WorldWideScience

Sample records for sa selective availability

  1. Availability-based Importance Framework for Supplier Selection

    Science.gov (United States)

    2015-05-01

    AVAILABILITY-BASED IMPORTANCE FRAMEWORK FOR SUPPLIER SELECTION Acquisition Research Symposium May 13-14, 2015 Kash Barker Industrial and...DATES COVERED 00-00-2015 to 00-00-2015 4. TITLE AND SUBTITLE Availability-based Importance Framework for Supplier Selection 5a. CONTRACT NUMBER...means to incorporate an ability to meet system availability needs into the supplier selection process  Addressing “how do we build in system

  2. Development of SPAWM: selection program for available watershed models.

    Science.gov (United States)

    Cho, Yongdeok; Roesner, Larry A

    2014-01-01

    A selection program for available watershed models (also known as SPAWM) was developed. Thirty-three commonly used watershed models were analyzed in depth and classified in accordance to their attributes. These attributes consist of: (1) land use; (2) event or continuous; (3) time steps; (4) water quality; (5) distributed or lumped; (6) subsurface; (7) overland sediment; and (8) best management practices. Each of these attributes was further classified into sub-attributes. Based on user selected sub-attributes, the most appropriate watershed model is selected from the library of watershed models. SPAWM is implemented using Excel Visual Basic and is designed for use by novices as well as by experts on watershed modeling. It ensures that the necessary sub-attributes required by the user are captured and made available in the selected watershed model.

  3. Pediocin SA-1: A selective bacteriocin for controlling Listeria monocytogenes in maize silages.

    Science.gov (United States)

    Amado, Isabel R; Fuciños, Clara; Fajardo, Paula; Pastrana, Lorenzo

    2016-10-01

    In this study, we assessed the potential as silage additive of a bacteriocin produced by Pediococcus acidilactici Northern Regional Research Laboratory (NRRL) B-5627 (pediocin SA-1). Maize was inoculated either with a bacterial starter alone (I) or in combination with the bacteriocin (IP), and untreated silage served as control. We monitored the products of fermentation (ethanol, and lactic and acetic acids), the microbial population, and the presence of the indicator strain Listeria monocytogenes Colección Española de Cultivos Tipo (CECT) 4032 (1×10(5) cfu/g) after 1, 2, 5, 8, 16, and 30d of ensiling. Our results indicated antilisterial activity of the bacteriocin, anticipating the disappearance of L. monocytogenes in IP compared with I and control silages. The PCR-denaturing gradient gel electrophoresis analysis revealed the addition of the bacteriocin did not affect the bacterial communities of the spontaneous fermentation, and the inoculant-containing bacteria (Lactobacillus plantarum, Lactobacillus buchneri, and Enterococcus faecium) were found in addition to the bacterial communities of untreated maize silages in I and IP silages. Both treatments increased the concentration of antimicrobial compounds (acetic acid, ethanol, and 1,2-propanodiol) and led to lower residual sugar contents compared with the control, which would provide enhanced aerobic stability. The fact that the identified species L. plantarum, L. buchneri, and E. faecium produce some of these inhibitory compounds, together with their persistence throughout the 30d of fermentation, suggest these bacteria could actively participate in the ensiling process. According to these results, pediocin SA-1 could be used as an additive to control the presence of L. monocytogenes in maize silages selectively, while improving their fermentative quality and eventually their aerobic stability.

  4. Algoritmi selektivnog šifrovanja - pregled sa ocenom performansi / Selective encryption algorithms: Overview with performance evaluation

    Directory of Open Access Journals (Sweden)

    Boriša Ž. Jovanović

    2010-10-01

    Full Text Available Digitalni multimedijalni sadržaj postaje zastupljeniji i sve više se razmenjuje putem računarskih mreža i javnih kanala (satelitske komunikacije, bežične mreže, internet, itd. koji predstavljaju nebezbedne medijume za prenos informacija osetljive sadržine. Sve više na značaju dobijaju mehanizmi kriptološke zaštite slika i video sadržaja. Tradicionalni sistemi kriptografske obrade u sistemima za prenos ovih vrsta informacija garantuju visok stepen sigurnosti, ali i imaju svoje nedostatke - visoku cenu implementacije i znatno kašnjenje u prenosu podataka. Pomenuti nedostaci se prevazilaze primenom algoritama selektivnog šifrovanja. / Digital multimedia content is becoming widely used and increasingly exchanged over computer network and public channels (satelite, wireless networks, Internet, etc. which is unsecured transmission media for ex changing that kind of information. Mechanisms made to encrypt image and video data are becoming more and more significant. Traditional cryptographic techniques can guarantee a high level of security but at the cost of expensive implementation and important transmission delays. These shortcomings can be exceeded using selective encryption algorithms. Introduction In traditional image and video content protection schemes, called fully layered, the whole content is first compressed. Then, the compressed bitstream is entirely encrypted using a standard cipher (DES - Data Encryption Algorithm, IDEA - International Data Encryption Algorithm, AES - Advanced Encryption Algorithm etc.. The specific characteristics of this kind of data, high-transmission rate with limited bandwidth, make standard encryption algorithms inadequate. Another limitation of traditional systems consists of altering the whole bitstream syntax which may disable some codec functionalities on the delivery site coder and decoder on the receiving site. Selective encryption is a new trend in image and video content protection. As its

  5. Selecting Peer Institutions with IPEDS and Other Nationally Available Data

    Science.gov (United States)

    Carrigan, Sarah D.

    2012-01-01

    The process of identifying and selecting peers for a college or university is one of this volume's definitions for "benchmarking": "a strategic and structured approach whereby an organization compares aspects of its processes and/or outcomes to those of another organization or set of organizations to identify opportunities for…

  6. Simultaneous selection and scheduling with sequence-dependent setup times, lateness penalties, and machine availability constraint: Heuristic approaches

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Zarei

    2016-01-01

    Full Text Available Job selection and scheduling are among the most important decisions for production planning in today’s manufacturing systems. However, the studies that take into account both problems together are scarce. Given that such problems are strongly NP-hard, this paper presents an approach based on two heuristic algorithms for simultaneous job selection and scheduling. The objective is to select a subset of candidate jobs and schedule them in such a way that the total net profit is maximized. The cost components considered here include jobs' processing costs and weighted earliness/tardiness penalties. Two heuristic algorithms; namely scatter search (SS and simulated annealing (SA, were employed to solve the problem for single machine environments. The algorithms were applied to several examples of different sizes with sequence-dependent setup times. Computational results were compared in terms of quality of solutions and convergence speed. Both algorithms were found to be efficient in solving the problem. While SS could provide solutions with slightly higher quality for large size problems, SA could achieve solutions in a more reasonable computational time.

  7. Availability-Based Importance Framework for Supplier Selection

    Science.gov (United States)

    2015-04-30

    estimated in the tens of billions of dollars with a replacement plan lasting for several ^Åèìáëáíáçå=oÉëÉ~êÅÜ=mêçÖê~ãW= `êÉ~íáåÖ=póåÉêÖó=Ñçê=fåÑçêãÉÇ=`Ü...an innovation of this work comes from how we weight the importance of component availability with the availability CIM provided in Equation 3

  8. Selective acquired long QT syndrome (saLQTS upon risperidone treatment

    Directory of Open Access Journals (Sweden)

    Lazarczyk Maciej

    2012-12-01

    Full Text Available Abstract Background Numerous structurally unrelated drugs, including antipsychotics, can prolong QT interval and trigger the acquired long QT syndrome (aLQTS. All of them are thought to act at the level of KCNH2, a subunit of the potassium channel. Although the QT-prolonging drugs are proscribed in the subjects with aLQTS, the individual response to diverse QT-prolonging drugs may vary substantially. Case presentation We report here a case of aLQTS in response to small doses of risperidone that was confirmed at three independent drug challenges in the absence of other QT-prolonging drugs. On the other hand, the patient did not respond with QT prolongation to some other antipsychotics. In particular, the administration of clozapine, known to be associated with higher QT-prolongation risk than risperidone, had no effect on QT-length. A detailed genetic analysis revealed no mutations or polymorphisms in KCNH2, KCNE1, KCNE2, SCN5A and KCNQ1 genes. Conclusions Our observation suggests that some patients may display a selective aLQTS to a single antipsychotic, without a potassium channel-related genetic substrate. Contrasting with the idea of a common target of the aLQTS-triggerring drugs, our data suggests existence of an alternative target protein, which unlike the KCNH2 would be drug-selective.

  9. Synthesis and evaluation of fluorine-18-labeled SA4503 as a selective sigma{sub 1} receptor ligand for positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, Kazunori [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi-ku, Tokyo 173-0022 (Japan) and Center for Integrated Human Brain Science, Brain Research Institute, University of Niigata, Niigata, Niigata 951-8585 (Japan)]. E-mail: kawamurak@bri.niigata-u.ac.jp; Tsukada, Hideo [Central Research Laboratory, Hamamatsu Photonics, K.K., Hamamatsu, Shizuoka 434-8601 (Japan); Shiba, Kazuhiro [Advanced Science Research Center, Kanazawa University, Kanazawa, Ishikawa 920-8640 (Japan); Tsuji, Chieko [NARD Institute, Ltd., Amagasaki, Hyogo 660-0805 (Japan); Harada, Norihiro [Central Research Laboratory, Hamamatsu Photonics, K.K., Hamamatsu, Shizuoka 434-8601 (Japan); Kimura, Yuichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi-ku, Tokyo 173-0022 (Japan); Ishiwata, Kiichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi-ku, Tokyo 173-0022 (Japan)

    2007-07-15

    The [{sup 18}F]fluoromethyl analog of the sigma{sub 1} selective ligand 1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine dihydrochloride (SA4503) ([{sup 18}F]FM-SA4503) was prepared and its potential evaluated for the in vivo measurement of sigma{sub 1} receptors with positron emission tomography (PET). FM-SA4503 had selective affinity for the sigma{sub 1} receptor ( K {sub i} for sigma{sub 1} receptor, 6.4 nM; K {sub i} for sigma{sub 2} receptor, 250 nM) that was compatible with the affinity of SA4503 ( K {sub i} for sigma{sub 1} receptor, 4.4 nM; K {sub i} for sigma{sub 2} receptor, 242 nM). [{sup 18}F]FM-SA4503 was synthesized by {sup 18}F-fluoromethylation of O-demethyl SA4503 in the radiochemical yield of 2.9-16.6% at the end of bombardment with a specific activity of 37.8-283 TBq/mmol at the end of synthesis. In mice, the uptake of [{sup 18}F]FM-SA4503 in the brain was gradually increased for 30 min after injection, and then decreased. In the blocking study, brain uptake was significantly decreased by co-injection of haloperidol to 32% of control, and FM-SA4503 to 52% of control. In PET study of the monkey brain, high uptake was found in the cerebral cortex, thalamus and striatum. The radioactivity level of [{sup 18}F]FM-SA4503 in the brain regions gradually increased over a period of 120 min after injection, followed by a stable plateau phase until 180 min after injection. In pretreatment with haloperidol measurement of the monkey brain, the radioactivity level was 22-32% and 11-25% of the baseline at 60 and 180 min, respectively, after injection, suggesting high receptor-specific binding. [{sup 18}F]FM-SA4503 showed specific binding to sigma{sub 1} receptors in mice and monkeys; therefore, [{sup 18}F]FM-SA4503 has the potential for mapping sigma{sub 1} receptors in the brain.

  10. Water SA

    African Journals Online (AJOL)

    Journal Home > Vol 43, No 2 (2017) ... WaterSA publishes refereed, original work in all branches of water science, technology and engineering. ... Water SA is the WRC's accredited scientific journal which contains original research articles ... via linearized calibration method in the upstream of Huaihe River Basin, China ...

  11. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    Directory of Open Access Journals (Sweden)

    Regina I. Cuizon

    2014-10-01

    Full Text Available Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng mga tesis at disertasyong nagawa mula sa mga piling SUCs. Desinyong kwalitatibo - kontent analisis sa pagsusuri ng: kaanyuan ayon sa suliranin, metodolohiya, paglalahad at interpretasyon ng mga datos, natuklasan, konklusyon, at rekomendasyon; kahinatnan ayon sa pagkatulad, pagkakaiba at kabuluhan; Emerging tema. Napag-alaman na ang karaniwang pinag-aralan ay 30% kahalagahang pangkatauhan, 20% larawangdiwa ng mga kababaihan at 10% gramatikang aspeto. Sa metodolohiyang ginamit, 80% desinyong kwalitatibo at 20% kwantitatibo-kwalitatibo. Sa paglikom ng datos 60% diretsahang pagsusuri, 30% talatanungan at 10% tseklis. Sa pag-analisa 90% kontent analisis at 10% gramatikal analisis. Batay sa natuklasan, ang pagsusuri ng maiikling kwento sa mga tesis at disertasyon mula sa iba’t ibang paaralan gamit ang meta analisis ay isang epektibo, mabisa, objektibong paraan at kagamitan na magagamit sa makatarungang paghatol; pamumuna sa kabuluhan at kagandahan; paghaham- bing sa mga kritikal na isyu; at pormulasyon ng panibagong pamantayan at batas.

  12. 78 FR 21611 - Guidance for Industry on Self-Selection Studies for Nonprescription Drug Products; Availability

    Science.gov (United States)

    2013-04-11

    ... HUMAN SERVICES Food and Drug Administration Guidance for Industry on Self-Selection Studies for...: The Food and Drug Administration (FDA) is announcing the availability of a guidance for industry... appropriate for them to use a drug product. The guidance provides recommendations to industry involved...

  13. The available lexicon: A tool for selecting appropriate vocabulary to teach a foreign language

    Directory of Open Access Journals (Sweden)

    Antonio Manuel Ávila Muñoz

    2017-01-01

    Full Text Available This study aims to provide foreign language professionals with a sound methodology for selecting a suitable lexicon apropos of their students’ level in the language. The justification of said selection is, herein, rooted in a cognitive argument: If we are able to observe the manner in which words are organized within the mind, we will be better able to select the words needed for the natural process of communication. After analyzing over lists of lexical availability compiled by previous analyses, this study puts forth a glossary filtered by way of an objective procedure based on the mathematical concept known as Fuzzy Expected Value. I begin first by rigorously defining the concept of lexical availability and then thoroughly examining and explaining the manner in which I have obtained the results. Next, I employ the cognitive theory of prototypes to expound upon the organizational apparatus which arranges words within speakers’ minds. Subsequently, and in accordance with objective criteria, a lexical selection is proposed. To end, I contemplate and muse upon the significance of a program that would enable us to identify the most appropriate vocabulary according to the students’ level of linguistic competence. In order to further substantiate this study, it will be juxtaposed with the specific notions outlined by the curriculum of The Cervantes Institute. Moreover, it will relate to the teaching levels proposed by the American Council on the Teaching of Foreign Languages (ACTFL and Common European Framework of Reference for Languages (CEFR.

  14. Availability of lignocellulosic feedstocks for lactic acid production - Feedstock availability, lactic acid production potential and selection criteria

    NARCIS (Netherlands)

    Bakker, R.R.C.

    2013-01-01

    The overall objective of this study is to assess the worldwide availability and suitability of agricultural residues for lactic acid production, based on fermentation of carbohydrates. The study focuses on lignocellulosic biomass that is produced as a by-product of agricultural production. The resul

  15. Nutrient availability as a mechanism for selection of antibiotic tolerant Pseudomonas aeruginosa within the CF airway.

    Directory of Open Access Journals (Sweden)

    Lucas R Hoffman

    2010-01-01

    Full Text Available Microbes are subjected to selective pressures during chronic infections of host tissues. Pseudomonas aeruginosa isolates with inactivating mutations in the transcriptional regulator LasR are frequently selected within the airways of people with cystic fibrosis (CF, and infection with these isolates has been associated with poorer lung function outcomes. The mechanisms underlying selection for lasR mutation are unknown but have been postulated to involve the abundance of specific nutrients within CF airway secretions. We characterized lasR mutant P. aeruginosa strains and isolates to identify conditions found in CF airways that select for growth of lasR mutants. Relative to wild-type P. aeruginosa, lasR mutants exhibited a dramatic metabolic shift, including decreased oxygen consumption and increased nitrate utilization, that is predicted to confer increased fitness within the nutrient conditions known to occur in CF airways. This metabolic shift exhibited by lasR mutants conferred resistance to two antibiotics used frequently in CF care, tobramycin and ciprofloxacin, even under oxygen-dependent growth conditions, yet selection for these mutants in vitro did not require preceding antibiotic exposure. The selection for loss of LasR function in vivo, and the associated adverse clinical impact, could be due to increased bacterial growth in the oxygen-poor and nitrate-rich CF airway, and from the resulting resistance to therapeutic antibiotics. The metabolic similarities among diverse chronic infection-adapted bacteria suggest a common mode of adaptation and antibiotic resistance during chronic infection that is primarily driven by bacterial metabolic shifts in response to nutrient availability within host tissues.

  16. Product-line selection and pricing with remanufacturing under availability constraints

    Science.gov (United States)

    Aras, Necati; Esenduran, G.÷k.‡e.; Altinel, I. Kuban

    2004-12-01

    Product line selection and pricing are two crucial decisions for the profitability of a manufacturing firm. Remanufacturing, on the other hand, may be a profitable strategy that captures the remaining value in used products. In this paper we develop a mixed-integer nonlinear programming model form the perspective of an original equipment manufacturer (OEM). The objective of the OEM is to select products to manufacture and remanufacture among a set of given alternatives and simultaneously determine their prices so as to maximize its profit. It is assumed that the probability a customer selects a product is proportional to its utility and inversely proportional to its price. The utility of a product is an increasing function of its perceived quality. In our base model, products are discriminated by their unit production costs and utilities. We also analyze a case where remanufacturing is limited by the available quantity of collected remanufacturable products. We show that the resulting problem is decomposed into the pricing and product line selection subproblems. Pricing problem is solved by a variant of the simplex search procedure which can also handle constraints, while complete enumeration and a genetic algorithm are used for the solution of the product line selection problem. A number of experiments are carried out to identify conditions under which it is economically viable for the firm to sell remanufactured products. We also determine the optimal utility and unit production cost values of a remanufactured product, which maximizes the total profit of the OEM.

  17. Mosquito host selection varies seasonally with host availability and mosquito density.

    Directory of Open Access Journals (Sweden)

    Tara C Thiemann

    2011-12-01

    Full Text Available Host selection by vector mosquitoes is a critical component of virus proliferation, particularly for viruses such as West Nile (WNV that are transmitted enzootically to a variety of avian hosts, and tangentially to dead-end hosts such as humans. Culex tarsalis is a principal vector of WNV in rural areas of western North America. Based on previous work, Cx. tarsalis utilizes a variety of avian and mammalian hosts and tends to feed more frequently on mammals in the late summer than during the rest of the year. To further explore this and other temporal changes in host selection, bloodfed females were collected at a rural farmstead and heron nesting site in Northern California from May 2008 through May 2009, and bloodmeal hosts identified using either a microsphere-based array or by sequencing of the mitochondrial cytochrome c oxidase I (COI gene. Host composition during summer was dominated by four species of nesting Ardeidae. In addition, the site was populated with various passerine species as well as domestic farm animals and humans. When present, Cx. tarsalis fed predominantly (>80% upon the ardeids, with Black-crowned Night-Herons, a highly competent WNV host, the most prevalent summer host. As the ardeids fledged and left the area and mosquito abundance increased in late summer, Cx. tarsalis feeding shifted to include more mammals, primarily cattle, and a high diversity of avian species. In the winter, Yellow-billed Magpies and House Sparrows were the predominant hosts, and Yellow-billed Magpies and American Robins were fed upon more frequently than expected given their relative abundance. These data demonstrated that host selection was likely based both on host availability and differences in utilization, that the shift of bloodfeeding to include more mammalian hosts was likely the result of both host availability and increased mosquito abundance, and that WNV-competent hosts were fed upon by Cx. tarsalis throughout the year.

