacteroides fragilis YCH46] ref|Y...P_213086.1| putative hemolysin [Bacteroides fragilis NCTC 9343] dbj|BAD50434.1| hemolysin III [Bacteroides fragil...is YCH46] emb|CAH09172.1| putative hemolysin [Bacteroides fragilis NCTC 9343] YP_100968.1 9.9 27% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-0029 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-0029 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 4e-99 83% ...

Supplementary tutoring in Trinidad and Tobago: Some implications for policy making

Science.gov (United States)

Barrow, Dorian A.; Lochan, Samuel N.

2012-06-01

Globally, private supplementary tutoring is a huge business and the practice is expanding rapidly in many regions of the world where it never existed before. In some of these regions it is posing a novel set of challenges for education planners and policy makers. The aim of this study was to examine the extent to which supplementary tutoring is impacting on the goals of the formal education system in Trinidad and Tobago (T&T). The participation rate in supplementary tutoring at primary school level in T&T was found to be high (88.2 per cent at Standard Five level), with the majority of the students being privately tutored by their regular school teachers. Their main motivation for taking private tutoring lessons was to try to secure a place in one of the few elite secondary schools in the country. The authors of this paper admit that there is no quick solution to the problem, especially if it is understood as a part of the process of cultural change. They contend that the key to breaking the elitist tradition lies in modifying public understanding about education and convincing parents and citizens at large that a wide range of options and opportunities exists outside the narrow confines of the old colonial economy and the old colonial schools.

49 CFR 1242.54 - Other and casualties and insurance (accounts XX-27-99 and 50-27-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Other and casualties and insurance (accounts XX-27... RAILROADS 1 Operating Expenses-Equipment § 1242.54 Other and casualties and insurance (accounts XX-27-99 and... administration (account XX-27-01). Operating Expenses—Transportation train operations ...

Homogeneous SLOWPOKE reactors for Mo-99/Tc-99m production in North America

Energy Technology Data Exchange (ETDEWEB)

Hilborn, J.W., E-mail: hilbovanw@sympatico.ca [Deep River, Ontario (Canada); Bonin, H.W. [Royal Military College of Canada, Kingston, Ontario (Canada)

2014-07-01

The 15 month shutdown of NRU in 2009 - 2010 caused an overall isotope shortage of approximately 30%; and in North America, the annual Tc-99m demand decreased from an estimated 20 million unit doses to about 15 million unit doses. Mo-99/Tc-99m is produced from HEU targets, irradiated in NRU for 11 days, and after chemical removal of uranium it is shipped to Nordion in Kanata, Ontario. Nordion further purifies the material and sends it to Lantheus Medical Imaging in the USA for manufacture of Mo-99 generators, which are then distributed to hundreds of hospital radiopharmacies throughout North America. One other American company, Covidien, manufactures and distributes Mo-99 generators like Lantheus, but they import bulk Mo-99 from Europe or South Africa. At the hospitals, Tc-99m is chemically extracted daily from the Mo-99 generators and loaded into syringes for immediate clinical use. Fortuitously, the 66 hour half-life of Mo-99 allows the replenishment of Tc-99m in the generator over a growth period of about 20 hours; and a generator can be 'milked' daily for up to two weeks. A more efficient model is the direct production and distribution of Tc-99m unit doses to regional hospitals from 10 'industrial' radiopharmacies located at existing licensed reactor sites in North America. A 20 kW homogeneous SLOWPOKE reactor at each site would deliver 15 litres of irradiated uranyl sulphate fuel solution daily to industrial-scale hot cells for extraction of Mo-99, which would be incorporated in large Mo-99/Tc-99m generators for extraction of Tc-99m five days a week; and the Low Enriched Uranium (LEU) would be recycled. Each automated hot-cell facility would be designed to load up to 7,000 Tc-99m syringes daily, for courier delivery to all of the Nuclear Medicine hospitals within a 3 hour average range by road transport. Typically, the delivered doses would be in the range 10 to 30 mCi. Assuming an average unit dose of 25 mCi at the hospital and 5 x 52

Performance of Cement Containing Laterite as Supplementary Cementing Material

Directory of Open Access Journals (Sweden)

Abbas Bukhari, Z. S.