  18. Selection of the Methods of Soil Analysis for Phyto-available Arsenic

    Science.gov (United States)

    Yoon, Junghwan; Lee, Dan-Bi; Kim, Kwon-Rae; Kim, Won-Il; Kim, Kye-Hoon

    2016-04-01

    Arsenic (As) is a trace element of major public health concern. Many of As contaminated agricultural lands in the Republic of Korea (ROK) are located at the areas nearby abandoned mines. Therefore, management of contaminated agricultural lands is important for safe crop cultivation. In ROK, soils contaminated with As have managed according to the As concentration determined after aqua regia digestion (total As). Many soil scientists reported that management of As in soils by phyto-available As is more effective than that by total As for safety of the crop cultivation point-of-view since As concentration in crops has a significant correlation with phyto-available As. Therefore, this study was carried out to select method of soil analysis for phyto-available As. For that purpose, five extracting solutions (0.1M Ca(NO?), 0.1M (NH?)?HPO?), 0.5M EDTA, Mehlich 3, 0.5M NaHCO?) were examined with 35 soil samples used for cultivation of three crops (bean, red pepper, rice). Correlation analysis was conducted between phyto-available As concentrations in soils and As concentration in edible part of the crops. Results of the correlation analysis showed that phyto-available As concentrations in soils using Mehlich 3 solution and As concentrations in edible part of red pepper and rice were significantly correlated. For soils used for bean cultivation, Mehlich 3 (R

  19. Increasing salinity tolerance in tilapias: selective breeding using locally available strains

    Directory of Open Access Journals (Sweden)

    Cecilia J. Jaspe

    2011-10-01

    Full Text Available The culture of tilapias is an important industry in most aquaculture producing countries in theworld. Due to the many favorable attributes of this species of fish, including tolerance to wide range ofenvironmental conditions and fast growth rates, interest in its culture is increasing at a rapid pace. Therehave been research initiatives on breeding, genetic improvement and stock manipulation in order toincrease the resistance of this fish to high salinity levels, enabling them to thrive in brackishwater andalmost seawater conditions. Saline-tolerant tilapias have been co-cultured with shrimp in brackishwaterponds as it was believed that tilapias are able to inhibit the occurrence of luminous vibriosis in ponds.This paper describes the selective breeding program that we developed in order to produce high-salinetolerant tilapias by using locally available strains.

  20. Defining new criteria for selection of cell-based intestinal models using publicly available databases

    Directory of Open Access Journals (Sweden)

    Christensen Jon

    2012-06-01

    Full Text Available Abstract Background The criteria for choosing relevant cell lines among a vast panel of available intestinal-derived lines exhibiting a wide range of functional properties are still ill-defined. The objective of this study was, therefore, to establish objective criteria for choosing relevant cell lines to assess their appropriateness as tumor models as well as for drug absorption studies. Results We made use of publicly available expression signatures and cell based functional assays to delineate differences between various intestinal colon carcinoma cell lines and normal intestinal epithelium. We have compared a panel of intestinal cell lines with patient-derived normal and tumor epithelium and classified them according to traits relating to oncogenic pathway activity, epithelial-mesenchymal transition (EMT and stemness, migratory properties, proliferative activity, transporter expression profiles and chemosensitivity. For example, SW480 represent an EMT-high, migratory phenotype and scored highest in terms of signatures associated to worse overall survival and higher risk of recurrence based on patient derived databases. On the other hand, differentiated HT29 and T84 cells showed gene expression patterns closest to tumor bulk derived cells. Regarding drug absorption, we confirmed that differentiated Caco-2 cells are the model of choice for active uptake studies in the small intestine. Regarding chemosensitivity we were unable to confirm a recently proposed association of chemo-resistance with EMT traits. However, a novel signature was identified through mining of NCI60 GI50 values that allowed to rank the panel of intestinal cell lines according to their drug responsiveness to commonly used chemotherapeutics. Conclusions This study presents a straightforward strategy to exploit publicly available gene expression data to guide the choice of cell-based models. While this approach does not overcome the major limitations of such models

  1. Available phosphorus in diets for 15 to 30 kg pigs genetically selected for meat deposition

    Directory of Open Access Journals (Sweden)

    Cláudio Luiz Corrêa Arouca

    2012-01-01

    Full Text Available With the objective to evaluate the effect of dietary available phosphorus levels (aP on the performance, blood and bone parameters of castrated male and female pigs, genetically selected for meat deposition, 60 commercial hybrids pigs with initial weight of 15.54±0.68 kg were allotted in a completely randomized block design, with six treatments (0.103, 0.210, 0.317, 0.424, 0.531, and 0.638% aP, five replicates, and two animals per experimental unit. Pigs were fed ad libitum and water was provided until the end of the experimental period (21 days, when animals reached 31.31±2.94 kg. Daily weight gain and daily feed intake increased, while the feed conversion improved quadratically up to 0.534, 0.487, and 0.574% aP maximum responses, respectively. The aP intake and the values of inorganic phosphorus in serum increased linearly with increasing the levels of aP in the diets. Alkaline phosphatase activity increased quadratically up to 0.558% maximum response. Bone breaking strength and calcium, phosphorus, and ash contents in the bones increased linearly with increasing aP concentration in the diets. The available phosphorus requirement of castrated male and female pigs genetically selected for meat deposition from 15 to 30 kg for best results of performance is 0.574%, corresponding to a daily intake of 8.26 g of available phosphorus.

  2. Available phosphorus levels for 95 to 120 kg barrows genetically selected for lean gain

    Directory of Open Access Journals (Sweden)

    Cláudio Luís Corrêa Arouca

    2012-06-01

    Full Text Available With the objective of evaluating available phosphorus (aP levels in diets for barrows selected for lean meat deposition, eighty commercial hybrid pigs with initial weight of 94.05±1.05 kg were used in this experiment. Pigs were allotted in a completely randomized block design, with five treatments (0.092, 0.156, 0.220, 0,284, and 0.348% of aP, eight replicates and two pigs per experimental unit. The average daily weight gain of pigs increased and the feed conversion improved quadratically with increasing aP in the diets up to the estimated levels of 0.21 and 0.20%, respectively. There was no effect of the dietary aP on average daily feed intake. However, aP intake, bone strength and concentration of phosphorus in the bones increased linearly with increasing aP in the diets. The levels of aP did not affect carcass traits; however, the alkaline phosphatase activity was improved and the values of serum inorganic phosphorus increased quadratically up to the estimated levels of 0.26 and 0.27% of aP, respectively. The available phosphorus levels of 0.21, 0.27, and 0.35%, corresponding to daily aP intakes of 6.34, 8.13, and 10.44 g result, respectively, in greatest performance, blood and bone parameters of 95 to 120 kg barrows selected for lean gain.

  3. Resource availability, breeding site selection, and reproductive success of red-winged blackbirds.

    Science.gov (United States)

    Turner, Andrew M; McCarty, John P

    1997-12-01

    Red-winged blackbirds are polygynous and show strong breeding site preferences, but it is unclear which environmental factors regulate their reproductive success and are ultimately responsible for shaping their patterns of habitat selection and their mating system. We evaluated the effect of variation in insect emergence rates on the reproductive success of male and female redwings nesting on replicate ponds. The number of male and female redwings that settled on a pond varied two- to three-fold among ponds, but was not related to insect emergence rates. Insect emergence rates had a positive effect on the number of nestlings successfully fledged by females, the number of nestlings fledged from male territories, and on the mass of nestlings at fledging. Typha stem density also varied widely among ponds, and was positively related to male and female settling density and mass of nestlings at fledging, but not to the number of nestlings fledged by females or males. We conclude that alternative breeding sites differ in their ability to support redwing reproduction, and that the availability of emerging odonates is an important environmental factor influencing the reproductive success of both male and female red-winged blackbirds.

  4. Ether modifications to 1-[2-(3,4-dimethoxyphenyl)ethyl]-4-(3-phenylpropyl)piperazine (SA4503): effects on binding affinity and selectivity for sigma receptors and monoamine transporters.

    Science.gov (United States)

    Xu, Rong; Lord, Sarah A; Peterson, Ryan M; Fergason-Cantrell, Emily A; Lever, John R; Lever, Susan Z

    2015-01-01

    Two series of novel ether analogs of the sigma (σ) receptor ligand 1-[2-(3,4-dimethoxyphenyl)ethyl]-4-(3-phenylpropyl)piperazine (SA4503) have been prepared. In one series, the alkyl portion of the 4-methoxy group was replaced with allyl, propyl, bromoethyl, benzyl, phenethyl, and phenylpropyl moieties. In the second series, the 3,4-dimethoxy was replaced with cyclic methylenedioxy, ethylenedioxy and propylenedioxy groups. These ligands, along with 4-O-des-methyl SA4503, were evaluated for σ1 and σ2 receptor affinity, and compared to SA4503 and several known ether analogs. SA4503 and a subset of ether analogs were also evaluated for dopamine transporter (DAT) and serotonin transporter (SERT) affinity. The highest σ1 receptor affinities, Ki values of 1.75-4.63 nM, were observed for 4-O-des-methyl SA4503, SA4503 and the methylenedioxy analog. As steric bulk increased, σ1 receptor affinity decreased, but only to a point. Allyl, propyl and bromoethyl substitutions gave σ1 receptor Ki values in the 20-30 nM range, while bulkier analogs having phenylalkyl, and Z- and E-iodoallyl, ether substitutions showed higher σ1 affinities, with Ki values in the 13-21 nM range. Most ligands studied exhibited comparable σ1 and σ2 affinities, resulting in little to no subtype selectivity. SA4503, the fluoroethyl analog and the methylenedioxy congener showed modest six- to fourteen-fold selectivity for σ1 sites. DAT and SERT interactions proved much more sensitive than σ receptor interactions to these structural modifications. For example, the benzyl congener (σ1Ki=20.8 nM; σ2Ki=16.4 nM) showed over 100-fold higher DAT affinity (Ki=121 nM) and 6-fold higher SERT affinity (Ki=128nM) than the parent SA4503 (DAT Ki=12650 nM; SERT Ki=760 nM). Thus, ether modifications to the SA4503 scaffold can provide polyfunctional ligands having a broader spectrum of possible pharmacological actions.

  5. Varyasyong Leksikal sa mga Dayalektong Mandaya

    Directory of Open Access Journals (Sweden)

    Dr. Raymund M. Pasion

    2014-12-01

    Full Text Available Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP.Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuhayan ng Mandaya na makikita sa munisipalidad ng Caraga, Manay, Bagangaat Cateel? Disenyong kwalitatibo ginamit.Metodong indehinusat deskriptibo naman ang ginamit mula sa paglilikom hanggang sa pag-aanalisa ng mga datos. Samantalang, ang mga impormante ay pinilisa pamamagitan ng kombinasyong purposive at snow-ball sampling. Natuklasan, na ang wikang Mandaya ay nakitaan ng varyasyong lekisikal ayon sa magkakaiba ang anyo, may pagkakatulad ang anyo, at magkakatulad ang anyo subalit magkakaiba ang bigkas. Gayunpaman, pinaniniwalaang dahil sa paktor na heograpikal, sikolohikal at sosyolohikal na nagaganap sa kanilang kultura ay hindi rin maipagkailang nagyari ang varyasyong leksikal na aspekto nito.

  6. A Family Longevity Selection Score: Ranking Sibships by Their Longevity, Size, and Availability for Study

    DEFF Research Database (Denmark)

    Sebastiani, Paola; Hadley, Evan C; Province, Michael;

    2009-01-01

    of these considerations, the authors developed a metric to rank families for selection into a family study of longevity. Their measure, the family longevity selection score (FLoSS), is the sum of 2 components: 1) an estimated family longevity score built from birth-, gender-, and nation-specific cohort survival...... probabilities and 2) a bonus for older living siblings. The authors examined properties of FLoSS-based family rankings by using data from 3 ongoing studies: the New England Centenarian Study, the Framingham Heart Study, and screenees for the Long Life Family Study. FLoSS-based selection yields families...

  7. MimoSA: a system for minimotif annotation

    Directory of Open Access Journals (Sweden)

    Kundeti Vamsi

    2010-06-01

    Full Text Available Abstract Background Minimotifs are short peptide sequences within one protein, which are recognized by other proteins or molecules. While there are now several minimotif databases, they are incomplete. There are reports of many minimotifs in the primary literature, which have yet to be annotated, while entirely novel minimotifs continue to be published on a weekly basis. Our recently proposed function and sequence syntax for minimotifs enables us to build a general tool that will facilitate structured annotation and management of minimotif data from the biomedical literature. Results We have built the MimoSA application for minimotif annotation. The application supports management of the Minimotif Miner database, literature tracking, and annotation of new minimotifs. MimoSA enables the visualization, organization, selection and editing functions of minimotifs and their attributes in the MnM database. For the literature components, Mimosa provides paper status tracking and scoring of papers for annotation through a freely available machine learning approach, which is based on word correlation. The paper scoring algorithm is also available as a separate program, TextMine. Form-driven annotation of minimotif attributes enables entry of new minimotifs into the MnM database. Several supporting features increase the efficiency of annotation. The layered architecture of MimoSA allows for extensibility by separating the functions of paper scoring, minimotif visualization, and database management. MimoSA is readily adaptable to other annotation efforts that manually curate literature into a MySQL database. Conclusions MimoSA is an extensible application that facilitates minimotif annotation and integrates with the Minimotif Miner database. We have built MimoSA as an application that integrates dynamic abstract scoring with a high performance relational model of minimotif syntax. MimoSA's TextMine, an efficient paper-scoring algorithm, can be used to

  8. Perception of maternal availability in childhood and selected psychosocial characteristics in adulthood.

    Science.gov (United States)

    Hojat, M

    1996-11-01

    The associations between reported perception of maternal availability in childhood and a set of psychosocial measures in adulthood were examined. Participants were 362 medical students who were divided into three groups based on their retrospective report of maternal availability before their 5th birthday: Mothers mostly available (n = 260), partly available (n = 70), and mostly unavailable (n = 32). Those with mostly unavailable mothers scored significantly higher on the intensity and chronicity of loneliness scales, reported more depression, scored lower on self-esteem, perceived themselves as less healthy, evaluated the same stressful events more negatively, and perceived both of their parents more negatively than those with mostly available mothers.

  9. 77 FR 13999 - Notice of Availability and Opportunity for Comments (Establishment Guidance for the Selection of...

    Science.gov (United States)

    2012-03-08

    ... that prepare meat, poultry, or processed egg products to follow the criteria in the guidelines in... producing meat, poultry, and processed egg products for selecting a commercial or private laboratory to... requirements, supporting on-going verification of the establishment's HACCP plan, supporting decisions made...

  10. Sleeping site selection by agile gibbons: the influence of tree stability, fruit availability and predation risk.

    Science.gov (United States)

    Cheyne, Susan M; Höing, Andrea; Rinear, John; Sheeran, Lori K

    2012-01-01

    Primates spend a significant proportion of their lives at sleeping sites: the selection of a secure and stable sleeping tree can be crucial for individual survival and fitness. We measured key characteristics of all tree species in which agile gibbons slept, including exposure of the tree crown, root system, height, species and presence of food. Gibbons most frequently slept in Dipterocarpaceae and Fabaceae trees and preferentially chose trees taller than average, slept above the mean canopy height and showed a preference for liana-free trees. These choices could reflect avoidance of competition with other frugivores, but we argue these choices reflect gibbons prioritizing avoidance of predation. The results highlight that gibbons are actively selecting and rejecting sleeping trees based on several characteristics. The importance of the presence of large trees for food is noted and provides insight into gibbon antipredatory behaviour.

  11. Product availability from delivery aspect: Evidence from retailers in selected Western Balkan countries

    Directory of Open Access Journals (Sweden)

    Grubor Aleksandar

    2016-01-01

    Full Text Available Bearing in mind that it represents one of the main preconditions of sales, product availability is the key task of retail companies and their delivery systems. This paper analyses its levels from the aspect of centralized and DSD systems. The research is conducted in Serbia, Bosnia and Herzegovina and Montenegro, including 84 stores and more than 70 FMCG products per each store. Thereby, the comparisons in product availability levels between alternative delivery systems are carried out within different trading formats and within different product categories. Unlike the results of similar studies and ongoing changes on retail markets, this research shows that at retailers in these Western Balkan countries, availability levels are higher in the case of DSD system.

  12. Micronutrient Availability in Relation to Selected Soil Properties and landscape Position in Calcareous Soils of Golpayegan

    Directory of Open Access Journals (Sweden)

    Mojtaba Fathi

    2017-02-01

    Full Text Available Introduction: Variety of soil reactions govern the distribution of metal micronutrients that includes complexation with organic and inorganic ligands, ion exchange, adsorption and desorption processes, precipitation and dissolution of solids and acid-based equilibria. The relative importance of these reactions depends on many factors such as soil physical, chemical, and mineralogical properties and the nature of metal ions. Environmental factors such as climate, physiographic position, and soil development may affect variability of some soil properties and thereby nutrient availability. The present research was conducted to find relationships between Iron, manganese, zinc, and copper availability and some major soil properties, physiographic condition and soil development. Materials and Methods: Golpayegan region is located in northwest of Isfahan province in central Iran. The mean elevation of the studied area is 1790 above sea level. Annual precipitation was about 244mm and mean monthly temperature ranges from -6 in January to 34°C in August. The soils were developed on different physiographic conditions including piedmont plains, alluvial-fan, plateaus, and flood plains belonging to Entisols and Aridisols. Soil samples (0–60 cm were collected from 98 grid points with 2000m distance in the agricultural area of Golpayegan. Particle size distribution, calcium carbonate, organic carbon, available potassium and phosphorus of the soils were measured by SWRI standard methods. Available Zn, Cu, Mn, and Fe were determined by addition of 10 g soil to 20mL 0.005M diethylentriaminepentacetic‏. The solutions were shaken for 2 h at 25°C, centrifuged, filtered, and Fe, Mn, Zn, and Cu concentrations were measured by an atomic absorption spectrophotometer. Results Discussion: Studied soils were developed on calcareous material and about 60% of samples have more than 20% of calcium carbonate. Available Fe ranged from 1.4 to 6.5 mg kg-1 (mean 15.8 mg kg-1

  13. Preclinical evaluation of [{sup 11}C]SA4503. Radiation dosimetry, in vivo selectivity and PET imaging of sigma{sub 1} receptors in the cat brain

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, Kazunori; Ishiwata, Kiichi; Shimada, Yuhei; Kimura, Yuichi; Senda, Michio [Tokyo Metropolitan Inst. of Gerontology (Japan). Positron Medical Center; Kobayashi, Tadayuki; Matsuno, Kiyoshi; Homma, Yoshio

    2000-08-01

    Our previous in vivo study with rats has demonstrated that {sup 11}C-labeled 1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine ([{sup 11}C]SA4503) is a potential radioligand for mapping central nervous system (CNS) sigma{sub 1} receptors by positron emission tomography (PET). In the present study, we further characterized this ligand. The radiation absorbed-dose of [{sup 11}C]SA4503 in humans estimated with the tissue distribution in mice, was higher in the liver, kidney and pancreas than in other organs studied, but was low enough for clinical use. The brain uptake of [{sup 11}C]SA4503 in mice was reduced to approximately 60-70% by co-injection of carrier SA4503 and haloperidol, but not by co-injection of any of six ligands for sigma{sub 2} or other receptors, for which SA4503 showed in vitro >100 times weaker affinity than for sigma{sub 1} receptor. In the cat brain, the uptake in the cortex was higher than that in the cerebellum. The radioactivity in the cortex and cerebellum accumulated for the first 10 min and then gradually decreased until 81.5 min in the baseline measurement, but rapidly decreased in the carrier-loading condition. The receptor-mediated uptake was estimated to be approximately 60-65% of the total radioactivity in the cortex and cerebellum at 76 min after tracer injection. We have concluded that [{sup 11}C]SA4503 has the potential for mapping sigma{sub 1} receptor by PET. (author)

  14. Evaluation of Availability of Financial Resources and Manpower Development in Selected Monotechnics in Nigeria

    Science.gov (United States)

    Potokri, Onoriode Collins

    2014-01-01

    This research investigates manpower development and availability of financial resources in Nigerian monotechnic education. Monotechnics are single-subject institutions of higher learning that offer specialized programmes. A quantitative research design located within the positivist paradigm was adopted. A sample of 200 students and 80 members of…

  15. A Selected List of Educational Material Available from Commerce and Industry.

    Science.gov (United States)

    Deasy, John

    This publication is designed to assist teachers of agricultural and technical education in identifying and locating some of the instructional aids available from commerce and industry. Although most of the items listed are intended to support and add variety to the customary teaching resources, some could serve as major student references. The…

  16. Population and annual renewable fresh water availability: selected countries, 1955-2050.

    Science.gov (United States)

    1995-03-01

    This chart presents population figures and total annual renewable fresh water available by country for 100 countries as well as estimates of per capita water availability based on these figures for 1955, for 1990, and for the UN medium population projection for 2025 and 2050. Graphs are provided which illustrate the population experiencing fresh water scarcity for 1990-2050 according to the UN's low, medium, and high population projections. The low projection (7.9 billion) shows 3.5 billion people living in 51 water-short countries, the medium projection (nearly 10 billion) has 4.4 billion people living in 58 water-short countries, and the high projection (11.9 billion) places 7.7 billion people in 66 water-short nations. Thus, there is an urgent need for population stabilization policies as well as efforts to ensure that all people have access to clean fresh water.

  17. Competitive foods and beverages available for purchase in secondary schools--selected sites, United States, 2006.

    Science.gov (United States)

    2008-08-29

    Schools are in a unique position to help improve youth dietary behaviors and prevent and reduce obesity. In most schools, foods and beverages are made available to students through the U.S. Department of Agriculture (USDA) school meal programs and the sale of competitive foods, which are any foods and beverages sold at a school separately from the USDA school meal programs. Foods and beverages sold through the USDA school meal programs must meet federal nutrition requirements. Competitive foods are not subject to any federal nutrition standards unless they are sold inside the food service area during mealtimes. A 2007 Institute of Medicine (IOM) report concluded that schools should limit the availability of less nutritious competitive foods or include more nutritious foods and beverages if they make competitive foods available. To identify the types of competitive foods and beverages available for purchase from vending machines or at school stores, canteens, or snack bars, CDC analyzed data from the 2006 School Health Profiles for public secondary schools in 36 states and 12 large urban school districts. CDC also compared 2004 and 2006 data among 24 states and nine large urban school districts. This report summarizes the results of these analyses, which indicated that, from 2004 to 2006, the median percentage of secondary schools across states allowing students to purchase chocolate candy and salty snacks that are not low in fat decreased; however, in 2006, secondary schools still offered less nutritious foods and beverages that compete with school meals. School and public health officials should work together with families to provide foods and beverages at school that follow the IOM recommendations.

  18. AVAILABILITY OF PHOSPHORUS FROM SELECTED INORGANIC PHOSPHATES TO JUVENILE ABALONE,HALIOTIS DISCUS HANNAI INO

    Institute of Scientific and Technical Information of China (English)

    谭北平; 麦康森; 徐玮

    2002-01-01

    The availability of phosphorus to juvenile abalone, Haliotis discus hannai from primary, secondary and tertiary calcium phosphate, primary sodium or potassium phosphate separately or in combination was determined in a 120-day feeding trial. Seven semi-purified diets were formulated to contain relativelyconstant dietary phosphorus, ranging from 0.78%-0.82%. The concentrations of dietary phosphorus were presumed to be slightly below the requirement for abalone.A brown alga, Laminaria japonica, was used as a control diet. Abalone juvenilesof similar size (average weight 1.18 g; average shell length 18.74 mm) were distributed in a single-pass, flow-through system using a completely randomized design with eight treatments and three replicates each treatment. The survival ranged from 71.1% to 81.1%, and was not significantly (P>0.05) related to dietary treatment. However, the weight gain rate (41.72%-65.02%), daily increment in shelllength (36.87-55.07 μm) and muscle RNA-DNA ratio (3.44-4.69) were significantly (P<0.05) affected by dietary treatment. Soft body alkaline phosphatase activity (10.9-19.8 U/g wet tissue) and carcass levels of lipid (7.71%-9.33%) and protein (46.68%-49.35%) were significantly (P<0.05) responsive to available phosphorus of the diets. Dietary treatment had significant effect (P<0.05) on concentrations of phosphorus in the whole body (WB) and soft body (SB). Apparent digestibility coefficients (45%-97%) of phosphorus were also significantly (P<0.05) different between dietary treatments. The results indicated that among these inorganiccompounds, primary calcium, potassium and sodium phosphates separately or in combination could be utilized effectively by juvenile abalone as dietary phosphorus sources (availability ranging from 87%-97%). However, secondary and tertiary calcium phosphates were found to be low in availability, the values being 45% and77%, respectively. ``

  19. Lingon sa Iskolarsyip sa Dulaan (1948-2007 Looking Back on Theater Scholarship (1948-2007

    Directory of Open Access Journals (Sweden)

    Apolonio B. Chua

    2012-12-01

    Full Text Available From 1948 to 2007, the academic community produced about a hundred titles of theses and dissertations on drama and theater, or made use of data from drama and theater for larger spheres of studies. The current article looked into identifying trends and points of emphasis, as the researches and studies progressed through roughly half a century of research production in the academic setting. Inductive in approach and tentative and exploratory in its analysis, the study identified four trends and points of emphasis in research production. In the fifties and sixties, the emphasis was more on studying the play text or drama; studies veered towards a literary reading and orientation. Eventually, this trend gave way to studying the larger phenomenon of mounting, and the mise en scéne and the spectator became additional units of concern for research. Studies began to have sections on props, costumes, and staging techniques. In the eighties, a larger concern for looking at theater as social production followed. Participant observation, field work and ethnography gave equal emphasis on the social context of theater. Marxism and other perspectives from the social sciences framed theater studies then; correlations between theater and society became useful. Towards the last decade of the century, theater studies aimed at a more conceptual approach, emphasizing core concepts like panata and other related or equivalent terms, elevating and defining the study of theater as a study of culture itself. Gamit ang mahigit sa sandaang tesis at disertasyon hinggil sa dula at dulaan o sinasangkot ang mga ito na lumabas sa akademya mula 1948 hanggang 2007, kapwa sa Unibersidad ng Pilipinas at sa iba pa, nilayon ng “Lingon sa Iskolarsyip sa Dulaan (1948-2007” na pulsuhan ang pangkalahatang daloy, tutok, tunguhin o kalakaran sa pagdadala ng mga pag-aaral. Panimula at exploratory sa inductive nitong lapat, nakatukoy ang pag-aaral ng apat na sapit o tutok sa daloy ng

  20. Effects of Selective Serotonin Reuptake Inhibitors on Interregional Relation of Serotonin Transporter Availability in Major Depression

    Science.gov (United States)

    James, Gregory M.; Baldinger-Melich, Pia; Philippe, Cecile; Kranz, Georg S.; Vanicek, Thomas; Hahn, Andreas; Gryglewski, Gregor; Hienert, Marius; Spies, Marie; Traub-Weidinger, Tatjana; Mitterhauser, Markus; Wadsak, Wolfgang; Hacker, Marcus; Kasper, Siegfried; Lanzenberger, Rupert

    2017-01-01

    Selective serotonin reuptake inhibitors (SSRIs) modulate serotonergic neurotransmission by blocking reuptake of serotonin from the extracellular space. Up to now, it remains unclear how SSRIs achieve their antidepressant effect. However, task-based and resting state functional magnetic resonance imaging studies, have demonstrated connectivity changes between brain regions. Here, we use positron emission tomography (PET) to quantify SSRI’s main target, the serotonin transporter (SERT), and assess treatment-induced molecular changes in the interregional relation of SERT binding potential (BPND). Nineteen out-patients with major depressive disorder (MDD) and 19 healthy controls (HC) were included in this study. Patients underwent three PET measurements with the radioligand [11C]DASB: (1) at baseline, (2) after a first SSRI dose; and (3) following at least 3 weeks of daily intake. Controls were measured once with PET. Correlation analyses were restricted to brain regions repeatedly implicated in MDD pathophysiology. After 3 weeks of daily SSRI administration a significant increase in SERT BPND correlations of anterior cingulate cortex and insula with the amygdala, midbrain, hippocampus, pallidum and putamen (p < 0.05; false discovery rate, FDR corrected) was revealed. No significant differences were found when comparing MDD patients and HC at baseline. These findings are in line with the clinical observation that treatment response to SSRIs is often achieved only after a latency of several weeks. The elevated associations in interregional SERT associations may be more closely connected to clinical outcomes than regional SERT occupancy measures and could reflect a change in the regional interaction of serotonergic neurotransmission during antidepressant treatment. PMID:28220069

  1. Availability of Selected (Pollutant Elements and their Influence on Soil Composition in Urban Area

    Directory of Open Access Journals (Sweden)

    Michaela Zeiner

    2015-03-01

    Full Text Available Interest in growing fruits and vegetables in private gardens is rising due to nowadays ecological awareness. Avoiding artificial fertilizers and plant protection products does not guarantee the absence of toxic substances, especially heavy metals in the soil and thus in the fruits harvested. Due to either geological bedrock weathering or environmental pollution, garden soils may be rich in certain potentially toxic elements. In the present study ten garden soils from central Croatia have been analysed by the BCR method for the contents and bioavailability of aluminium, cadmium, chromium, cobalt, copper, lead, manganese, nickel and zinc. The total amounts of the elements are in the concentration range as reported for agricultural soils in different geographical regions. Only two soils of the capital Zagreb have higher concentrations of pollutant metals, such as chromium, cobalt, copper, lead, manganese and zinc. Regarding nutrients, all soils have met the needs of common garden plants.

  2. Available in selected metros only : rural melancholy and the promise of online connectivity

    Directory of Open Access Journals (Sweden)

    Gregg, Melissa

    2010-01-01

    Full Text Available This article considers the benefits a cultural studies perspective can offer debates around rural and regional telecommunications provision. It begins with a critique of the metrocentrism dominant in recent scholarship of new media, arguing that academic, business and government discourses share progressivist assumptions in equating online connectivity with freedom. It highlights how the gap between the promotion of connectivity and actually existing infrastructure leads to an ontological resilience among rural residents who 'make do' with deferred promises of community and participation. The relationship this bears to the political subjectivities described in recent queer theory is briefly explored. The article develops to suggest that a parachute model of policy consultation privileges those in rural communities with the social and cultural capital to advance established interests – leaving the everyday lives of the majority of residents unrecognised. In encouraging ethnographic studies of technology use that spend time in rural locations, the paper concludes that the different priorities that drive country life – the prominence of environmental concerns, the importance of civic institutions, and above all, distance from the temporalities that dictate the terms for assessing political participation – offer important correctives to the ideologies of individualism and innovation that drive new media consumption.

  3. Available in Selected Metros Only: Rural Melancholy and the Promise of Online Connectivity

    Directory of Open Access Journals (Sweden)

    Melissa Gregg

    2010-03-01

    Full Text Available This article considers the benefits a cultural studies perspective can offer debates around rural and regional telecommunications provision. It begins with a critique of the metrocentrism dominant in recent scholarship of new media, arguing that academic, business and government discourses share progressivist assumptions in equating online connectivity with freedom. It highlights how the gap between the promotion of connectivity and actually existing infrastructure leads to an ontological resilience among rural residents who 'make do' with deferred promises of community and participation. The relationship this bears to the political subjectivities described in recent queer theory is briefly explored. The article develops to suggest that a parachute model of policy consultation privileges those in rural communities with the social and cultural capital to advance established interests – leaving the everyday lives of the majority of residents unrecognised. In encouraging ethnographic studies of technology use that spend time in rural locations, the paper concludes that the different priorities that drive country life – the prominence of environmental concerns, the importance of civic institutions, and above all, distance from the temporalities that dictate the terms for assessing political participation – offer important correctives to the ideologies of individualism and innovation that drive new media consumption.

  4. Phenolic content, antioxidant and antibacterial activity of selected natural sweeteners available on the Polish market.

    Science.gov (United States)

    Grabek-Lejko, Dorota; Tomczyk-Ulanowska, Kinga

    2013-01-01

    Seventeen natural sweeteners available on the Polish market were screened for total phenolic content, by the Folin-Ciocalteu method, and for antioxidant activity, using the ferric reducing antioxidant power (FRAP) assay and the 2,2'-Azinobis (3-ethylbenzthiazoline-6-sulphonic acid) radical cation decolorization assay (ABTS(·+)). In addition, we analyzed antibacterial activities against Staphylococcus aureus strains: both those susceptible and those resistant to methicillin (MRSA). The results of the study showed that total phenolic content, antioxidant activity and antibacterial activity differ widely among different samples of sweeteners. Phenolic content, expressed as a gallic acid equivalent, ranged from 0 mg kg(-1) in white, refined sugar, xylitol and wheat malt syrup to 11.4 g kg(-1) in sugarcane molasses. Antioxidant activity was lowest in refined white sugar, xylitol, brown beet sugar, liquid fructose, and rape honey; it was average in spelt syrup and corn syrup, and highest in sugar cane, beet molasses, date and barley syrups. Despite the great variety of sweeteners, a strong correlation was noted between the concentration of phenolics and antioxidant properties, as determined by the ABTS(·+) method (r = 0.97) and the FRAP assay (r = 0.77). The strongest antibacterial activity was observed in sugarcane molasses, which was lethal to S. aureus strains at 2 and 4% concentrations in medium for susceptible and MRSA strains respectively. Other sweeteners kill bacteria in 6-15% solutions, whereas some did not show any antibacterial activities against S. aureus strains, even at 20% concentrations. Due to their high antioxidant and antibacterial activities, some of the tested sweeteners have potential therapeutic value as supporting agents in antibiotic therapy.

  5. Discovery and characterization of ACT-335827, an orally available, brain penetrant orexin receptor type 1 selective antagonist.

    Science.gov (United States)

    Steiner, Michel A; Gatfield, John; Brisbare-Roch, Catherine; Dietrich, Hendrik; Treiber, Alexander; Jenck, Francois; Boss, Christoph

    2013-06-01

    Stress relief: Orexin neuropeptides regulate arousal and stress processing through orexin receptor type 1 (OXR-1) and 2 (OXR-2) signaling. A selective OXR-1 antagonist, represented by a phenylglycine-amide substituted tetrahydropapaverine derivative (ACT-335827), is described that is orally available, penetrates the brain, and decreases fear, compulsive behaviors and autonomic stress reactions in rats.

  6. The Availability and Utilization of School Library Resources in Some Selected Secondary Schools (High School) in Rivers State

    Science.gov (United States)

    Owate, C. N.; Iroha, Okpa

    2013-01-01

    This study investigates the availability and utilization of school library resources by Secondary School (High School) Students. Eight Selected Secondary Schools in Rivers State, Nigeria were chosen based on their performance in external examinations and geographic locations. In carrying out the research, questionnaires were administered to both…

  7. Planejamento em Saúde

    Directory of Open Access Journals (Sweden)

    Antonio José Costa CARDOSO

    2014-03-01

    Full Text Available Esse texto pretendeu subsidiar aula sobre Planejamento e Avaliação em Saúde para os Analistas Técnicos de Políticas Sociais lotados no Ministério da Saúde (MS, na perspectiva de promover uma maior compreensão dos antecedentes históricos do planejamento em saúde no Brasil e na América Latina, do referencial teórico metodológico do planejamento estratégico e participativo, e refletir sobre os avanços e desafios que se apresentam no atual contexto de construção do Sistema Único de Saúde (SUS. Neste sentido, foi estruturado na perspectiva de responder a três questões orientadoras: 1 Como tem se dado esse processo de coordenação do Planejamento Estratégico Nacional no âmbito do SUS, em cooperação técnica com os Estados, Municípios e Distrito Federal? 2 Quais são as tecnologias de gestão e planejamento em saúde adotadas pelo MS para conduzir esses processos de forma integrada? 3 Como se dá o gerenciamento das ações no MS? Como os planos, projetos e programas são monitorados pelas equipes responsáveis?

  8. Is the red spotted green frog Hypsiboas punctatus (Anura: Hylidae) selecting its preys? The importance of prey availability.

    Science.gov (United States)

    López, Javier A; Scarabotti, Pablo A; Medrano, María C; Ghirardi, Romina

    2009-09-01

    The study of the feeding ecology of amphibians is an old issue in herpetology. Notwithstanding, the lack of food resources data in many studies of amphibians feeding has lead to partial understanding of frog feeding strategies. In this study we evaluate the trophic selectivity of a red spotted green frog (Hypsiboas punctatus) population from a Middle Paraná River floodplain pond in Argentina, and discuss the importance of prey availability data when interpreting results from diet analysis. We analyzed the gut contents of 47 H. punctatus adults and compared frog's diet with the environmental food resources. Prey availability was estimated by systematically seep-netting the microhabitat where anurans were localized foraging. We identified 33 taxonomic categories from gastrointestinal contents. Numerically, the most important prey categories were dipterans, followed by hemipterans, homopterans and coleopterans. The diet similarity between males and females was high and no statistical differences in diet composition were found. The most abundant food resources in the environment were dipterans, coleopterans, homopterans and collembolans. In order to assess whether frogs were selecting their preys, we calculated Pianka's niche overlap index and Jacobs' electivity index comparing gut contents to prey availability data. Trophic niche overlap was medium but significantly higher than expected by chance. The electivity index indicated that H. punctatus foraged dipterans slightly above their environmental abundance. Among the secondary preys, hemipterans were foraged selectively, homopterans were consumed in the same proportion to their occurrence in the environment, coleopterans were foraged quite under their availability and collembolans were practically ignored by frogs. Without food resources data, H. punctatus could be classified as a specialist feeder, but dipterans also were quite abundant in the environment. Our results show that H. punctatus fit better as a

  9. IMPROVEMENT OF RESPONSE TO LOW WATER AVAILABILITY IN MAIZE PLANTS INOCULATED WITH SELECTED RHIZOSPHERIC MICROBIAL CONSORTIA UNDER DIFFERENT IRRIGATION REGIMES

    Directory of Open Access Journals (Sweden)

    Eligio Malusà

    2014-01-01

    Full Text Available Low water availability for agriculture is a rising problem in temperate countries. The effect of two different rhizospheric microbial consortia on the tolerance to water deficiency of maize was evaluated under controlled watering regimes. One consortium was a mixture of arbuscular mycorrhizal fungi and rhizospheric bacteria isolated under osmotic stress selective pressure; the other consortium was a commercial product. A higher tolerance of plants to water deficiency was observed when roots were inoculated with microbial consortia. Plant gas exchange parameters were positively affected by inoculation, and a improvements of the leaves mineral nutrients content and of the biomass yield were also recorded. The positive effect should be ascribed to an increased roots development more than to an increased uptake from extraradical mycorrhizal hyphae. The use of microbial inoculants appears to be a suitable practice to improve the crop performances under low water availability.

  10. Demographic Data, (Note: Describe as available) Full selection of demographic data available to join with related boundary area GIS files, Published in Not Provided, 1:12000 (1in=1000ft) scale, Indiana University (IU).

    Data.gov (United States)

    NSGIC Education | GIS Inventory — Demographic Data dataset current as of unknown. (Note: Describe as available) Full selection of demographic data available to join with related boundary area GIS...

  11. ANALISIS DAYA SAING KEDELAI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sarwono Sarwono

    2014-09-01

    Full Text Available RCA (Revealed Comparative Advantage index of soybean in Indonesia from 1983 up to 2013 is less than one, mostly. It means that the competitiveness of soybean in Indonesia is low. The purpose of this study is to analyze the factors influence the soybean competitiveness. OLS (Ordinary Least Square was used as the analysis method. Hypotheses test based on that analysis model is not bias, so that, classic divergence test is needed. It is for getting the Best Linier Unbiased Estimator (BLUE appraisal. T statistic and F statistic were also applied. The result of this research shows that production and export have positive and significant influence. In addition, exchange rate and government policy do not influence the Indonesia soybean competitiveness.Indeks RCA (Revealed Comparative Advantage kedelai Indonesia dari tahun 1983-2013 kecenderungan bernilai kurang dari satu yang berarti daya saing kedelai Indonesia rendah.Penelitian ini bertujuan untuk menganalisis faktor-faktor yang mempengaruhi daya saing kedelai Indonesia.Metode analisis yang digunakan adalah Ordinary Least Square (OLS.Pengujian hipotesis berdasarkan model analisis tersebut tidak bias maka perlu dilakukan uji penyimpangan klasik yang tujuannya agar diperoleh penaksiran yang bersifat Best Linier Unbiased Estimator (BLUE.Pengujian statistik menggunakan uji t statistikdan uji f statistik.Hasil penelitian ini menunjukkan bahwa produksi dan ekspor berpengaruh secara positif dan signifikan terhadap daya saing kedelai Indonesia. Nilai tukar rupiah dan kebijakan pemerintah tidak berpengaruh terhadap daya saing kedelai Indonesia.