2013-03-01

Full Text Available The utilization of different industrial waste, by-products or other materials such as ground granulated blast furnace slag, silica fume, fly ash, limestone, and kiln dust, etc. as supplemen- tary cementing materials has received considerable attention in recent years. A study has been conducted to look into the performance of laterite as Supplementary Cementing Materials (SCM. The study focuses on compressive strength performance of blended cement containing different percentage of laterite. The cement is replaced accordingly with percentage of 2 %, 5 %, 7 % and 10 % by weight. In addition, the effect of use of three chemically different laterites have been studied on physical performance of cement as in setting time, Le-Chatlier expansion, loss on ignition, insoluble residue, free lime and specifically compressive strength of cement cubes tested at the age of 3, 7, and 28 days. The results show that the strength of cement blended with laterite as SCM is enhanced. Key words: Portland cement, supplementary cementing materials (SCM, laterite, compressive strength KUI – 6/2013 Received January 4, 2012 Accepted February 11, 2013

99Mo production for using in the nuclear medicine in 99mTc generators

International Nuclear Information System (INIS)

Kurenkov, N.V.; Chuvilin, D.Yu.

1999-01-01

The review of methods and advanced technologies for obtaining 99 Mo in nuclear reactors is presented. The 99 Mo isotope is used for preparing the 99m Tc generators, widely applied in nuclear medicine. The reactor method for obtaining 99 Mo is based on the 98 Mo(n, γ) 99 Mo radiation capture reaction and 235 U fission reaction under the effect of the 235 U (n, f) 99 Mo reaction. The results of studies on obtaining 99 Mo on the charged particles accelerators, mainly, on the proton beam and under the effect of photonuclear reaction is also described. The data on the 99 Mo real consumption and forecast for its application in different regions of the world from 1994 up to 2006 are presented [ru

Development of 99mTc extraction techniques from 99Mo by (n,γ) reaction

International Nuclear Information System (INIS)

Kimura, Akihiro; Hori, Naohiko; Tsuchiya, Kunihiko; Ishihara, Masahiro; Yamabayashi, Hisamichi; Tanase, Masakazu; Fujisaki, Saburo; Sato, Yuichi

2010-11-01

Investigation of production method of 99 Mo by (n, γ) reaction, where the processing is relatively simple and generating less amount of radioactive waste, is conducted in the Neutron Irradiation and Testing Reactor Center. The 99 Mo is adsorbed to highly efficient adsorbent PZC after neutron irradiation and 99m Tc is eluted. However, radioactivity concentration of the 99m Tc solution obtained from PZC column loaded with 99 Mo derived by (n, γ) method is lower than that obtained from alumina column with 99 Mo by (n, f) method due to extremely low specific activity of (n, f) 99 Mo. Therefore, it is necessary to develop technique for increasing the amount of 99 Mo and the 99m Tc solution of high radioactivity concentration (minimum: 1Ci/ cm 3 ). In this study, the preliminary fabrication tests using high density MoO 3 pellets were carried out to increase the production of 99 Mo. The method of concentrating 99m Tc solution through solvent extraction with MEK was investigated and a device for this concentration process was also developed. In the preliminary tests of the MoO 3 pellets, the pellets having high density were successfully fabricated by the SPS method. Additionally, it was ascertained that the pellets can be dissolved with 6M-NaOH solution completely. The test for 99 Mo adsorption followed by 99m Tc elution using PZC was carried out. As the result, amount of Mo adsorbed to 1g-PZC was about 250mg, and 99m Tc yield was about 80%. In the concentration test using Re solution instead of 99m Tc solution, it was ascertained that the concentration efficiency is higher than 80% of the theoretical value. A concentration device for 99m Tc solution could be realized based on the method employed in the present experiments. The outcomes of development of 99m Tc extraction techniques from 99 Mo by (n,γ) reaction was reviewed in this paper, and the contents were presented in the 3rd International Symposium on Material Test Reactors. (author)

75 FR 30850 - Final Supplementary Rules for Camping on Undeveloped Public Lands in Montana, North Dakota, and...

Science.gov (United States)

2010-06-02

... Supplementary Rules for Camping on Undeveloped Public Lands in Montana, North Dakota, and South Dakota AGENCY... personal property on undeveloped public lands managed by the BLM in Montana, North Dakota, and South Dakota... public lands throughout Montana, North Dakota, and South Dakota. These final supplementary rules will...