  12. SARANEA: a freely available program to mine structure-activity and structure-selectivity relationship information in compound data sets.

    Science.gov (United States)

    Lounkine, Eugen; Wawer, Mathias; Wassermann, Anne Mai; Bajorath, Jürgen

    2010-01-01

    We introduce SARANEA, an open-source Java application for interactive exploration of structure-activity relationship (SAR) and structure-selectivity relationship (SSR) information in compound sets of any source. SARANEA integrates various SAR and SSR analysis functions and utilizes a network-like similarity graph data structure for visualization. The program enables the systematic detection of activity and selectivity cliffs and corresponding key compounds across multiple targets. Advanced SAR analysis functions implemented in SARANEA include, among others, layered chemical neighborhood graphs, cliff indices, selectivity trees, editing functions for molecular networks and pathways, bioactivity summaries of key compounds, and markers for bioactive compounds having potential side effects. We report the application of SARANEA to identify SAR and SSR determinants in different sets of serine protease inhibitors. It is found that key compounds can influence SARs and SSRs in rather different ways. Such compounds and their SAR/SSR characteristics can be systematically identified and explored using SARANEA. The program and source code are made freely available under the GNU General Public License.

  13. Saúde e desenvolvimento

    Directory of Open Access Journals (Sweden)

    Ana Luiza D'Ávila Viana

    Full Text Available Considerando que os modernos sistemas de saúde são o resultado da complexa interação de processos econômicos, políticos e sociais, o objetivo do trabalho é discutir a relação entre saúde e desenvolvimento no Brasil, mostrando que o esgotamento do modelo liberal de política econômica abre nova perspectiva para a retomada do desenvolvimento, entendido como combinação entre crescimento da economia, mudanças na estrutura produtiva e melhora das condições de vida da população. O complexo produtivo da saúde joga papel decisivo nesse processo, pois constitui um campo em que inovação tecnológica e acumulação de capital geram oportunidades de investimento, trabalho e renda, além de produzir avanços importantes para melhorar o estado de saúde das pessoas. A recente adoção de políticas públicas voltadas para articular, de forma positiva, aspectos da política econômica e da política social revela que a questão do desenvolvimento nacional ganhou nova centralidade na agenda governamental, o que abre a perspectiva de maior integração entre a lógica econômica e a lógica sanitária. Entretanto, é preciso reconhecer que o Brasil ainda não logrou alcançar uma associação virtuosa entre saúde e desenvolvimento.

  14. Determining the storage, availability and reactivity of NH3 within Cu-Chabazite-based Ammonia Selective Catalytic Reduction systems.

    Science.gov (United States)

    Lezcano-Gonzalez, I; Deka, U; Arstad, B; Van Yperen-De Deyne, A; Hemelsoet, K; Waroquier, M; Van Speybroeck, V; Weckhuysen, B M; Beale, A M

    2014-01-28

    Three different types of NH3 species can be simultaneously present on Cu(2+)-exchanged CHA-type zeolites, commonly used in Ammonia Selective Catalytic Reduction (NH3-SCR) systems. These include ammonium ions (NH4(+)), formed on the Brønsted acid sites, [Cu(NH3)4](2+) complexes, resulting from NH3 coordination with the Cu(2+) Lewis sites, and NH3 adsorbed on extra-framework Al (EFAl) species, in contrast to the only two reacting NH3 species recently reported on Cu-SSZ-13 zeolite. The NH4(+) ions react very slowly in comparison to NH3 coordinated to Cu(2+) ions and are likely to contribute little to the standard NH3-SCR process, with the Brønsted groups acting primarily as NH3 storage sites. The availability/reactivity of NH4(+) ions can be however, notably improved by submitting the zeolite to repeated exchanges with Cu(2+), accompanied by a remarkable enhancement in the low temperature activity. Moreover, the presence of EFAl species could also have a positive influence on the reaction rate of the available NH4(+) ions. These results have important implications for NH3 storage and availability in Cu-Chabazite-based NH3-SCR systems.

  15. Health SA Gesondheid

    African Journals Online (AJOL)

    Health SA Gesondheid - Journal of Interdisciplinary Health Sciences is an open access, .... Chokwe M. Setati, Zerish Z. Nkosi, 130-137 ... Movement as a critical concept in model generation to attain wholeness · EMAIL FREE FULL TEXT ...

  16. CLUB-MARTINI: Selecting Favourable Interactions amongst Available Candidates, a Coarse-Grained Simulation Approach to Scoring Docking Decoys.

    Directory of Open Access Journals (Sweden)

    Qingzhen Hou

    Full Text Available Large-scale identification of native binding orientations is crucial for understanding the role of protein-protein interactions in their biological context. Measuring binding free energy is the method of choice to estimate binding strength and reveal the relevance of particular conformations in which proteins interact. In a recent study, we successfully applied coarse-grained molecular dynamics simulations to measure binding free energy for two protein complexes with similar accuracy to full-atomistic simulation, but 500-fold less time consuming. Here, we investigate the efficacy of this approach as a scoring method to identify stable binding conformations from thousands of docking decoys produced by protein docking programs. To test our method, we first applied it to calculate binding free energies of all protein conformations in a CAPRI (Critical Assessment of PRedicted Interactions benchmark dataset, which included over 19000 protein docking solutions for 15 benchmark targets. Based on the binding free energies, we ranked all docking solutions to select the near-native binding modes under the assumption that the native-solutions have lowest binding free energies. In our top 100 ranked structures, for the 'easy' targets that have many near-native conformations, we obtain a strong enrichment of acceptable or better quality structures; for the 'hard' targets without near-native decoys, our method is still able to retain structures which have native binding contacts. Moreover, in our top 10 selections, CLUB-MARTINI shows a comparable performance when compared with other state-of-the-art docking scoring functions. As a proof of concept, CLUB-MARTINI performs remarkably well for many targets and is able to pinpoint near-native binding modes in the top selections. To the best of our knowledge, this is the first time interaction free energy calculated from MD simulations have been used to rank docking solutions at a large scale.

  17. SalSA status

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom)], E-mail: amyc@hep.ucl.ac.uk

    2009-06-01

    I review the status of SalSA, a proposed antenna array in a large volume salt formation for detecting ultra-high energy neutrinos. We report on measurements taken in 2007 of attenuation lengths in the 125-900 MHz frequency range at the Cote Blanche salt mine near New Iberia, Louisiana, which is the most precise in situ measurement of attenuation lengths in salt to date. We comment on the impact of these measurements on the feasibility of SalSA.

  18. Total and Available Heavy Metal Concentrations and Assessment of Soil Pollution Indices in Selected Soils of Zanjan

    Directory of Open Access Journals (Sweden)

    M. Taheri

    2017-01-01

    content of soils were respect to control these indices. Geoaccumulation index of Zn, Cd and Pb, and availability ratios of Zn and Pb showed negative correlations with soil pH. Therefore, in some seasons of the year, their availabilities will increase in soil. Conclusion: The results showed that Cu content in soils were not in the critical limit but Cd, Pb and Zn content in soils were greater than standard levels and reclamation procedures for remedy of these soils must be done. The high values of the heavy metals in available fraction inthe soils increased the risk of bioaccumulation in microbial and biotic tissues. In areas where there are high content of available form of heavy metals in soils, it could be an index of new contamination in soils by heavy metals. According to geoaccumulation index of Cd, Zn and Pb, there are some contaminated points around waste depositition areas near Zanjan city. These points are in the direction that wind could effectively transport the particles of wastes to urban area. Enrichment factor (EF showed that at least there were a few points polluted by Cd, Zn and Cu, although EF values were generally low. The leaked wastes of Zinc and lead industries had been spread in deposited areas caused difficulties in determining background values for the selected metals.

  19. Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas

    Directory of Open Access Journals (Sweden)

    F. P. A. Demeterio

    2010-06-01

    Full Text Available Maraming paraan ang pagsusuri sa problema ng pulitika sa Pilipinas.Para sa mga moralista at ideyalista, halimbawa, maaari itong tingnangamit ang perspektibo ng sistema ng pagpapahalaga (values at moralidad; para sa mga materyalista naman, maaari din itong himayin gamit ang perspektibo ng pagka-di-pantay-pantay ng kayamanan at kapangyarihan(unequal wealth and power ng ating mga mamamayan; o hindi kaya para sa mga eksperto sa sistema at istraktura, maaari din itong dalumatin gamit ang perspektibo ng ating marupok na burukrasya. Susubukan ng papel na ito na pag-aralan ang paksa sa pamamagitan ng pagsusuri sa konsepto ng pamumuno na hinihiling ng ating demokratikong sistema at sa kaparehong konseptong umiiiral naman sa kamalayan ng ating mga kababayan. Gagamitin ng pagsusuring ito, bilang teoretikal na balangkas, ang isang uri ng antropolohikalna teorya at pamamaraan na kilala bilang “kognitibong antropolohiya”(cognitive anthropology.

  20. Cumulative Production Per Township - SaMiRa

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains a selected township grid within the Sagebrush Mineral Resource Assessment project (SaMiRa) study area attributed with cumulative oil and gas...

  1. Saúde Coletiva: um desafio para a enfermagem

    Directory of Open Access Journals (Sweden)

    Matumoto Silvia

    2001-01-01

    Full Text Available O texto parte da saúde pública para discutir o que é saúde coletiva, seu objeto e campo de atuação, dando ênfase à concepção de homem, à discussão a respeito do âmbito individual e coletivo e ao conceito de saúde-doença, passando pelo debate da construção interdisciplinar da saúde coletiva. Em seguida, busca situar a enfermagem nesse campo, destacando aquilo que parece ser um grande desafio, compreender a enfermagem como prática de relações.

  2. Effect of compositional alteration of food matrices and processing on availability of selected nutrients and bioactive components in rice products.

    Science.gov (United States)

    Oghbaei, Morteza; Prakash, Jamuna

    2011-05-01

    The aim was to determine the influence of compositional alteration and processing on the digestibility/availability of nutrients and bioactive components [protein (IVPD), starch (IVSD), iron, calcium, polyphenols, flavonoids] in rice products. The compositional changes representing fortified foods in 'wafers' and 'noodles' were addition of iron, rice bran, onion and cabbage. The moisture content of wafer and noodles ranged from 4.1 to 4.8% and from 73.3 to 82.1%, respectively. Wafer control (73.9-75.9%) and noodle with iron and control (85.4-87.0%) showed the highest IVPD and IVSD. Addition of rice bran decreased nutrient digestibility. The control and iron-added products exhibited least and highest available iron (2.50-2.69% and 5.99-7.07%). Total and available bioactive components increased in proportion to added external source. Overall availability of all components was better in noodles than in wafers, indicating high moisture supported higher availability. In conclusion, it can be said that both composition of the food matrix and processing influenced the availability of analyzed components.

  3. Perceived neighborhood partner availability, partner selection, and risk for sexually transmitted infections within a cohort of adolescent females.

    Science.gov (United States)

    Matson, Pamela A; Chung, Shang-En; Ellen, Jonathan M

    2014-07-01

    This research examined the association between a novel measure of perceived partner availability and discordance between ideal and actual partner characteristics as well as trajectories of ideal partner preferences and perceptions of partner availability over time. A clinic-recruited cohort of adolescent females (N = 92), aged 1619 years, were interviewed quarterly for 12 months using audio computer-assisted self-interview. Participants ranked the importance of characteristics for their ideal main sex partner and then reported on these characteristics for their current main partner. Participants reported on perceptions of availability of ideal sex partners in their neighborhood. Paired t-tests examined discordance between ideal and actual partner characteristics. Random-intercept regression models examined repeated measures. Actual partner ratings were lower than ideal partner preferences for fidelity, equaled ideal preferences for emotional support and exceeded ideal preferences for social/economic status and physical attractiveness. Discordance on emotional support and social/economic status was associated with sex partner concurrency. Participants perceived low availability of ideal sex partners. Those who perceived more availability were less likely to be ideal/actual discordant on fidelity [OR = .88, 95% CI: .78, 1.0]. Neither ideal partner preferences nor perceptions of partner availability changed over 12 months. Current main sex partners met or exceeded ideal partner preferences in all domains except fidelity. If emotional needs are met, adolescents may tolerate partner concurrency in areas of limited partner pools. Urban adolescent females who perceive low availability may be at increased risk for sexually transmitted infection (STI) because they may be more likely to have nonmonogamous partners. Copyright © 2014 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  4. Failure database and tools for wind turbine availability and reliability analyses. The application of reliability data for selected wind turbines

    DEFF Research Database (Denmark)

    Kozine, Igor; Christensen, P.; Winther-Jensen, M.

    2000-01-01

    The objective of this project was to develop and establish a database for collecting reliability and reliability-related data, for assessing the reliability of wind turbine components and subsystems and wind turbines as a whole, as well as for assessingwind turbine availability while ranking...... the contributions at both the component and system levels. The project resulted in a software package combining a failure database with programs for predicting WTB availability and the reliability of all thecomponents and systems, especially the safety system. The report consists of a description of the theoretical...... foundation of the reliability and availability analyses and of sections devoted to the development of the WTB reliability models as well as adescription of the features of the database and software developed. The project comprises analysis of WTBs NM 600/44, 600/48, 750/44 and 750/48, all of which have...

  5. Failure database and tools for wind turbine availability and reliability analyses. The application of reliability data for selected wind turbines

    Energy Technology Data Exchange (ETDEWEB)

    Kozine, I.; Christensen, P.; Winther-Jensen, M.

    2000-01-01

    The objective of this project was to develop and establish a database for collecting reliability and reliability-related data, for assessing the reliability of wind turbine components and subsystems and wind turbines as a whole, as well as for assessing wind turbine availability while ranking the contributions at both the component and system levels. The project resulted in a software package combining a failure database with programs for predicting WTB availability and the reliability of all the components and systems, especially the safety system. The report consists of a description of the theoretical foundation of the reliability and availability analyses and of sections devoted to the development of the WTB reliability models as well as a description of the features of the database and software developed. The project comprises analysis of WTBs NM 600/44, 600/48, 750/44 and 750/48, all of which have similar safety systems. The database was established with Microsoft Access Database Management System, the software for reliability and availability assessments was created with Visual Basic. (au)

  6. Acute pharmacologically induced shifts in serotonin availability abolish emotion-selective responses to negative face emotions in distinct brain networks

    DEFF Research Database (Denmark)

    Grady, Cheryl Lynn; Siebner, Hartwig R; Hornboll, Bettina

    2013-01-01

    enhanced the neural response of this set of regions to angry faces, relative to Control, and CIT also enhanced activity for neutral faces. The net effect of these changes in both networks was to abolish the selective response to fearful expressions. These results suggest that a normal level of serotonin...... distributed brain responses identified two brain networks with modulations of activity related to face emotion and serotonin level. The first network included the left amygdala, bilateral striatum, and fusiform gyri. During the Control session this network responded only to fearful faces; increasing serotonin...... decreased this response to fear, whereas reducing serotonin enhanced the response of this network to angry faces. The second network involved bilateral amygdala and ventrolateral prefrontal cortex, and these regions also showed increased activity to fear during the Control session. Both drug challenges...

  7. The Available Options for Wavelength Group Selection and Transceiver Design for Next Generation PON Stage 2 (NG-PON2)

    Science.gov (United States)

    Niazi, Shahab Ahmad; Zhang, Xiaoguang; Xi, Lixia; Chen, Yong Li; Idress, Muhammad

    2013-09-01

    The full service access network (FSAN) task group meeting was held in April 2012, where they agreed to adopt time and wavelength division multiplexed passive optical network (TWDM-PON) as a primary solution to NG-PON2. Major requirements includes at least 40 Gbit/s aggregate rate in downstream, 1:64 split ratio, 40 km differential reach, and at least 1 Gb/s access rate per optical network unit (ONU). In this paper, a performance analysis will be carried out for downstream 4-wavelengths group selection from S-band, L-band, and C-band. A comparison for optimal transmitter design is also investigated among probable options of chirp managed laser diode, Lithium Niobate (LiNbo3) Mach Zehnder modulator, besides examining tunable transceivers in contrary to remotely fed colorless ONUs.

  8. Mga Kuwento-Kuwento ng Baliw: Lihis na Pagkilos sa Mga Maikling-Kuwentong Tagalog

    Directory of Open Access Journals (Sweden)

    Diana Ziganay

    1990-12-01

    Full Text Available Ang sulating ito ay nalikha upang magbigay ng isang pagsusuri at pagtatalakay sa pagbuo ng konsepto ng abnormalidad o kakaibang kilos o pananaw buhat sa mga piling uri ng panitikang Pilipinong naisulat sa wikang Ingles noong ika-1900 hanggang 1945. Pag-uukulan ng pansin dito ang panahon at kalagayang binanggit, ang mga suliraning binanggit, ang maga suliranin ng pagbuo ng panitikang Pilipino sa Ingles, at ang daloy ng kaisipan ng mga manunulat na may kaugnayan sa pag-unawa ng konsepto ng abnormalidad na sumasalamin sa ilang mga piling sulatin, tuwiran man o di tuwiran.

  9. Heavy metal content of selected personal care products (PCPs available in Ibadan, Nigeria and their toxic effects

    Directory of Open Access Journals (Sweden)

    Sunday Samuel Omenka

    2016-01-01

    Full Text Available There is a growing concern on heavy metals in consumer products due to their potential human health risks and environmental effects. In this study, the levels of zinc, cadmium, lead and nickel were assessed in 3 different classes of personal care products commonly used in Ibadan, Nigeria. Samples were analysed for heavy metals using Atomic Absorption Spectrophotometer (AAS after acid digestion. Estimated daily intake (EDI of the metals and Health Risk Index (HRI were calculated to assess the human health risks associated with the use of these PCPs. The concentrations (mg/kg of zinc ranged from 3.75 to 19.3, 1.88 to 112,000 and 19.8 to 217 respectively in creams, powders and eyeliners. Cadmium ranged from ND—0.50, ND—36.3 and ND—0.50 mg/kg while lead ranged from ND—6.25, ND—468 and 3.73–27.5 mg/kg and nickel ranged from ND—6.25, 0.13–107 and 2.75–22.7 mg/kg respectively. There were high concentrations of Cd, Pb and Ni in some of the samples when compared with the available permissible limits in cosmetics (Cd: 0.3 ppm, Pb: 10 ppm and Ni: 0.6 ppm while there is no permissible limit for Zn in cosmetics currently available. Prolonged use of PCPs may pose human health and environmental risks due to toxic metal loading through dermal contact and accumulation over a period of time. Hence, the need for necessary government agencies to regulate and enforce toxic metals in consumer products including cosmetics produced and imported into Nigeria to safeguard public health and the environment, which is the final sink.

  10. Antioxidants Activity and Color Evaluation of Date Fruit of Selected Cultivars Commercially Available in the United States

    Directory of Open Access Journals (Sweden)

    Fahad Mohammed Al-Jasass

    2015-01-01

    Full Text Available Dates (Phoenix dactylifera L. are nutrient-rich fruit consumed throughout the world, either directly or in several food products. Six commercially available date cultivars in the US were analyzed for total phenolics, antioxidant activity using ABTS, DPPH, FRAP, and ORAC assays, and instrumental color. Total phenolics content varied from 33 to 125 mg GAE/100 g dry weight, with the highest in Barni (Saudi Arabia. Antioxidant values as determined by the ABTS in Deglet Nour (Algeria, Deglet Nour (California, Deglet Noor (Tunisia, Shahia (Tunisia, Barni (Saudi Arabia, and Khudri (Saudi Arabia were 1300, 1047, 796, 452, 776, and 341 μmol TE/g dry weight, respectively. Antioxidative properties as measure by DPPH, FRAP, and ORAC varied from 3.27 to 3.54, 3.29 to 5.22, and 189 to 243 μmol TE/g dry basis, respectively. Fruit and pulp color of Deglet Nour (Algeria was lighter whereas pulp of Barni (Saudi Arabia was the darkest. Antioxidant values varied with different techniques used and also followed a different pattern than that of phenolics content.

  11. Atmospheric environment for ASTP (SA-210) launch

    Science.gov (United States)

    Johnson, D. L.

    1976-01-01

    A summary is presented of selected atmospheric conditions observed near ASTP/SA-210 launch time on July 15, 1975, at Kennedy Space Center, Florida. Values of ambient pressure, temperature, moisture, ground winds, visual observations (cloud), density, index of refraction, and wind/wind shear aloft are included. A final meteorological data tape for the ASTP launch, consisting of wind and thermodynamic parameters versus altitude, has been constructed.

  12. ARQ 092, an orally-available, selective AKT inhibitor, attenuates neutrophil-platelet interactions in sickle cell disease.

    Science.gov (United States)

    Kim, Kyungho; Li, Jing; Barazia, Andrew; Tseng, Alan; Youn, Seock-Won; Abbadessa, Giovanni; Yu, Yi; Schwartz, Brian; Andrews, Robert K; Gordeuk, Victor R; Cho, Jaehyung

    2017-02-01

    Previous studies identified the Ser/Thr protein kinase, AKT, as a therapeutic target in thrombo-inflammatory diseases. Here we report that specific inhibition of AKT with ARQ 092, an orally-available AKT inhibitor currently in phase Ib clinical trials as an anti-cancer drug, attenuates the adhesive function of neutrophils and platelets from sickle cell disease patients in vitro and cell-cell interactions in a mouse model of sickle cell disease. Studies using neutrophils and platelets isolated from sickle cell disease patients revealed that treatment with 50-500 nM ARQ 092 significantly blocks αMβ2 integrin function in neutrophils and reduces P-selectin exposure and glycoprotein Ib/IX/V-mediated agglutination in platelets. Treatment of isolated platelets and neutrophils with ARQ 092 inhibited heterotypic cell-cell aggregation under shear conditions. Intravital microscopic studies demonstrated that short-term oral administration of ARQ 092 or hydroxyurea, a major therapy for sickle cell disease, diminishes heterotypic cell-cell interactions in venules of sickle cell disease mice challenged with tumor necrosis factor-α. Co-administration of hydroxyurea and ARQ 092 further reduced the adhesive function of neutrophils in venules and neutrophil transmigration into alveoli, inhibited expression of E-selectin and intercellular adhesion molecule-1 in cremaster vessels, and improved survival in these mice. Ex vivo studies in sickle cell disease mice suggested that co-administration of hydroxyurea and ARQ 092 efficiently blocks neutrophil and platelet activation and that the beneficial effect of hydroxyurea results from nitric oxide production. Our results provide important evidence that ARQ 092 could be a novel drug for the prevention and treatment of acute vaso-occlusive complications in patients with sickle cell disease.

  13. ARQ 092, an orally-available, selective AKT inhibitor, attenuates neutrophil-platelet interactions in sickle cell disease

    Science.gov (United States)

    Kim, Kyungho; Li, Jing; Barazia, Andrew; Tseng, Alan; Youn, Seock-Won; Abbadessa, Giovanni; Yu, Yi; Schwartz, Brian; Andrews, Robert K.; Gordeuk, Victor R.; Cho, Jaehyung

    2017-01-01

    Previous studies identified the Ser/Thr protein kinase, AKT, as a therapeutic target in thrombo-inflammatory diseases. Here we report that specific inhibition of AKT with ARQ 092, an orally-available AKT inhibitor currently in phase Ib clinical trials as an anti-cancer drug, attenuates the adhesive function of neutrophils and platelets from sickle cell disease patients in vitro and cell-cell interactions in a mouse model of sickle cell disease. Studies using neutrophils and platelets isolated from sickle cell disease patients revealed that treatment with 50–500 nM ARQ 092 significantly blocks αMβ2 integrin function in neutrophils and reduces P-selectin exposure and glycoprotein Ib/IX/V-mediated agglutination in platelets. Treatment of isolated platelets and neutrophils with ARQ 092 inhibited heterotypic cell-cell aggregation under shear conditions. Intravital microscopic studies demonstrated that short-term oral administration of ARQ 092 or hydroxyurea, a major therapy for sickle cell disease, diminishes heterotypic cell-cell interactions in venules of sickle cell disease mice challenged with tumor necrosis factor-α. Co-administration of hydroxyurea and ARQ 092 further reduced the adhesive function of neutrophils in venules and neutrophil transmigration into alveoli, inhibited expression of E-selectin and intercellular adhesion molecule-1 in cremaster vessels, and improved survival in these mice. Ex vivo studies in sickle cell disease mice suggested that co-administration of hydroxyurea and ARQ 092 efficiently blocks neutrophil and platelet activation and that the beneficial effect of hydroxyurea results from nitric oxide production. Our results provide important evidence that ARQ 092 could be a novel drug for the prevention and treatment of acute vaso-occlusive complications in patients with sickle cell disease. PMID:27758820

  14. Análise da fidedignidade dos dados estatísticos hospitalares disponíveis na Secretaria de Estado da Saúde de São Paulo em 1974 Accuracy analysis of the available hospital statistical data at the S. Paulo State Health Department

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Lebrão

    1978-06-01

    Full Text Available Foi analisada a fidedignidade dos dados estatísticos hospitalares recebidos pela Coordenadoria de Assistência Hospitalar da Secretaria de Estado da Saúde de São Paulo. Mediante uma amostra sistemática por conglomerado em etapa única, com base nas saídas de pacientes relacionados nos Boletins 101 - "Movimento de Pacientes Saídos" - foram visitados 31 hospitais de assistência hospitalar geral e examinados 7.021 prontuários de pacientes saídos durante um mês. A perda de prontuários foi em média de 19,64%. Houve concordância de dados quanto à idade, procedência, data de admissão e tipo de saída, respectivamente de 97,08%, 96,93%, 98,47% e 99,82%. Relativamente à data de saída, a discordância média foi de 7,43%, com valores de até 65,64% e 82,51% de erro, sendo analisados alguns fatores responsáveis por esses resultados. Quanto aos diagnósticos, verificou-se que há um aumento da relação de diagnósticos por paciente, na medida em que se examinam o Boletim 101 e os prontuários, e que alguns diagnósticos tais como anemias, desnutrição e verminoses apareceram inúmeras vezes nos prontuários sem a devida transcrição no Boletim 101. Em 17,51% dos casos, os diagnósticos registrados nos Boletins não concordaram com os diagnósticos dos prontuários, havendo 458 saídas (6,52% onde o único diagnóstico registrado era um estado mórbido mal definido, tendo sido possível reduzir, mediante análise dos prontuários, esse número para 174 casos (2,48%.The objective of this paper was to analyze the accuracy of hospital statistical data collected by means of the "Model 101 Report" of the S. Paulo State Health Department, Brazil. The "Model 101 Report" summarizes the data on discharged patient records and is sent monthly to the Health Department by each hospital in the State of S. Paulo. A one stage systematic cluster sampling of these data was performed. Only general care hospitals entered the sample. Thirty one hospitals

  15. Por um programa preventivo em saúde mental do trabalhador na brigada militar

    Directory of Open Access Journals (Sweden)

    Fernanda Spanier Amador

    Full Text Available O presente artigo argumenta sobre a importância de políticas de Saúde e Segurança Públicas que sustentem programas voltados à saúde do trabalhador na Brigada Militar. Aborda, mais especificamente, a necessidade de ações preventivas e promotoras de saúde mental nesse âmbito.

  16. Saúde mental e trabalho: os problemas que persistem

    Directory of Open Access Journals (Sweden)

    Leny Sato

    Full Text Available Este artigo toma por objeto a Saúde Mental e Trabalho como uma subárea do campo da Saúde do Trabalhador. Parte da constatação de que os problemas de saúde mental e trabalho, já identificados em meados da década de 1980, persistem. Após retomar a taxonomia de tais problemas, busca evidenciar algumas de suas expressões atuais a partir da assistência e da vigilância em saúde do trabalhador, bem como pela perspectiva de alguns sindicatos mais atentos à questão. Para tal, toma como ponto de partida o Centro de Referência em Saúde do Trabalhador (CRST de Campinas. Por fim, pontua algumas características do trabalho no contexto atual para compreender as motivações dessa persistência.

  17. Projetos PET-Saúde e Educando para a Saúde: construindo saberes e práticas

    Directory of Open Access Journals (Sweden)

    Pâmela Leites de Souza

    Full Text Available Buscando alcançar ações intersetoriais efetivas e inovadoras, o projeto Educando para a Saúde, vem envolvendo as escolas, academia e serviços de saúde locais no desafio de construir uma sólida relação entre saúde-escola. O presente relato de experiência socializa a trajetória do projeto Educando para a Saúde, uma parceria entre a Equipe de Saúde da Família (ESF de um bairro de Pelotas - RS, a comunidade docente de duas escolas do território e acadêmicos do Programa de Educação pelo Trabalho para a Saúde - PET-Saúde. O objetivo é refletir o papel da ESF e dos acadêmicos do Projeto PET-Saúde na integração saúde-educação. Os temas discutidos são relacionados à educação em sexualidade, direitos sexuais e reprodutivos com ênfase nas DSTs e métodos contraceptivos, prevenção, promoção e recuperação da saúde. A participação do acadêmico nas atividades de integração saúde-educação veio a acrescentar ideias, valores e conceitos, possibilitando a (reconstrução das relações interpessoais, promovendo a reciclagem do processo de trabalho. Pelos laços multiprofissionais e interdisciplinares, essa parceria consiste em aprendizado mútuo, cujos frutos refletem diretamente na melhoria da assistência prestada à comunidade.

  18. Lewis Porter, John Coltrane. Sa vie, sa musique

    OpenAIRE

    Parent, Emmanuel

    2008-01-01

    Les éditions Outre Mesure viennent de mettre à la disposition du lectorat français, avec la qualité de mise en page et en musique qu’on leur connaît, un nouveau livre de référence en musicologie du jazz. Salué à sa sortie par la critique en langue anglaise en 1998, John Coltrane. Sa vie, sa musique constitue en effet un ouvrage fort complet pour qui veut s’immerger dans le langage du heavyweight champion. L’auteur, enseignant à Rutgers (l’université du New Jersey abritant depuis les années 19...

  19. Performance Evaluation Considering Iterations per Phase and SA Temperature in WMN-SA System

    Directory of Open Access Journals (Sweden)

    Shinji Sakamoto

    2014-01-01

    Full Text Available One of the key advantages of Wireless Mesh Networks (WMNs is their importance for providing cost-efficient broadband connectivity. There are issues for achieving the network connectivity and user coverage, which are related with the node placement problem. In this work, we consider Simulated Annealing Algorithm (SA temperature and Iteration per phase for the router node placement problem in WMNs. We want to find the optimal distribution of router nodes in order to provide the best network connectivity and provide the best coverage in a set of Normal distributed clients. From simulation results, we found how to optimize both the size of Giant Component and number of covered mesh clients. When the number of iterations per phase is big, the performance is better in WMN-SA System. From for SA temperature, when SA temperature is 0 and 1, the performance is almost same. When SA temperature is 2 and 3 or more, the performance decrease because there are many kick ups.

  20. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  1. Em busca de uma Teologia Pública da Saúde

    Directory of Open Access Journals (Sweden)

    Alex Villas Boas

    2016-03-01

    Full Text Available A proposta de uma teologia pública da saúde visa o diálogo entre antropologia teológica e antropologias médicas e da saúde de modo a ampliar a percepção da saúde, não somente como fato, mas como valor. Mesmo um Estado Laico, suas tradições religiosas possuem hermenêuticas de saúde, ao interpretar a doença e a morte com razões religiosas distintas, ora conflitantes, ora cooperativas com as ciências da saúde. Ampliar essas hermenêuticas religiosas compondo a sabedoria de vida presente nas expressões religiosas e o conhecimento científico da área de saúde visa uma cooperação para interesses de bem comum da sociedade civil, como é a questão da saúde. Para essa reflexão, a escola de Cós combina a sabedoria mítica asclepíade e a ciência jônia. Os mitos de saúde nomeados no juramento hipocrático pertencem à tradição da teologia poética grega e indica uma espécie de credo no qual a medicina hipocrática professa, no qual o médico além de profissional também possui fé na vida e exerce o ofício de sacerdote da esperança. Interessa ainda o modo como o a teologia da saúde grega foi recebida pela teologia cristã, e como ambas desconstruíram suas teodiceias. Nessa recepção há um caminho para pensar uma teologia pública da saúde. 

  2. Qualidade das informações sobre aleitamento materno e alimentação complementar em sites brasileiros de profissionais de saúde disponíveis na internet The quality of information on maternal breast feeding and complementary feeding on Brazilian internet sites available for health professionals

    Directory of Open Access Journals (Sweden)

    Rosângela Quirino da Silva

    2010-09-01

    Full Text Available OBJETIVOS: analisar as informações de sites da internet sobre o aleitamento materno e alimentação complementar de acordo com a adequação às recomendações do Ministério da Saúde do Brasil. MÉTODOS: realizado estudo transversal, com amostra de 103 sites de profissionais de saúde. Analisaram-se informações sobre aleitamento materno (AM e alimentação complementar (AC. As informações foram quantificadas e analisadas qualitativamente. RESULTADOS: as recomendações relativas ao AM foram: exclusivo até 6º mês (64,1%; sem água e chá (31,1%; duração de dois anos ou mais (36,9%; e não utilizar mamadeira e chupeta (33%. Para a AC foi utilizada a terminologia desmame (30,1%, recomendada a introdução alimentar no 6º mês (47,9%, introdução da primeira papa com fruta (11,6% ou suco (9,7%; e a oferta de sopa (14,6% como refeição. Na análise qualitativa, entre as informações incorretas, constavam recomendações de consumo de carne no 12º mês, horários regulares para refeições, introdução de alimentos no 7º mês e consumo de leite de vaca no 6º mês. CONCLUSÕES: a maior parte das informações sobre aleitamento materno está de acordo com o preconizado pelo Ministério da Saúde, mas são insuficientes para estimular a prática do aleitamento materno. Já as informações sobre alimentação complementar na sua maioria divergem do recomendado.OBJECTIVES: to analyze the information available on internet sites regarding maternal breast feeding and complementary feeding according to the recommendations of the Brazilian Ministry of Health. METHODS: a cross-sectional study was carried out using a sample of 103 sites for professional healthcare workers. Information was analyzed on maternal breast feeding (MB and complementary feeding (CF. The information was quantified and analyzed qualitatively. RESULTS: the recommendations for MB were: that it should be exclusive up to the 6th month of life (64.1%; that no water or tea

  3. IkusaSA. Integrated Assessment for Sustainability

    CSIR Research Space (South Africa)

    Scholes, RJ

    2012-10-01

    Full Text Available , have intended and unintended consequences across a range of important issues. The IkusaSA model system comprises: ? A South African national IAM nested within one or more ?state-of-the-art? global IAMs that predict trade, climate change and human.... The desired outcome is a well-functioning interface between sectors and between technical assessments and policy action. WHAT IS AN INTEGRATED ASSESSMENT MODEL (IAM)? An IAM is a numerical simulation of the dynamic interaction between socio...

  4. Tungo sa Hardin ng Tao: “Si Bonifacio ang pinakauna, hindi lamang sa Pilipinas, kundi sa buong Indonesia, oo, sa buong Asia na nanggaling sa, at edukado bilang, proletaryado, na nag-organisa ng mga proletaryo.” ni Tan Malaka

    Directory of Open Access Journals (Sweden)

    Ramon Guillermo

    2013-06-01

    Full Text Available Salin ito ng sanaysay na “Ke Taman Manusia” (sinulat taong 1943 nakathang-isip ng Indones na lider komunista na si Tan Malaka o Ibrahimgelar Datuk Tan Malaka (1897-1949 hinggil sa isang “Taman Manusia”o “Hardin ng Tao” na itatayo ng darating na Republika ng Indonesia sahinaharap. Dahil sa futuristiko nitong perspektiba, maihahalintuladang obrang ito ni Tan Malaka sa sanaysay ni Jose Rizal na “Filipinasdentro de cien años” (Ang Pilipinas sa loob ng isang dantaon (1891.Galing ito sa napakalaking akdang pilosopikal ni Tan Malaka napinamagatang Madilog: Materialisme, Dialektika, Logika (1948(Larawan 1 at tila tumatayo bilang pansarang mga repleksyon nito(Magnis-Suseno, 2005, pp. 205-233. Ang akdang ito ay unanginilathala noong 1951 ng Terbitan Widjaya sa Jakarta.

  5. “The Smart Peninsula” pilot project of Smart Grid deployment at ENERGA-OPERATOR SA

    Directory of Open Access Journals (Sweden)

    Adam Babś

    2012-03-01

    Full Text Available The article presents the current progress and activities planned in the near future in the implementation of The Smart Peninsula, ENERGA-OPERATOR SA ‘s pilot Smart Grid deployment project. In the three stages of the preparatory work and analysis so far completed a detailed inventory has bee n made of the MV and LV grids covered by the project, a project implementation concept has been developed, as well algorithms of the Smart Grid control, and the algorithms’ simulation model tests have been completed. The preparatory works have been summarised by a project feasibility study. The functionalities and experimental implementation of an island operation involving the EV Władysławowo cogeneration plant have been selected for the deployment, as well as the implementation at ENERGA-TRADE SA of electric vehicle charging power consumption control in DSM/DR programmes.

  6. SignS: a parallelized, open-source, freely available, web-based tool for gene selection and molecular signatures for survival and censored data

    Directory of Open Access Journals (Sweden)

    Diaz-Uriarte Ramon

    2008-01-01

    Full Text Available Abstract Background Censored data are increasingly common in many microarray studies that attempt to relate gene expression to patient survival. Several new methods have been proposed in the last two years. Most of these methods, however, are not available to biomedical researchers, leading to many re-implementations from scratch of ad-hoc, and suboptimal, approaches with survival data. Results We have developed SignS (Signatures for Survival data, an open-source, freely-available, web-based tool and R package for gene selection, building molecular signatures, and prediction with survival data. SignS implements four methods which, according to existing reviews, perform well and, by being of a very different nature, offer complementary approaches. We use parallel computing via MPI, leading to large decreases in user waiting time. Cross-validation is used to asses predictive performance and stability of solutions, the latter an issue of increasing concern given that there are often several solutions with similar predictive performance. Biological interpretation of results is enhanced because genes and signatures in models can be sent to other freely-available on-line tools for examination of PubMed references, GO terms, and KEGG and Reactome pathways of selected genes. Conclusion SignS is the first web-based tool for survival analysis of expression data, and one of the very few with biomedical researchers as target users. SignS is also one of the few bioinformatics web-based applications to extensively use parallelization, including fault tolerance and crash recovery. Because of its combination of methods implemented, usage of parallel computing, code availability, and links to additional data bases, SignS is a unique tool, and will be of immediate relevance to biomedical researchers, biostatisticians and bioinformaticians.

  7. Commercially available antibodies directed against α-adrenergic receptor subtypes and other G protein-coupled receptors with acceptable selectivity in flow cytometry experiments.

    Science.gov (United States)

    Tripathi, Abhishek; Gaponenko, Vadim; Majetschak, Matthias

    2016-02-01

    Several previous reports suggested that many commercially available antibodies directed against G protein-coupled receptors (GPCR) lack sufficient selectivity. Accordingly, it has been proposed that receptor antibodies should be validated by at least one of several criteria, such as testing tissues or cells after knockout or silencing of the corresponding gene. Here, we tested whether 12 commercially available antibodies directed against α-adrenergic receptor (AR) subtypes (α1A/B/D, α2A/B/C), atypical chemokine receptor 3 (ACKR3), and vasopressin receptor 1A (AVPR1A) suffice these criteria. We detected in flow cytometry experiments with human vascular smooth muscle cells that the fluorescence signals from each of these antibodies were reduced by 46 ± 10 %-91 ± 2 % in cells treated with commercially available small interfering RNA (siRNA) specific for each receptor, as compared with cells that were incubated with non-targeting siRNA. The tested antibodies included anti-ACKR3 (R&D Systems, mab42273), for which specificity has previously been demonstrated. Staining with this antibody resulted in 72 ± 5 % reduction of the fluorescence signal after ACKR3 siRNA treatment. Furthermore, staining with anti-α1A-AR (Santa Cruz, sc1477) and anti-ACKR3 (Abcam, ab38089), which have previously been reported to be non-specific, resulted in 70 ± 19 % and 80 ± 4 % loss of the fluorescence signal after α1A-AR and ACKR3 siRNA treatment, respectively. Our findings demonstrate that the tested antibodies show reasonable selectivity for their receptor target under our experimental conditions. Furthermore, our observations suggest that the selectivity of GPCR antibodies depends on the method for which the antibody is employed, the species from which cells/tissues are obtained, and on the type of specimens (cell, tissue/cell homogenate, or section) tested.