Use of 99mTc from a commercial 99Mo/9mTc generator as yield tracer for the determination of 99Tc at low levels

DEFF Research Database (Denmark)

Hou, Xiaolin; Jensen, Mikael; Nielsen, Sven Poul

2007-01-01

The concentrations of Tc-99 and impurity radionuclides in the Tc-99m tracer solution obtained from a commercial Mo-99/Tc-99m generator were measured by gamma spectrometry and liquid scintillation counting. Mo-99 and Ru-103 were found in the Tc-99m eluate. A simple separation using two extra alumina...... cartridges was investigated to purify the eluate to obtain a suitable Tc-99m tracer with low Tc-99 concentration. The activity ratio of Tc-99/Tc-99m in the prepared Tc-99m solution is lower than 15 x 10(-9), which is higher than the theoretical ratio of less than 10 x 10(-9). The possible reason is discussed....... The Tc-99 in the 20 kBq spiked Tc-99m tracer was found to be less than 0.3mBq, which is lower than the detection limit of the radiometric method used for environmental samples. The purified Tc-99m eluate is used as yield tracer for the determination of low levels of Tc-99 in environmental samples. (c...

ChemEngine: harvesting 3D chemical structures of supplementary data from PDF files.

Science.gov (United States)

Karthikeyan, Muthukumarasamy; Vyas, Renu

2016-01-01

Digital access to chemical journals resulted in a vast array of molecular information that is now available in the supplementary material files in PDF format. However, extracting this molecular information, generally from a PDF document format is a daunting task. Here we present an approach to harvest 3D molecular data from the supporting information of scientific research articles that are normally available from publisher's resources. In order to demonstrate the feasibility of extracting truly computable molecules from PDF file formats in a fast and efficient manner, we have developed a Java based application, namely ChemEngine. This program recognizes textual patterns from the supplementary data and generates standard molecular structure data (bond matrix, atomic coordinates) that can be subjected to a multitude of computational processes automatically. The methodology has been demonstrated via several case studies on different formats of coordinates data stored in supplementary information files, wherein ChemEngine selectively harvested the atomic coordinates and interpreted them as molecules with high accuracy. The reusability of extracted molecular coordinate data was demonstrated by computing Single Point Energies that were in close agreement with the original computed data provided with the articles. It is envisaged that the methodology will enable large scale conversion of molecular information from supplementary files available in the PDF format into a collection of ready- to- compute molecular data to create an automated workflow for advanced computational processes. Software along with source codes and instructions available at https://sourceforge.net/projects/chemengine/files/?source=navbar.Graphical abstract.

Preparation of a gel of zirconium molybdate for use in the generators of 99 Mo - 99m Tc prepared with 99 Mo produced by the 98 Mo(n,γ)99 Mo reaction

International Nuclear Information System (INIS)

Osso Junior, Joao A.; Lima, Ana Lucia V.P.; Silva, Nestor C. da; Nieto, Renata C.; Velosa, Adriana C. de

1998-01-01

IPEN develops a project concerning the preparation of a gel of Zirconium Molybdate for use in the generators of 99 Mo- 99m Tc . 99m Tc is the most used radioisotope in nuclear medicine diagnosis procedures and nowadays the generators are being prepared with imported 99 Mo, produced by 235 U fission. The production of 99 Mo by the 98 Mo(n, γ) 99 Mo reaction is now possible because of the power upgrade of IPEN's IEA-R1 reactor, from 2 to 5 MW. This work describes the preparation method of Zirconium Molybdate gel that will be used in the 99 Mo- 99m Tc generators. The gel is prepared by the chemical reaction between Mo, in Mo O 3 form, and Zr, in Zr O Cl 2 .8H 2 O form. After the reaction, the gel is filtered, dried and cracked with saline solution. The product is then loaded into glass columns for use as 99m Tc generator. The results showed the good quality of the gel prepared at laboratory level and of the generators evaluated. (author)

An analytical and experimental approach for pressure distribution analysis of a particular lobe and plain bearing performance keeping in view of all impeding varying parameters associating with fixed lubrication SAE20W40

International Nuclear Information System (INIS)

Biswas, Nabarun; Chakraborti, Prasun; Belkar, Sanjay

2016-01-01

This paper presents both analytical and experimental pressure analysis approach of a typical Lobe and plain bearing for determining effective performance of the bearing. This is found to be dependent on several variables viz. angular velocity (1200-1900 rpm), load (300- 750 N) and pressure angle (0.deg.-180.deg.). This study in particular has been carried out for better rectifications and comparative prediction of lobe and plain bearing in terms of pressure distribution behavior under lubrication oil grade of SAE20W40. Influencing parameters were varied in this set up only to get optimum parametric combination considering all relevant practical issues. The experimentation was done based on significant directives of relevant literatures in these sectors. Attempt was made to compare the analytical findings with experimental results and found matched appreciably. After that attention was diverted to find the nature of pressure and load carrying capacity at various fluctuating speed and load with a fixed lubrication of SAE20W40 for appropriate decision making towards its characteristic performance. The analytical data generated by MATLAB are compared with experimental data which is generated by JBTR

An analytical and experimental approach for pressure distribution analysis of a particular lobe and plain bearing performance keeping in view of all impeding varying parameters associating with fixed lubrication SAE20W40

Energy Technology Data Exchange (ETDEWEB)

Biswas, Nabarun; Chakraborti, Prasun [National Institute of Technology Agartala, Jirania (India); Belkar, Sanjay [Pravara Rural Engineering CollegeLoni, Rahata taluka (India)

2016-05-15

This paper presents both analytical and experimental pressure analysis approach of a typical Lobe and plain bearing for determining effective performance of the bearing. This is found to be dependent on several variables viz. angular velocity (1200-1900 rpm), load (300- 750 N) and pressure angle (0.deg.-180.deg.). This study in particular has been carried out for better rectifications and comparative prediction of lobe and plain bearing in terms of pressure distribution behavior under lubrication oil grade of SAE20W40. Influencing parameters were varied in this set up only to get optimum parametric combination considering all relevant practical issues. The experimentation was done based on significant directives of relevant literatures in these sectors. Attempt was made to compare the analytical findings with experimental results and found matched appreciably. After that attention was diverted to find the nature of pressure and load carrying capacity at various fluctuating speed and load with a fixed lubrication of SAE20W40 for appropriate decision making towards its characteristic performance. The analytical data generated by MATLAB are compared with experimental data which is generated by JBTR.

Radiolabeling, quality control and radiochemical purity assessment of 99mTc-HYNIC-TOC

International Nuclear Information System (INIS)

Melero, Laura T.U.H.; Araujo, Elaine B.; Mengatti, Jair

2009-01-01

Somatostatine receptors are widely expressed by several tumors, especially of the neuroendocrine origin. In vivo images of these tumors using radiolabeled somatostatine analogues became a useful clinical tool in oncology. The aim of this work was the radiolabeling of the somatostatine analogue HYNIC-TOC with 99mTc as well as the evaluation of the radiochemical stability and quality control of labeled complex. 99mTc-HYNIC-TOC was produced by labeling conditions using 20 μg of peptide, 20 mg of tricine and 10 mg of EDDA as coligands, 1110 MBq of 99mTc (99Mo-99mTc IPEN-TEC generator) and 15 μg of SnCl 2 .2H 2 O. The reaction proceeds for 10 minutes at boiling water bath. Radiochemical purity of labeled preparation was evaluated by different chromatographic systems: ITLC-SG in methanol:ammonium acetate (1:1); TLC-SG in sodium citrate buffer 0.1 N pH 5.0 and methylethylketone, and HPLC employing column C-18, 5 μm, 4.6 mm x 250 mm, UV (220 nm), radioactivity detectors, 1 mL/minute flow of acetonitrile and trifluoroacetic acid solution 0.1 %. Labeled compound has been found radiochemically stable for 5 hours and radiochemical purity was higher than 90 %. The thin layer chromatographic systems enabled the separation of radiochemical species presented in the labeled mixture as well as HPLC system. The labeling procedure studied resulted in high radiochemical yield and easy preparation. Future works include the preparation of a lyophilized reagent to make feasible the preparation of 99mTc-HYNIC-TOC at nuclear medicine services in order to study the clinical potential of the radiopharmaceutical in diagnostic and staging of neuroendocrine tumors. (author)