  8. Educação em saúde como principal alternativa para promover a saúde do idoso

    Directory of Open Access Journals (Sweden)

    Danielli Gavião Mallmann

    2015-06-01

    Full Text Available Trata-se de uma revisão integrativa que objetivou identificar as evidências científicas sobre as ações educativas em saúde voltadas à promoção da saúde do idoso. A busca dos artigos foi realizada nas bases de dados Medline, Lilacs, BDENF, CINAHL e biblioteca virtual SciELO, por meio do cruzamento dos descritores Educação em Saúde, Idoso, Envelhecimento, Saúde do Idoso, Promoção da Saúde e Qualidade de vida, incluindo-se artigos publicados no período de 2003 a 2013, nos idiomas inglês, espanhol e português, realizados com idosos. Foram selecionados oito artigos, dos quais percebeu-se a qualidade de vida e a promoção do envelhecimento saudável como fatores resultantes das estratégias de educação em saúde. As ações de educação em saúde para idosos necessitam de metodologias que atentem para a complexidade do processo de envelhecimento e relacionem os fatores que cercam o indivíduo, como as crenças, os valores, as normas e os modos de vida.

  9. [Not Available].

    Science.gov (United States)

    Murray, Clinton K; Bennett, Jason W

    2009-01-01

    Malaria's global impact is expansive and includes the extremes of the healthcare system ranging from international travelers returning to nonendemic regions with tertiary referral medical care to residents in hyperendemic regions without access to medical care. Implementation of prompt and accurate diagnosis is needed to curb the expanding global impact of malaria associated with ever-increasing antimalarial drug resistance. Traditionally, malaria is diagnosed using clinical criteria and/or light microscopy even though both strategies are clearly inadequate in many healthcare settings. Hand held immunochromatographic rapid diagnostic tests (RDTs) have been recognized as an ideal alternative method for diagnosing malaria. Numerous malaria RDTs have been developed and are widely available; however, an assortment of issues related to these products have become apparent. This review provides a summary of RDT including effectiveness and strategies to select the ideal RDT in varying healthcare settings.

  10. Change in enrollment patterns, patient selection, and clinical outcomes with the availability of drug-eluting stents in the Bypass Angioplasty Revascularization Investigation 2 Diabetes trial

    Science.gov (United States)

    Shah, Binita; Srinivas, Vankeepuram S.; Lu, Jiang; Brooks, Maria M.; Bates, Eric R.; Nedeljkovic, Zoran S.; Escobedo, Jorge; Das, Gladwin S.; Lopez, John J.; Feit, Frederick

    2013-01-01

    Background In the BARI 2D trial, patients with type 2 diabetes and stable coronary artery disease were randomized to prompt revascularization versus intensive medical therapy (IMT). This analysis sought to evaluate how the availability of drug-eluting stents (DESs) has changed practice and outcomes. Methods In BARI 2D, 1,605 patients were in the percutaneous coronary intervention (PCI)–intended stratum. As DES became available midway through recruitment, we report clinical outcomes among patients who underwent IMT versus prompt PCI with bare-metal stents (BMSs) or DES up to 4 years. Results In North America, after DES became available, selection for the PCI-intended stratum increased from 73% to 79% (P = .003). Fewer BMS than DES patients had total occlusions treated or underwent rotational atherectomy (5.6% vs 9.7%, P = .02, and 1.2% vs 3.7%, P < .01, respectively). Subsequent revascularization (IMT 39%, BMS 29%, DES 21%, P < .01) and target vessel revascularization (BMS 16.1% vs DES 9.6%, P = .03) were lower with DES. Angina at 2 years tended to be less common with DES (IMT 39%, BMS 37%, DES 29%, P = .04, for 3 groups, P = .07 for DES vs BMS). The composite of death, myocardial infarction, or stroke was IMT 16.0%, BMS 20.5%, DES 17.5%; P = .80. Conclusions When DES became available in North America, patients were more likely to be selected into the PCI-intended stratum. Compared with patients receiving BMS, those receiving DES tended to have less target vessel revascularization and angina. PMID:24016502

  11. Saúde mental e trabalho: levantamento das publicações na SCIELO e PEPSIC

    Directory of Open Access Journals (Sweden)

    Maria Célia Bruno Mundim

    2012-01-01

    Full Text Available Considerando-se a importância do tema saúde do trabalhador, o objetivo deste estudo foi o de fazer um levantamento das publicações acerca da saúde mental e trabalho nos periódicos das bases Scielo e PePSIC, sem limitação de período. Foram selecionados 57 trabalhos, nos quais foram levantados os seguintes aspectos: a temática, o período de publicação, setores pesquisados e regiões de publicação. Os resultados indicaram aumento nas publicações sobre o tema nos últimos seis anos e prevalência das pesquisas teóricas seguidas pela empírica qualitativa. Também se verificou que a temática mais pesquisada é a saúde/doença mental, há predominância de publicações na região sudeste e os setores mais pesquisados são da saúde, saúde mental e policial. Concluiu-se que o interesse pelo tema saúde mental e trabalho vêm aumentando, porém há necessidade de mais estudos sobre intervenções e políticas de saúde do trabalhador. Abstract The aim of this study was to conduct a review of publications on mental health and work in Scielo and PePSIC journals, without limitation of time. 57 articles were selected and analyzed regarding methodology, theme, date of publication, surveyed sectors and regions of publication. The results showed an increase in publications on the subject over the past six years and the prevalence of theoretical research followed by the qualitative empirical papers. Also it was found that the prevailing subject is health/mental illness and there are more publications in the Southeast. The sectors more surveyed are health, mental health and police. In conclusion, the interest in mental health and work has increased, but there is a need for further studies on interventions and policies for worker health.

  12. Desenvolvimento econômico, desigualdade e saúde

    Directory of Open Access Journals (Sweden)

    Pedro Reginaldo Prata

    1994-09-01

    Full Text Available O autor se refere a dimensão socioeconômica, individual e coletiva do fenômeno saúde-doença. Refere-se também ao fato das populações estarem sobre a influência desigual de fatores de risco e de proteção à saúde. Discute as desigualdades no desenvolvimento e a relação entre desenvolvimento, riqueza, saúde e justiça social. Questiona as teorias de desenvolvimento econômico, diferenciando desenvolvimento de crescimento. Cunha os conceitos de armadilha do desenvolvimento e refugiados sociais. Define uma comunidade saudável. Propõe a necessidade de mudança no modelo de desenvolvimento. Baliza o papel e as limitações do setor saúde no que diz respeito a iniqüidade social.

  13. Temperature, but not available energy, affects the expression of a sexually selected ultraviolet (UV colour trait in male European green lizards.

    Directory of Open Access Journals (Sweden)

    Katalin Bajer

    Full Text Available BACKGROUND: Colour signals are widely used in intraspecific communication and often linked to individual fitness. The development of some pigment-based (e.g. carotenoids colours is often environment-dependent and costly for the signaller, however, for structural colours (e.g. ultraviolet [UV] this topic is poorly understood, especially in terrestrial ectothermic vertebrates. METHODOLOGY/PRINCIPAL FINDINGS: In a factorial experiment, we studied how available energy and time at elevated body temperature affects the annual expression of the nuptial throat colour patch in male European green lizards (Lacerta viridis after hibernation and before mating season. In this species, there is a female preference for males with high throat UV reflectance, and males with high UV reflectance are more likely to win fights. We found that (i while food shortage decreased lizards' body condition, it did not affect colour development, and (ii the available time for maintaining high body temperature affected the development of UV colour without affecting body condition or other colour traits. CONCLUSIONS/SIGNIFICANCE: Our results demonstrate that the expression of a sexually selected structural colour signal depends on the time at elevated body temperature affecting physiological performance but not on available energy gained from food per se in an ectothermic vertebrate. We suggest that the effect of high ambient temperature on UV colour in male L. viridis makes it an honest signal, because success in acquiring thermally favourable territories and/or effective behavioural thermoregulation can both be linked to individual quality.

  14. DAYA SAING KAKAO INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Anggita Tresliyana

    2015-07-01

    Full Text Available Cocoa is one of the major Indonesian agricultural export products. Cocoa international market has great potential regarding world’s consumption growth, therefore Indonesia is expected to take advantage on existing opportunities. The aims of this study were to analyze the competitiveness of Indonesian cocoa beans and processed cocoa trade in the international market as well as the level of competition between cocoa exporting countries. By using Revealed Comparative Advantage (RCA and Spearman Rank Correlation, it showed that Indonesia had a comparative advantage as an cocoa exporter on the international market, the highest for cocoa beans and the lowest for cocoa paste; Indonesia also had a significant correlation to exporting countries in cocoa beans’ market (Ghana and cocoa paste’s market (Netherlands and Malaysia, the correlation suggests that there were high correlation between Indonesia and the exporting country in competing for market share.Keywords: cocoa, comparative advantage, international trade, competitiveness, market share, RCA ABSTRAKKakao merupakan salah satu komoditas pertanian unggulan ekspor Indonesia.  Pasar kakao memiliki potensi yang besar dilihat dari peningkatan konsumsi dunia, sehingga Indonesia diharapkan dapat memanfaatkan peluang yang ada.  Tujuan penelitian ini adalah menganalisis daya saing perdagangan biji kakao dan kakao olahan Indonesia di pasar internasional serta hubungan daya saing antar negara eksportir kakao. Dengan menggunakan Reavealed Comparative Advantage (RCA, dan Korelasi Rank Spearman, hasil analisis menunjukkan bahwa Indonesia memiliki keunggulan komparatif sebagai eksportir biji kakao dan kakao olahan di pasar internasional, tertinggi untuk biji kakao dan terendah untuk kakao pasta;  Indonesia juga memiliki korelasi yang signifikan di beberapa negara untuk pasar biji kakao (Ghana dan kakao pasta (Belanda dan Malaysia, korelasi tersebut menunjukkan bahwa terdapat hubungan daya saing yang cukup

  15. Perfil de saúde dos trabalhadores de um Centro de Saúde-Escola

    Directory of Open Access Journals (Sweden)

    Nascimento Lucila Castanheira

    2002-01-01

    Full Text Available O estudo buscou descrever o perfil de saúde dos trabalhadores (184 de um Centro de Saúde-Escola de Ribeirão Preto, sob a perspectiva da Promoção de Saúde, modelo epidemiológico de Blum e fatores de risco para doenças crônico-degenerativas. Foi realizado estudo descritivo utilizando-se entrevista estruturada. Concluiu-se que os trabalhadores eram predominantemente do sexo feminino, faixa etária de 35 a 39 anos e escolaridade "superior completo". Dentre os achados, constatou-se que 61,9% tinham sobrepeso e obesidade; a hipertensão foi detectada em 33,1%; 41 (22,3% apresentaram pressão arterial acima do nível da normalidade e a obesidade mostrou-se presente em mais da metade dos indivíduos com pressão arterial alterada. Os dados possibilitaram explorar riscos autocriados para as doenças crônico-degenerativas; identificar fatores relacionados à promoção de saúde e prevenção de doenças e refletir sobre o autocuidado e auto-responsabilidade, visando à qualidade de vida que desfrutarão, em decorrência da transição demográfica e epidemiológica que vivenciamos.

  16. A interdisciplinaridade vivenciada no PET-Saúde = The interdisciplinarity experienced in the PET- Saúde program

    Directory of Open Access Journals (Sweden)

    Assega, Mariana Lieka

    2010-01-01

    Full Text Available Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste em parte integrante e inseparável da saúde do indivíduo. A interação dos profissionais da saúde torna-se possível por meio de iniciativas como o PET-Saúde, o qual fomenta a formação profissional articulada com os profissionais da ESF, bem como, o processo de integração ensino-serviço-comunidade na perspectiva da interdisciplinaridade. Objetivo: Relatar a vivência de estudantes ao realizar uma pesquisa interdisciplinar. Descrição da experiência: Esse relato foi vivenciado no projeto PET-Saúde da Faculdade de Medicina de Marília, no sub projeto Saúde do Homem, visando construir e validar um instrumento de coleta de dados por meio da Técnica Delphi, para auxiliar a equipe de saúde detectar precocemente agravos odontológicos, visto que no Brasil, o perfil de saúde bucal, na faixa etária de 35 a 44 anos, está comprometido. Os participantes, deste estudo, são discentes de enfermagem e medicina, preceptora cirurgiã-dentista e tutora docente enfermeira. Para as atividades educacionais utilizou-se a metodologia ativa de ensino-aprendizagem. Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde

  17. Comparison of availability and offer of controlled physical activities for pupils with disability in selected regions of Czech Republic and United Kingdom

    Directory of Open Access Journals (Sweden)

    Zuzana Kornatovská

    2016-11-01

    Full Text Available Background: The European Union and other countries of the world need quality research data, without which it cannot assess how the overall situation of persons with disabilities develops. Objective: The aim of this paper is to compare the availability of controlled physical activities for pupils with mental disabilities, hearing or visual disabilities in selected regions of the Czech Republic and Great Britain (region of South Bohemia and the region West Midlands. Partial aim is to analyse an offer of the controlled physical activities for this population of pupils. Methods: We used analytical investigative methods (Investigative pentagram. The survey was based on explanation, exploration and direct observation. Another method was a tool "ArcGIS" evaluating the distance of polygons and "packaging zones" by driving times for the EU - Index of availability. After that it was determined the availability of controlled physical activities for pupils with the observed types of disability and evaluated the hypothesis H1. In surveyed regions were also examined ways of organizing a range of offers of controlled physical activities for pupils with disabilities. Results: The range of controlled physical activities was verified higher in the West Midlands region compared to the South Bohemian region. It was found that the British region unlike the South Bohemian region accentuated non-confrontational character of the controlled physical activities with health preventive impact (yoga, swimming and social integration (dancing, walking and hiking. Conclusions: It was verified the hypothesis H1, assuming that the availability of controlled physical activities for pupils with mental disabilities, hearing, visual is significantly higher in the surveyed region of the UK compared to the surveyed region in the Czech Republic.

  18. A Robust Separation Assurance (SA) Architecture Using Integrated Airborne and Ground SA Concepts Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. proposes a robust SA architecture that uses integrated airborne and ground-based SA concepts such that SA functions are switched between...

  19. Cerditos Company S.A.

    OpenAIRE

    2010-01-01

    Esta idea de negocio consiste en la adecuación de una granja, en la cual se desarrollará el proceso de levante y comercialización de carne de cerdo en pie o en canal. Cerditos Company S.A. es una empresa que busca la calidad y el buen servicio, brindando al consumidor garantías de la carne que está consumiendo. En Colombia el mercado ha sido poco explotado comparado con otros países como Chile o Europa, donde el consumo es muy significativo, Cerditos Company S.A. busca aumentar el cons...

  20. The visualization of DHSI based on the relationship model of CL and SA

    Science.gov (United States)

    Wang, Haibo; Guo, Huijuan; Xue, Chengqi

    2013-03-01

    The source and cause of cognitive load (CL) and situation awareness (SA) in digital human-system interface (DHSI) is explained. Based on the analysis of cognitive procedure and the relation of CL and SA, The relationship model of CL and SA in DHSI is put forward. Using the association target and the relationship model of CL and SA, the method and strategy of information visualization of DHSI is presented which is based on the cognitive psychology. Selecting the Boeing 757 autopilot as the case, the comparison of design is shown.

  1. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    Directory of Open Access Journals (Sweden)

    Aline Rodrigues de ALMEIDA

    2016-01-01

    Full Text Available A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorpora o foco na dimensão social das vulnerabilidades. Para promover saúde no Brasil, é indissociável do enfrentamento de uma realidade de iniquidades históricas de grandes proporções que impõem desafios cotidianos não apenas ao setor de saúde, mas a todos aqueles que constroem políticas públicas. A qualidade de vida depende da satisfação das necessidades básicas de todos os cidadãos, propondo uma gestão baseada na solidariedade social, uma visão holística dos problemas e a redução das iniquidades. A promoção da saúde em um país tão desigual como o Brasil propõe um desafio constante aos atores envolvidos no sistema de saúde. A compreensão das iniquidades em saúde para estabelecer uma assistência holística é um processo difícil, mas extremamente relevante para a saúde pública.

  2. Apoio social e saúde entre idosos

    Directory of Open Access Journals (Sweden)

    Ramos Marília P.

    2002-01-01

    Full Text Available O presente artigo trata da relação entre a saúde dos idosos e relacionamentos sociais, bem como na interpretação e entendimento desta problemática sob a luz de dois enfoques teóricos: um macro, centrado na Teoria da Integração Social de Emile Durkheim e outro micro, centrado na Teoria das Trocas, de Peter Blau, com ênfase na Teoria da Eqüidade. A integração social (freqüência de contatos pode ter efeitos negativos na saúde, mas isto tem de ser medido pela qualidade dos contatos. Algumas conclusões apresentadas indicam que as relações sociais têm um efeito na saúde, no sentido de que as pessoas, nas sociedades modernas, esperam a reciprocidade, e, quando isto não é possível, principalmente na fase do envelhecimento, as pessoas sentem-se dependentes, e isso pode afetar a saúde de diferentes maneiras. Por outro lado, quando as pessoas têm problemas de saúde, elas experienciam uma falta de relações sociais balanceadas devido à incapacidade para trocar em bases iguais. Sendo assim, conclui-se que a relação entre relações sociais e saúde na população idosa pode ser uma relação recíproca.

  3. Desigualdade social e saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Neri Marcelo

    2002-01-01

    Full Text Available Esse artigo estuda a relação entre desigualdade social e saúde no Brasil. A estratégia usada foi avaliar as necessidades e o consumo dos serviços de saúde, bem como o acesso a seguro saúde ao longo da distribuição de renda. Adicionalmente, por meio da estimação de uma regressão logística, foram avaliados outros determinantes do consumo dos serviços de saúde, com o intuito de se conhecer aonde e quem utiliza esses serviços no país. Os dados foram extraídos da Pesquisas Nacional de Amostra por Domicilio da Fundação Instituto Brasileiro de Geografia e Estatística levada a campo em 1998. Em geral, observou-se que os indivíduos nos primeiros décimos da distribuição de renda têm pior acesso a seguro saúde, necessitam de maiores cuidados médicos, mas consomem menos os serviços de saúde. As outras características extra rendimento indicam que os principais determinantes para o consumo dos serviços de saúde estariam fortemente associados aos grupos sociais mais privilegiados (de maior escolaridade, acesso a seguro saúde, água, esgoto, luz, coleta de lixo e a fatores que apontam para capacidade de geração de oferta desses serviços no país.

  4. Does diet in lacertid lizards reflect prey availability? Evidence for selective predation in the Aeolian wall lizard, Podarcis raffonei (Mertens, 1952 (Reptilia, Lacertidae

    Directory of Open Access Journals (Sweden)

    Pietro Lo Cascio

    2011-06-01

    Full Text Available In this paper the invertebrate fauna occurring on Scoglio Faraglione, a tiny Aeolian island (AeolianArchipelago, NE Sicily inhabited by a population of the critically endangered lacertid lizard Podarcis raffonei(Mertens, 1952, was censused at different seasons and the resulting data were then compared with dataobtained analysing prey composition and prey abundance in the diet of the lizards occurring on the same islet.The diet of Podarcis raffonei was mainly based on insects and other arthropods. The results indicate that dietcomposition is not directly influenced by prey availability and temporal prey abundance, and that there isstrong evidence indicating selective predation. Lizards prey upon a number of arthropod categories fewer thanthat recorded in field. Some invertebrate taxa (e.g. Diptera and Gastropoda are really less attractive for lizardsand are rarely preyed or not preyed at all despite their spatial and/or temporal abundance. This suggests thatPodarcis raffonei is able to operate a hierarchical choice within the range of prey items constituting its preyspectrum, probably through the ability to discriminate between prey chemicals or visually oriented predation.

  5. Saúde, direito à saúde e justiça sanitária

    Directory of Open Access Journals (Sweden)

    João Arriscado Nunes

    2012-10-01

    Full Text Available Propõe‑se uma abordagem preliminar dos processos heterogéneos e contingentes através dos quais se definem e constituem mutuamente a saúde e o direito à saúde. São apresentadas e discutidas duas manifestações recentes dessa dinâmica. A primeira situa‑se na linha das transformações associadas às orientações de inspiração neoliberal no campo da saúde, apontando para a passagem da saúde como direito à saúde como imperativo, centrado na responsabilização individual e na centralidade da vigilância e da prevenção. A segunda, designada justiça sanitária, é exemplificada através de situações em que cidadãos, através da acção colectiva e mobilizando os vocabulários dos direitos e da justiça, procuram o reconhecimento como portadores de uma doença, os direitos associados a essa condição e a acção pública sobre situações que afectam a sua saúde.