Preparation of i.v. 99mTc radiopharmaceuticals from spent moly 99Mo

International Nuclear Information System (INIS)

Noronha, O.P.D.

1998-01-01

Full text: Expiry dating is an important quality assurance precept in (radio) pharmacy. There are occasions when for the sake of patient service one may be forced to continue using an over aged source of 99 Mo to generate 99m Tc beyond 7d, especially when there is short/no supply of 99 Mo, (In the early days the expiry date was 3 d or 3 extractions, whichever one was earlier). With the passage of time a few physico-chemical changes (apart from decay) do occur in the 99 Mo/ 99m Tc milieu. The cocktail also begins to contain traces of carried over MEK which is subjected to strong β-, γ irradiation. These impurity (in trace amounts) is soluble in MEK and even, to an extent, in aqueous media. Furthermore, the concentrated impurity tends to seemingly increase in the bulk 99m TcO 4 - since one is compelled to leach TcO 4 - in lower volume of saline. On many occasions we have been constrained to extend the use of 99 Mo beyond 7 - 14 d. Adequate activities were obtained by pooling the previous week's lot of 99 Mo with the current over aged lot. On a few occasions over the past 26 years we have used 99 Mo much beyond 14 d and 2 - 3 occasions for 26 - 28 d (i.e. >10 t 1 /2 of 99 Mo). On each of these occasions the purity of 99m TcO- 4 was ascertained by pharmacopoeial procedures. It was found that despite depleting activities, the purity was not compromised and the trace impurities, even if present, did not cause any interference. We have profitably utilised the bulk TcO- 4 to formulate a variety of i.v. dosage forms of 99m Tc radiodiagnostics. The following strategy was adopted for the patient services - the agents requiring larger activity levels/patients dose were made available in the earlier period, the other during the latter half. It is concluded that pure 99m TcO- 4 can be obtained over the entire useful life-period of 99 Mo, even > 10t l/2

The Effect of Rain-Fed and Supplementary Irrigation on the Yield ...

African Journals Online (AJOL)

Choice-Academy

Ethiopian Journal of Environmental Studies and Management Vol.1 No.2 June. 2008 ... an urgent attention for improving productivity ..... difference between rain fed and supplementary irrigation in all plots examined across time interval. 0. 5.

99mTc-Novobiocin: a novel radiotracer for infection imaging

International Nuclear Information System (INIS)

Shah, S.Q.; Khan, M.R.; Khan, A.U.

2011-01-01

The radiosynthesis of 99m Tc-Novobiocin ( 99m Tc-NBN) complex and its suitability as a radiotracer for infection imaging was assessed. The radiochemical purity (RCP) of the 99m Tc-NBN complex was determined using radio-TLC and radioactive HPLC and biodistribution was studied in artificially infected (A.I.) rats and rabbit, using single well gamma counter (SWGRC) interface with scalar count rate meter (SCRM) and Gamma Camera (γ-CM). The maximum RCP observed for the preparation having 2 mg of NBN, 111 MBq of sodium pertechnetate (Na 99m TcO 4 ) and 125 μL of SnF 2 (1 μg/μL in 0.01 N HCl) at a pH 5.6 was 98.97±0.40% and remained stable >90% up to 120 min. The activity of the 99m Tc-NBN in the infected muscle (TI) was significantly increased from 6.50±0.15 to 19.00±0.17% and decreased in the inflamed muscle (TII), normal muscle (NT), blood, liver, spleen, stomach and intestine within 120 min. The TI/NT and TII/NT ratios were 7.60±1.08 and 1.60±1.14. The Whole Body Static (WBS) images of A.I. rabbit were obtained at 30, 40, 50 and 60 min after the I.V. administration of 111 MBq of 99m Tc-NBN to the A.I. rabbit. The stability in saline and serum, higher TI/NT, lower TII/NT ratios and WBS images confirmed the feasibility of the 99m Tc-NBN complex as an infection imaging agent. (orig.)