  6. Chacun sa citation

    Directory of Open Access Journals (Sweden)

    Michele Guerra

    2010-12-01

    Full Text Available The quotability of films entails – albeit in different ways – relevant methodological problems both for directors and for scholars. For these reasons, it is important to restrict the range of action of quotations. Moreover, as far as cinema is concerned, it would be suitable to follow Genette’s classification (1982. Through the analysis of some movies from the collective opera Chacun son cinéma (2007 and, specifically, through the examination of films shot by Hou Hsiao-Hsien, Abbas Kiarostami, Jean-Pierre and Luc Dardenne, and Atom Egoyan – this article offers a proposal for the study of some possibilities of quotation in movies.

  7. Saúde oral: um desafio para a equipe de saúde

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Oliveira Gomes

    2001-03-01

    Full Text Available Esta pesquisa teve como objetivo desvelar o conhecimento dos formandos dos cursos de Enfermagem e Medicina de uma Universidade do Rio Grande do Sul acerca da promoção da Saúde Oral. Participaram do estudo 58 acadêmicos, sendo 26 do Curso de Enfermagem e 32 do Curso de Medicina, estes responderam a um questionário com três perguntas semi-estruturadas. Através da triangulação constatamos que esse conhecimento entre os formandos dos referidos cursos é deficitário. Sabemos que é grande a dificuldade de acesso da população infantil carente aos gabinetes dentários, por esse motivo, acreditamos ser indispensável que os profissionais de Enfermagem e Medicina tenham conhecimentos referentes à promoção de saúde oral em crianças.

  8. Psicologia da saúde crítica no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Denis Barros de Carvalho

    Full Text Available O texto apresenta uma discussão sobre a Psicologia da saúde no contexto hospitalar a partir de uma perspectiva histórica e ética, mostrando como o desenvolvimento desse campo foi caracterizado pelo surgimento de duas perspectivas: a Psicologia da saúde tradicional e a Psicologia da saúde crítica. O modelo de quatro abordagens à Psicologia da saúde é apresentado e reformulado com a inclusão do conceito de Psicologia sanitária, e a prática em Psicologia da saúde é discutida à luz do conceito de reflexividade. Por fim, alguns questionamentos derivados da Psicologia da saúde crítica são feitos à prática do psicólogo no contexto hospitalar.

  9. Selective Targeting to Glioma with Nucleic Acid Aptamers.

    Directory of Open Access Journals (Sweden)

    Shraddha Aptekar

    Full Text Available Malignant glioma is characterised by a rapid growth rate and high capacity for invasive infiltration to surrounding brain tissue; hence, diagnosis and treatment is difficult and patient survival is poor. Aptamers contribute a promising and unique technology for the in vitro imaging of live cells and tissues, with a potentially bright future in clinical diagnostics and therapeutics for malignant glioma. The binding selectivity, uptake capacity and binding target of two DNA aptamers, SA43 and SA44, were investigated in glioma cells and patient tissues. The binding assay showed that SA43 and SA44 bound with strong affinity (Kd, 21.56 ± 4.60 nM and Kd, 21.11 ± 3.30 nM respectively to the target U87MG cells. Quantitative analysis by flow cytometry showed that the aptamers were able to actively internalise in U87MG and 1321N1 glioma cells compared to the non-cancerous and non-glioma cell types. Confocal microscopy confirmed staining in the cytoplasm, and co-localisation studies with endoplasmic reticulum, Golgi apparatus and lysosomal markers suggested internalisation and compartmentalisation within the endomembrane system. Both aptamers selectively bound to Ku 70 and Ku 80 DNA repair proteins as determined by aptoprecipitation (AP followed by mass spectrometry analysis and confirmation by Western blot. In addition, aptohistochemical (AHC staining on paraffin embedded, formalin fixed patient tissues revealed that the binding selectivity was significantly higher for SA43 aptamer in glioma tissues (grade I, II, III and IV compared to the non-cancerous tissues, whereas SA44 did not show selectivity towards glioma tissues. The results indicate that SA43 aptamer can differentiate between glioma and non-cancerous cells and tissues and therefore, shows promise for histological diagnosis of glioma.

  10. DAYA SAING TEH INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Fadhilah Ramadhani

    2013-11-01

    Full Text Available Abstrak ___________________________________________________________________ Teh merupakan komoditas sub sektor perkebunan yang pernah mengalami kejayaan selama dua puluh tahun terakhir. Namun dari tahun ke tahun peringkat teh Indonesia di pasar internasional terus mengalami penurunan. Penurunan tersebut dari peringkat ke dua dunia menjadi peringkat ke enam dunia. Hal ini diduga karena lemahnya daya saing produk teh Indonesia di pasar internasional. Adapun tujuan penelitian ini untuk mengkaji perkembangan daya saing teh Indonesia di pasar internasional serta faktor yang mempengaruhi posisi daya saing tesebut. Metode analisis data yang digunakan dalam penelitian ini adalah analisis deskriptif untuk hasil uji Import Dependency Ratio (IDR, Self Sufficiency Ratio (SSR, dan  Revealed Comparative Advantage (RCA. Selanjutnya hasil nilai Revealed Comparative Advantage (RCA akan diregresi dengan metode Ordinary Least Square (OLS.  Berdasarkan hasil uji Import Dependency Ratio (IDR mendapatkan nilai 0 persen hingga 16 persen yang menunjukkan Indonesia tidak mempunyai ketergantungan terhadap produk impor teh. Sedangkan nilai Self Sufficiency Ratio (SSR menunjukkan nilai 280,015 persen, artinya produksi teh Indonesia cukup untuk memenuhi kebutuhan dalam negeri dan ekspor. Dengan nilai daya saing yang cukup kuat, dilihat dari nilai Revealed Comparative Advantage (RCA sebesar 6,790. Hasil uji regresi Ordinary Least Square (OLS terdahap Revealed Comparative Advantage (RCA, menunjukkan kurs rill dan harga riil berpengaruh secara signifikan terhadap posisi daya saing teh indonesia di pasar internasional pada α = 5%. Produksi teh Indonesia tidak berpengaruh terhadap posisi daya saing dengan α = 5%. Abstract ______________________________________________________________ Tea is plantation commodity has been experienced triumph over the last twenty years. But every years ratings Indonesia tea in international markets continues to decline. The decline Indonesia

  11. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  12. Intersetorialidade na política de saúde do idoso

    Directory of Open Access Journals (Sweden)

    Grossi, Patricia Krieger

    2006-01-01

    Full Text Available Este artigo versa sobre a intersetorialidade na política de saúde do idoso. Apresenta uma discussão referente à conceituação e à construção da intersetorialidade. Aborda a saúde do idoso nos aspectos conceituais, legais e no enfrentamento de problemas concretos

  13. Educação Popular e Saúde e democracia no Brasil

    Directory of Open Access Journals (Sweden)

    Eduardo Navarro Stotz

    2014-12-01

    Full Text Available O ensaio se propõe a entender os limites, as possibilidades e os desafios do controle social do Sistema Único de Saúde à luz de uma reflexão sobre a democracia no Brasil com base nas referências da Educação Popular e Saúde.

  14. Data of evolutionary structure change: 1C5SA-1QRZD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dbID> A 1C5SA AHCYK-----SGIQV ...>GGG ----- EEE> ATOM 550 CA ALA A 56 34.816 22.651...QRZD AHCLEKSPRPSSYKV >EGGG EEEe>...DChain>1C5SA SCKSA--YPGQI ure>HHHHH-- ...DChain> VCNRYEFLNGRV >HH > <

  15. Data of evolutionary structure change: 1O2SA-2FOHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1O2SA SLNSG-----YHFCG >EEE ----- EE...ID>2FOH A 2FOHA SLQYRSGSSWAHTCG ...>EEEEEE EEE EEucture> ATOM 123 CA SER A 32 53....yIDChain>1O2SA PVVCS----GKLQG >EEEE ---- EEEE...LHCLVNGQYAVHG >EEEEEE EEEEEEe>

  16. Hydrogen infrastructure within HySA national program in South Africa: road map and specific needs

    CSIR Research Space (South Africa)

    Bessarabov, D

    2012-01-01

    Full Text Available The Department of Science and Technology of South Africa developed the National Hydrogen and Fuel Cells Technologies (HFCT) Research, Development and Innovation Strategy. The National Strategy was branded Hydrogen South Africa (HySA). HySA has been...

  17. Grupo PET-Saúde/Vigilância em Saúde do Trabalhador Portuário: vivência compartilhada

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Ferreira Queiróz

    2015-12-01

    Full Text Available Trata-se de um relato de vivência compartilhada do Grupo PET-Saúde/ Vigilância em Saúde do Trabalhador Portuário, da Universidade Federal de São Paulo – Unifesp e o Centro de Referência em Saúde do Trabalhador – CEREST, de Santos, SP. O objetivo é descrever a experiência desse grupo tutorial e sua contribuição para o fortalecimento de ações de vigilância em saúde do trabalhador de Santos. O trabalho portuário é a temática do PET-Saúde por sua importância no cenário nacional e por sofrer transformações que geram fatores de agravos à saúde dos trabalhadores. As ações são desenvolvidas englobando o CEREST, os serviços da rede de saúde de Santos e a comunidade portuária santista. Observa-se que os participantes têm compartilhado conhecimento teórico e prático profissional, contribuindo nas ações dos trabalhadores do CEREST e apontando na direção de aproximação com a rede básica de atenção à saúde.

  18. Seleção de prioridades para programas de saúde, nutrição e alimentação: um exemplo no estado da Bahia Selection of priorities for health and nutrition programs: an example in the state of Bahia

    Directory of Open Access Journals (Sweden)

    Leonor Maria Pacheco Santos

    2001-08-01

    Full Text Available OBJETIVOS: entre 1996 e 1998 foram implantadas três políticas públicas na área de saúde materno-infantil: Programa de Redução da Mortalidade Infantil (PRMI, Programa Comunidade Solidária (PCS e Incentivo de Combate às Carências Nutricionais (ICCN. Este estudo teve como objetivo comparar a metodologia empregada para selecionar os municípios prioritários nestas três políticas públicas. MÉTODOS: os índices e indicadores estatísticos, bem como as bases de dados que deram origem aos mesmos, as suas variáveis independentes e dependentes e a modelagem estatística, foram analisados a partir de sua descrição nas publicações oficiais. Foi usado como exemplo o estado da Bahia e a construção da base cartográfica ocorreu pela digitalização do contorno dos municípios, diretamente na tela do programa Epi-Map. RESULTADOS: pode-se observar que parâmetros distintos e diferentes bases de dados foram empregados para a construção dos três diferentes índices analisados. Como resultado final dentre os 111 municípios selecionados pelo PRMI, os 96 escolhidos pelo PCS e os 100 considerados prioritários dentro do ICCN, verificou-se que houve superposição em apenas 28. CONCLUSÕES: no caso destas três políticas públicas, implantadas quase simultaneamente no estado da Bahia, envolvendo um volume considerável de recursos, em menos do que 28% dos casos ocorreu o que se pode chamar de focalização e convergência, elementos considerados essenciais para a otimização do investimento dos recursos públicos em políticas sociais.OBJECTIVES: between 1996 and 1998 three public policies in the area of maternal and child health were implemented: Program to Reduce Infant Mortality (PRIM, Community Solidarity Program (CSP and Incentive to Combat Nutritional Deficiencies (ICND. The objective of this study was to compare the methodology used to select priorities and to choose municipalities for these three public policies. METHODS: the indexes

  19. PET-Saúde: micropolítica, formação e o trabalho em saúde

    Directory of Open Access Journals (Sweden)

    Kathleen Tereza da Cruz

    2015-12-01

    Full Text Available O presente artigo analisa os efeitos que podem ser coletados das múltiplas experiências cotidianas vivenciadas pelos tutores/as, preceptores/as e alunos/as participantes do Programa de Educação pelo Trabalho para Saúde (PET-Saúde quando se trata de utilizá-las para se pensarem transformações na micropolítica da formação universitária e no trabalho em saúde. Tem como eixo uma pergunta: O Programa Pet-Saúde, nos seus processos cotidianos, é capaz de produzir efeitos que alargam a matriz de formação que tem como característica principal os processos de ensignação? Mais do que polarizar entre o sim e o não, temos como objetivo colocar em discussão as apostas na formação e atuação do campo da produção do cuidado em saúde, tentando pensar o que têm sido esses campos no âmbito da educação brasileira, e como é possível re-inventar processos de formação que tomam muito mais as desaprendizagens e as potencialidades dos diferentes atores envolvidos.

  20. [Not Available].

    Science.gov (United States)

    1992-03-25

    Archersstar Sudha Bhuchar, right, launches a video on breast screening for women from ethnic minorities, sponsored by the NHS. The video is available in six languages. Ms Bhuchar is pictured with programme co-ordinator Julietta Patrick.

  1. Places available**

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: ACCESS 2000 - niveau 1 : 13 & 14.11.03 (2 jours) C++ for Particle Physicists : 17 – 21.11.03 (6 X 3-hour lectures) Programmation automate Schneider TSX Premium – niveau 2 : 18 – 21.11.03 (4 jours) JAVA 2 Enterprise Edition – Part 1 : WEB Applications : 20 & ...

  2. Relações entre profissionais de saúde e usuários durante as práticas em saúde Relationships between health professionals and users throughout health care practices

    Directory of Open Access Journals (Sweden)

    Maria Denise Schimith

    2011-11-01

    Full Text Available Apresenta-se uma revisão integrativa sobre estudos que abordam as relações entre profissionais de saúde e usuários durante as práticas em saúde. Objetivou-se identificar os aspectos pesquisados no cotidiano dos serviços acerca dessas relações. A coleta foi realizada nas bases Lilacs e Pubmed segundo os descritores: acolhimento; relações profissional-família; relações profissional-paciente; humanização da assistência; e a palavra 'vínculo' associada ao descritor Sistema Único de Saúde. Selecionaram-se 290 estudos publicados entre 1990 e 2010. Por meio da análise temática, foram criados cinco núcleos de sentido: a relevância da confiança na relação profissional-usuário; sentimentos e sentidos na prática do cuidado; a importância da comunicação nos serviços de saúde; modo de organização das práticas em saúde; e (descolonialismo. Identificou-se que as relações estabelecidas nas práticas de saúde têm uma dimensão transformadora. No entanto, permanece o desafio de humanizar os serviços de saúde. A enfermagem se destaca na produção do conhecimento nessa temática.This article presents an integrative review about studies that address the relationships between health professionals and users in health care practices. It aimed to identify aspects that were researched on the daily life of the services concerning such relationships. Data were collected from the Lilacs and Pubmed databases based on these descriptors: user embracement; professionalfamily relations; professionalpatient relations; humanization of the care; and the bonding word associated to the Single Health System descriptor. Two hundred and ninety studies, published from 1990 to 2010, were selected. Through thematic analyses, five meaning cores were created: the relevance of the confidence in the professionaluser relationship; feelings and senses in the health care practice; the importance of communications in health care services; ways to

  3. Places available

    CERN Multimedia

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Places available The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses : Introduction à Outlook : 19.8.2004 (1 journée) Outlook (short course I) : E-mail : 31.8.2004 (2 hours, morning) Outlook (short course II) : Calendar, Tasks and Notes : 31.8.2004 (2 hours, afternoon) Instructor-led WBTechT Study or Follow-up for Microsoft Applications : 7.9.2004 (morning) Outlook (short course III) : Meetings and Delegation : 7.9.2004 (2 hours, afternoon) Introduction ...

  4. [Not Available].

    Science.gov (United States)

    Asfari, Hadyl; Bousquet, Cédric; Paviot, Béatrice Trombert; Bellet, Florelle; Mounier, Geneviève; Marsille, Fakhria; Beyens, Marie-Noëlle; Guy, Claire

    2014-01-01

    To evaluate the value of research in the case-mix database to identify cases of drug-related anaphylactic or anaphylactoid shock. Hospital stays of patients discharged from the University Hospital of Saint-Étienne between July 1st 2009 and June 30th 2012. Five codes from the international classification of diseases were selected: T88.6, T88.2, J39.3, T80.5 and T78.2. Among 89 cases identified by the programme for medicalization of information system (programme de médicalisation des systèmes d'information, PMSI), 40 were selected (45%). Of these, 16 cases were spontaneously reported by physicians. The unspecific code "anaphylactic shock unspecified (T78.2)" was coded for 57.5% of cases. The study confirms the interest of the PMSI as a tool for health monitoring, in addition to spontaneous reporting. Nevertheless, coding with insufficient precision about the causal role of the drug, requires a return to the medical record and so an important time consuming process. Copyright © 2014 Société Française de Pharmacologie et de Thérapeutique. Publié par Elsevier Masson SAS.

  5. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: C++ Programming Level 2 - Traps & Pitfalls:  16 - 19.7.02 (4 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Technical Training Monique Duval Tel.74924 monique.duval@cern.ch

  6. Places available**

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval Tel. 74924technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: MATLAB Fundamentals and Programming Techniques (ML01) : 2 & 3.12.03 (2 days) Oracle 8i : SQL : 3 - 5.12.03 (3 days) The EDMS MTF in practice : 5.12.03 (afternoon, free of charge) Modeling Dynamic Systems with Simulink (SL01) : 8 & 9.12.03 (2 days) Signal Processing with MATLAB (SG01) : 11 & 12.12.03 (2 days) The JAVA Programming Language - l...

  7. Places available**

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval Tel. 74924 technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: JAVA 2 Enterprise Edition - Part 1 : WEB Applications : 20 & 21.11.03(2 days) FrontPage 2000 - niveau 1 : 20 & 21.11.03 (2 jours) Oracle 8i : SQL : 3 - 5.12.03 (3 days) Oracle 8i : Programming with PL/SQL : 8 - 10.12.03 (3 days) The JAVA Programming Language - leve...

  8. Places available**

    CERN Multimedia

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: The JAVA Programming Language Level 1 :9 & 10.1.2004 (2 days) The JAVA Programming Language Level 2 : 11 to 13.1.2004 (3 days) Hands-on Introduction to Python Programming : 16 - 18.2.2004 (3 days - free of charge) CLEAN-2002 : Working in a Cleanroom : 10.3.2004 (afternoon - free of charge) C++ for Particle Physicists : 8 - 12.3.2004...

  9. Places available**

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses : EXCEL 2000 - niveau 1 : 20 & 22.10.03 (2 jours) CLEAN-2002 : Working in a Cleanroom (free of charge) : 23.10.03 (half day) The EDMS-MTF in practice (free of charge) :  28 -  30.10.03 (6 half-day sessions) AutoCAD 2002 - Level 1 : 3, 4, 12, 13.11.03 (4 days) LabVIEW TestStand ver. 3 : 4 & 5.11.03 (2 days) Introduction to Pspice : 4.11.03 p.m. (half-day) Hands-on Introduction to Python Programm...

  10. Places available**

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: MATLAB Fundamentals and Programming Techniques (ML01) :2 & 3.12.03 (2 days) Oracle 8i : SQL : 3 - 5.12.03 (3 days) The EDMS MTF in practice : 5.12.03 (afternoon, free of charge) Modeling Dynamic Systems with Simulink (SL01) : 8 & 9.12.03 (2 days) Signal Processing with MATLAB (SG01) : 11 & ...

  11. Places available**

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: Project Planning with MS-Project : 15 & 22.1.2004 (2 days) Joint PVSS JCOP Framework Course : 2 sessions : 2 - 6.2.2004 and 16 - 20-2-2004 (5 days) Hands-on Introduction to Python Programming : 16 - 18.2.2004 (3 days - free of charge) C++ for Particle Physicists : 8 - 12.3.2004 ( 6 X 4-hour sessions)

  12. Places available**

    CERN Multimedia

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt.TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch ** The number of places available may vary. Please check our Web site to find out the current availability. Places are available in the following courses: The JAVA Programming Language Level 1 : 9 & 10.1.2004 (2 days) The JAVA Programming Language Level 2 : 11 to 13.1.2004 (3 days) LabVIEW base 1 : 25 - 27.2.2004 (3 jours) CLEAN-2002 : Working in a Cleanroom : 10.3.2004 (afternoon - free of charge) C++ for Particle Physicists : 8 - 12.3.2004 ( 6 X 4-hour sessions) LabVIEW Basics 1 : 22 - 24.3.20...