A comparative study of 99Tcm-tetrofosmin and 99Tcm-MIBI myocardial imaging

International Nuclear Information System (INIS)

Zhao Kui; Chen Peng; Zhang Furong; Shen Wenhua

2001-01-01

Objective: To evaluate the value of 99 Tc m -tetrofosmin myocardial imaging for detecting coronary artery disease. Methods: Twenty-seven patients underwent 99 Tc m -tetrofosmin SPECT, twenty-six patients underwent 99 Tc m -MIBI SPECT; coronary angiography was performed on patients included in both groups (≥50% luminal diameter stenosis was considered significant coronary stenosis). Results: 99 Tc m -tetrofosmin produced high quality myocardial images from 30 min to several hours postinjection, the outlines of myocardial perfusion images provided by 99 Tc m -tetrofosmin imaging were clearly discernible. One-day exercise/rest 99 Tc m -tetrofosmin myocardial perfusion imaging was feasible and had a high sensitivity for detection of coronary artery disease. Sensitivities of 99 Tc m -tetrofosmin SPECT and 99 Tc m -MIBI SPECT for detecting coronary artery disease were 90% and 94%, respectively. The 95% confidence limits of both sensitivities were 68.65% - 98.77% and 72.33% - 99.86%, respectively; the positive predictive values of both imaging agents were 90.0% and 89.5%, respectively, the 95% confidence limits of those were 68.38% - 98.77% and 72.33% - 99.86% respectively; the positive predictive values of both imaging agents were 90.0% and 89.5%, respectively, the 95% confidence limits of those were 68.38% - 98.77% and 66.38% - 98.70%, respectively; efficiencies of both imaging agents were 85.2% and 88.5%, respectively. The 95% confidence limits of both efficiencies were 65.81% - 95.78% and 69.44 - 98.70%, respectively. The specificity for both imaging agents was 71% and 75%. There was no significant difference among above results (P > 0.05). No ECG abnormalities were found following the injection of 99 Tc m -tetrofosmin SPECT. There were no drug-related effects on blood pressure, heart rate and body temperature. This experiment failed to provide the negative predictive value of the myocardial perfusion imaging with 99 Tc m -tetrofosmin because that few patients with

Quantifying and exploiting the age dependence in the effect of supplementary food for child undernutrition.

Directory of Open Access Journals (Sweden)

Milinda Lakkam

Full Text Available Motivated by the lack of randomized controlled trials with an intervention-free control arm in the area of child undernutrition, we fit a trivariate model of weight-for-age z score (WAZ, height-for-age z score (HAZ and diarrhea status to data from an observational study of supplementary feeding (100 kCal/day for children with WAZ [Formula: see text] in 17 Guatemalan communities. Incorporating time lags, intention to treat (i.e., to give supplementary food, seasonality and age interactions, we estimate how the effect of supplementary food on WAZ, HAZ and diarrhea status varies with a child's age. We find that the effect of supplementary food on all 3 metrics decreases linearly with age from 6 to 20 mo and has little effect after 20 mo. We derive 2 food allocation policies that myopically (i.e., looking ahead 2 mo minimize either the underweight or stunting severity - i.e., the sum of squared WAZ or HAZ scores for all children with WAZ or HAZ [Formula: see text]. A simulation study based on the statistical model predicts that the 2 derived policies reduce the underweight severity (averaged over all ages by 13.6-14.1% and reduce the stunting severity at age 60 mo by 7.1-8.0% relative to the policy currently in use, where all policies have a budget that feeds [Formula: see text]% of children. While these findings need to be confirmed on additional data sets, it appears that in a low-dose (100 kCal/day supplementary feeding setting in Guatemala, allocating food primarily to 6-12 mo infants can reduce the severity of underweight and stunting.