  13. [Not Available].

    Science.gov (United States)

    Mokeddem, Diab; Khellaf, Abdelhafid

    2009-01-01

    Optimal design problem are widely known by their multiple performance measures that are often competing with each other. In this paper, an optimal multiproduct batch chemical plant design is presented. The design is firstly formulated as a multiobjective optimization problem, to be solved using the well suited non dominating sorting genetic algorithm (NSGA-II). The NSGA-II have capability to achieve fine tuning of variables in determining a set of non dominating solutions distributed along the Pareto front in a single run of the algorithm. The NSGA-II ability to identify a set of optimal solutions provides the decision-maker DM with a complete picture of the optimal solution space to gain better and appropriate choices. Then an outranking with PROMETHEE II helps the decision-maker to finalize the selection of a best compromise. The effectiveness of NSGA-II method with multiojective optimization problem is illustrated through two carefully referenced examples.

  14. Saúde do homem e masculinidades na Política Nacional de Atenção Integral à Saúde do Homem: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Marco Antonio Separavich

    2013-06-01

    Full Text Available Este artigo, orientado pela teoria do gênero sobre masculinidades, revisa os textos que trataram do tema nos periódicos de Saúde Coletiva/Saúde Pública no período de 2005-2011. Os eixos temáticos encontrados coincidem com as prioridades conferidas pela Política Nacional de Atenção Integral à Saúde do Homem, criada pelo Ministério da Saúde em 2008. São eles: o acesso dos homens aos serviços de saúde, sexualidade, saúde reprodutiva, violência e os principais agravos à saúde masculina, contextualizados à luz dos determinantes sociais da saúde. Tais determinantes se baseiam em um tipo de masculinidade tradicional concebida como hegemônica, que apesar de comprometer a saúde masculina, não é o tipo único de masculinidade existente na sociedade. As diferentes masculinidades encontram-se imbricadas no processo saúde/doença vivido pelos homens. Elas devem ser consideradas na busca da adesão dos homens aos serviços de saúde.

  15. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Garcia Eloi S.

    1995-01-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  16. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  17. Sindicalismo, SUS e planos de saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    Full Text Available Este artigo discute a interlocução do sindicalismo brasileiro com o Sistema Único de Saúde (SUS e os planos e seguros privados de saúde. São ponderadas algumas teses na Saúde Coletiva à luz de estudos mais recentes nas Ciências Sociais sobre o sindicalismo e realizada análise documental para o caso da Central Única dos Trabalhadores (CUT, tomado aqui como referência. Aponta-se a necessidade de considerar os pesos relativos que a ação sindical atribuiu a cada um dos aspectos da relação, SUS e planos privados de saúde, pelas distintas conjunturas do país. O conflito entre trabalhadores e empresas somado ao desemprego e à precarização do trabalho expõe os limites das coberturas assistenciais privadas e impele a representação sindical a pleitear a intervenção estatal. O trabalho refletiu sobre as distintas modalidades de ação sindical na empresa e no Estado. A complexidade dessa dinâmica fez emergir um setor sindical interessado na gestão da previdência complementar e dos planos de saúde e, ao mesmo tempo, recria as circunstâncias e traz novas possibilidades de as organizações sindicais se colocarem na cena política e aglutinar os interesses de amplos segmentos dos trabalhadores para pressionar o Estado na defesa da melhoria do sistema público de saúde.

  18. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: C++ Programming Level 2 - Traps & Pitfalls:  16 - 19.7.02 (4 days) Frontpage 2000 - level 1 :  22 - 23.7.02  (2 days) Introduction à Windows 2000 au CERN : 24.7.02 (après-midi) CLEAN-2002 : Travailler en salle blanche (cours gratuit) : 13.08.2002 (matin) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Technical Training Monique Duval Tel.74924 monique.duval@cern.ch

  19. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: December 2002   PCAD Schémas - Débutants :  5 & 6.12.02  (2 jours) PCAD PCB - Débutants :  9 - 11.12.02  (3 jours) FrontPage 2000 - level 1:  9 & 10.12.02  (2 days) Introduction à la CAO Cadence (cours gratuit) :  10 & 11.12.02  (2 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Technical Training Monique Duval Tel.74924 monique.duval@cern.ch

  20. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: CLEAN-2002 : Travailler en salle blanche (cours gratuit) : 13.08.2002 (matin) Introduction to the CERN Enginnering Data Management System :  27.8.02  (1 day) The CERN Engineering Data Management System for Advanced Users :  28.8.02  (1 day) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Technical Training Monique Duval Tel.74924 monique.duval@cern.ch    

  1. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Introduction to Databases :  3 - 4.7.01 (2 days) The JAVA programming language Level 2 : 4 - 6.7.01 (3 days) Enterprise JavaBeans :  9 - 11.7.01 (3 days) Design Patterns :  10 - 12.7.01 (3 days) C++ for Particle Physicists :  23 - 27.7.01 (6 3-hour lectures) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt.

  2. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Introduction to Perl 5 : 2 - 3.7.01 (2 days) Introduction to Databases :  3 - 4.7.01 (2 days) JAVA programming language Level 2 : 4 - 6.7.01 (3 days) Enterprise JavaBeans :  9 - 11.7.01 (3 days) Design Patterns :  10 - 12.7.01 (3 days) C++ for Particle Physicists :  23 - 27.7.01 (6 3-hour lectures) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt.

  3. Tumor imaging with 2 sigma-receptor ligands, F-18-FE-SA5845 and C-11-SA4503 : A feasibility study

    NARCIS (Netherlands)

    van Waarde, A; Buursma, AR; Hospers, GAP; Kawamura, K; Kobayashi, T; Ishii, K; Oda, K; Ishiwata, K; Vaalburg, W; Elsinga, PH

    2004-01-01

    Our objective was to study 2 radioligands for visualization of sigma-receptors with PET. Methods: Two radioligands--sigma(1)-selective C-11-1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine (C-11-SA4503) and nonsubtype-selective 1-(4-2'-F-18-fluoroethoxy-3-methoxyphenethyl)-4-(3-(4-fluoropheny

  4. Whole Genome Comparison of Thermus sp. NMX2.A1 Reveals Principle Carbon Metabolism Differences with Closest Relation Thermus scotoductus SA-01

    Directory of Open Access Journals (Sweden)

    Walter J. Müller

    2016-09-01

    Full Text Available Genome sequencing of the yellow-pigmented, thermophilic bacterium Thermus sp. NMX2.A1 resulted in a 2.29 Mb draft genome that encodes for 2312 proteins. The genetic relationship between various strains from the genus Thermus was assessed based on phylogenomic analyses using a concatenated set of conserved proteins. The resulting phylogenetic tree illustrated that Thermus sp. NMX2 A.1 clusters together with Thermus scotoductus SA-01, despite being isolated from vastly different geographical locations. The close evolutionary relationship and metabolic parallels between the two strains has previously been recognized; however, neither strain’s genome data were available at that point in time. Genomic comparison of the Thermus sp. NMX2.A1 and T. scotoductus SA-01, as well as other closely related Thermus strains, revealed a high degree of synteny at both the genomic and proteomic level, with processes such as denitrification and natural cell competence appearing to be conserved. However, despite this high level of similarity, analysis revealed a complete, putative Calvin–Benson–Bassham (CBB cycle in NMX2.A1 that is absent in SA-01. Analysis of horizontally transferred gene islands provide evidence that NMX2 selected these genes due to pressure from its HCO3- rich environment, which is in stark contrast to that of the deep subsurface isolated SA-01.

  5. PRODUCTIVITY AND QUALITY: A STRATEGY FOR THE SA DEFENCE FORCE

    Directory of Open Access Journals (Sweden)

    R. Eberlein

    2012-02-01

    Full Text Available In recent times the SA Defence Force (SADF has been bombarded with a variety of methods and approaches to the improvement of productivity, financial savings and, most recently, for quality of work life or quality assurance. Various approaches have included the concepts of Total Quality Management (TQM, Quality Circles (and variants in the guise of Triads and others, Methodology, Unit Management Systems, Cost Control Systems, Deterministic Productivity Accounting and the Iike. There have been many benefits to be found in these various approaches, each of which concentrates on certain aspects of productivity. That there have been great achievements in productivity in the SADF is a matter of record, a record which is reflected in a National Award for Productivity, a smaller more efficient SADF, and a reputation for submitting more recommendations for improvements than other departments in the Public Service. At a more personal level though, the writer has gained the impression that no or very little attempt has been made to integrate selected aspects of these approaches into an overall "productivity” strategy acceptable to the SADF. That there is a need for such an overall strategy is clear from the sentiments expressed recently by the members of the SADF's Productivity Co-ordination Committee when attempting to indicate the way ahead to even greater productivity in the SADF (Meeting, January 1991. In this paper a strategy for the improvement of productivity and the quality of work life which is acceptable to the SADF is proposed.

  6. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: Conception de PCB rapides dans le flot Cadence : 11.6.03 (matin) EXCEL 2000 - level 1 : 12 & 13.6.03 (2 days) Introduction to PVSS : 16.6.03 (p.m.) Basic PVSS : 17 - 19.6.03 (3 days) Réalisation de PCB rapides dans le flot Cadence : 17.6.03 (matin) PVSS - JCOP Framework Tutorial : 20.6.03 (1 day) Programmation automate Schneider : Programmation automate Schneider TSX Premium - 2ème niveau : 24 - 27.6.03 (4 jours) - audience : toute personne qui veux maitriser la mise en uvre et la programmation des fonctions spécialisées d'un automate TSX Premium - objectifs : maitriser la mise en uvre et la programmation des fonctions spécialisées d'un automate TSX Premium Cours de sécurité : Etre TSO au CERN : Prochaines sessions : 24, 25 & 27.6.03 - 4, 5 & 7.11.03 (session de 3 jours) ** The number of places available may vary. Please check our Web site to find out the current availability. If you wish to participate in one of these courses, pl...

  7. Ressignificando Promoção de Saúde em Grupos para Profissionais da Saúde

    Directory of Open Access Journals (Sweden)

    Siegrid Kurzawa Zwiener dos Santos

    Full Text Available RESUMO Diferenças entre os conceitos de promoção e prevenção não estão claras para parte dos profissionais de saúde, incluindo médicos e estudantes de Medicina. Este trabalho objetivou problematizar o conceito de grupos de promoção de saúde para contribuir com o desenvolvimento da autonomia de profissionais de modo a avaliarem criticamente a maneira como vinham realizando educação em saúde e a refletirem sobre novas práticas. Foram realizados seis encontros no formato de círculos de cultura com profissionais da Estratégia Saúde da Família (ESF. Após esse trabalho, o grupo compreendeu a diferença entre promoção e prevenção. Promoção foi entendida como abordagem de condições de vida, cidadania, moradia, dinâmica familiar, como um processo que capacita para enfrentamentos, desenvolvimento do afeto, da discussão, do ouvir, do aceitar, do opinar e do oferecer. Os profissionais concluíram que é necessário desenvolver a autonomia dos grupos e indivíduos, ouvir a comunidade para compreender suas necessidades, resgatar o saber que a população possui e ver a saúde como um todo. Fatores biológicos foram relacionados à prevenção, e os sociais e psicológicos à promoção. O grupo é um instrumento importante para a promoção de saúde e deve ter uma metodologia problematizadora.

  8. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: The CERN Engineering Data Management System for Advanced users :  13.6.02  (1 day) The CERN Engineering Data Management System for Local Administrators :  18.6.02  (1 day) AutoCAD 2002 - niveau 2 : 24 - 25.6.02 (2 jours) Frontpage 2000 - niveau 2 : 25 - 26.6.02 (2 jours) Object-oriented Analysis and Design :  2 - 5.7.02  (4 days) C++ Programming Level 2 - Traps & Pitfalls :  16 - 19.7.02  (4 days) C++ for Particle Physicists :  22 - 26.7.02  (6 * 3 hour lectures) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of the...

  9. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: LabView Hands-on (bilingue/bilingual - gratuit/free of charge) : 13.9.02 (a.m.) LabView DAQ Hands-on (bilingue/bilingual - gratuit/free of charge) : 13.9.02 (p.m.) AutoCAD 2002 - niveau 1 : 19, 20, 26, 27.9.02 (4 jours) LabView Base 1 : 23 - 25.9.02 (3 jours) LabView DAQ (E) : 26 - 27.9.02 (2 days) AutoCAD Mechanical 6 PowerPack (F) : 30.9, 1, 2, 9, 10, 11.10.02 (6 jours) CLEAN-2002 : Working in a Cleanroom (free of charge) : 10.10.02 (half-day, p.m.) AutoCAD 2002 - niveau 2 : 14 - 15.10.02 (2 jours) AutoCAD 2002 - Level 1 : 17, 18, 24, 25.10.02 (4 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Of...

  10. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Utilisation du simulateur Simplorer : 30.5 - 1.6.01 (3 jours) JAVA programming language level 1: 11-12.6.01 (2 days) LabView hands-on F ou E : 11.6.01 (1/2 journée) Comprehensive VHDL for EPLD/FPGA Design : 11 - 15.6.01 (5 days) Introduction au Langage C : 13 - 15.6.01 (3 jours) LabView Base 1 : 12 - 14.6.01 (3 jours) Habilitation électrique : superviseurs : 2 sessions d'une demi-journée les 12 et 19.6.01 Migration de LabVIEW 5 vers LabVIEW 6i Migration from LabVIEW 5 to LabVIEW 6I :  15.6.01 (1/2 journée/half-day) Introduction to Perl 5 : 2 - 3.7.01 (2 days) JAVA programming language level 2 : 4 - 6.7.01 (3 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : http://www.cern.ch/Training/ or fill in an 'application for training' form available from ...

  11. PLACES AVAILABLES

    CERN Document Server

    Technical Training; Tel. 74924

    2000-01-01

    Places are available in the following courses:   C++ for Particle Physicists 20 - 24.11.00 6 lectures CANbus 20.11.00 1 journée CANopen 21 et 22.11.00 2 jours Sécutiré dans les installations cryogéniques 21 et 22.11.00 2 demi-journées The JAVA programming language level 2 27 ­ 29.11.00 3 days Contract Follow-up 27.11.00 3 heures 1/2 Cryogénie (introduction) 4 ­ 8.12.00 ANSYS Introduction : langue a décider suivant majorité 5 ­ 7.12.00 3 jours EXCEL 7, 8, 13 et 14.12.00 4 jours Contract Follow-up 15.12.00 3 heures 1/2 If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : http://www.cern.ch/Training/ or fill in an “application for training” form available from your Divisional Secretariat or from your DTO (Divisional Training Officer)....

  12. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Habilitation électrique : recyclage HT/BT : 11 - 15.3.2002  (2 * 2 heures) PVSS Basics :  8 - 12.4.02  (5 days) ELEC-2002 : Spring Term :  9, 11, 16, 18, 23, 25, 30.4.02 (7 * 2.5 hours) LabVIEW base 1 : 22 - 24.4.02 (3 jours) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) LabVIEW Basics 2 : 13 & 14.5.02 (2 days) LabVIEW DAQ (F) : 15 & 16.5.02 (2 jours) Cours sur la migration AutoCAD :   AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applica...

  13. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel 74924

    2002-01-01

    Places are available in the following courses: LabView hands-on : 21.01.02 (1/2 journée) LabView DAQ hands-on : 21.01.02 (1/2 journée) FileMaker Pro : 22 - 25.1.02 (4 jours) MS-Project 2000 : 24 & 25.01.02 (2 jours) Introduction au PC et à Windows 2000 au CERN : 29 - 30.1.02 (2 jours) LabView Base 1 : 4 - 6.2.02 (3 jours) LabView DAQ (E) : 7 & 8.02.02 (2 days) Hands-on Object-Oriented Design & Programming with Java : 11 - 13.02.02 (3 days) C++ for Particle Physicists : 11 - 15.3.2002 (6 * 3 hour lectures) Cours sur la migration AutoCAD : AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO ...

  14. PLACES AVAILABLES

    CERN Multimedia

    Enseignement Technique; Tél. 74924; monique.duval@cern.ch

    2000-01-01

    Places are available in the following courses: LabView hands-on : 13.11.00 (4 hours) LabView Basics 1 : 14 ­ 16.11.00 (3 days) Nouveautés de WORD : 19 et 20.10.00 (2 jours) ACCESS 1er niveau : 30 ­ 31.10.00 (2 jours) Advanced C programming : 2 ­ 3.11.00 (2 days) Introduction à PowerPoint : 6.11.00 (1 journée) C++ for Particle Physicists : 20 ­ 24.11.00 (12 hours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : http://www.cern.ch/Training/ or fill in an “application for training” form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt.

  15. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: PVSS basics :  18 - 22.2.02 (5 days) Introduction à la CAO CADENCE : 20 & 21.2.02 (2 jours) LabView Basics 1 :  4 - 6.3.02  (3 days) Introduction au VHDL et utilisation du simulateur de CADENCE : 6 & 7.3.02 (2 jours) LabView Base 2 : 11 & 12.3.02 (2 jours) C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) LabView Advanced :  13 - 15.3.02 (3 days) Cours sur la migration AutoCAD :   AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO...

  16. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Introduction à la CAO CADENCE : 20 & 21.2.02 (2 jours) LabView Basics 1 :  4 - 6.3.02  (3 days) Introduction au VHDL et utilisation du simulateur de CADENCE : 6 & 7.3.02 (2 jours) CLEAN-2002 : Working in a Clean Room :  7.3.2002  (1 day) LabView Base 2 : 11 & 12.3.02 (2 jours) C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) LabView Advanced :  13 - 15.3.02 (3 days) Cours sur la migration AutoCAD :   AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisiona...

  17. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: Hands-on Introduction to Python Programming: 11-13.08.2003(3 days) Introduction to the CERN Engineering Data Management System (EDMS): 26.08.2003 (1 day) The CERN Engineering Data Management System (EDMS) for Engineers: 27.08.2003 (1 day) CLEAN-2002 : Travailler en salle blanche : 4.09.2003 (une demi-journée) AutoCAD 2002 - Level 1: 4, 5, 15, 16.09.2003 (2 x 2 days) AutoCAD Mechanical 6 PowerPack : 17, 18, 25, 26.09.2003 et 2, 3.10.2003 (3 x 2 journées, français) AutoCAD 2002 - niveau 1 : 23, 24, 30.09.2003 et 1.10.2003 (2 x 2 journées) Introduction to the CERN Engineering Data Management System (EDMS): 23.09.2003 (1 day) The CERN Engineering Data Management System (EDMS) for Local Administrators: 24-25.09.2003 (2 days) AutoCAD 2002 - niveau 2 : 8 et 10.10.2003 (2 journées) CLEAN-2002: Working in a Cleanroom: 23.10.2003 (half day, p.m.) ** The number of places available may vary. Please ch...

  18. Places available**

    CERN Multimedia

    Places are available in the following courses: Hands-on Introduction to Python Programming: 11-13.08.2003 (3 days) Introduction to the CERN Engineering Data Management System (EDMS): 26.08.2003 (1 day) The CERN Engineering Data Management System (EDMS) for Engineers: 27.08.2003 (1 day) CLEAN-2002 : Travailler en salle blanche : 4.09.2003 (une demi-journée) AutoCAD 2002 - Level 1: 4, 5, 15, 16.09.2003 (2 x 2 days) AutoCAD Mechanical 6 PowerPack : 17, 18, 25, 26.09.2003 et 2, 3.10.2003 (3 x 2 journées, français) AutoCAD 2002 - niveau 1 : 23, 24, 30.09.2003 et 1.10.2003 (2 x 2 journées) Introduction to the CERN Engineering Data Management System (EDMS): 23.09.2003 (1 day) The CERN Engineering Data Management System (EDMS) for Local Administrators: 24-25.09.2003 (2 days) AutoCAD 2002 - niveau 2 : 8 et 10.10.2003 (2 journées) CLEAN-2002: Working in a Cleanroom: 23.10.2003 (half day, p.m.) ** The number of places available may vary. Please check our Web site to find out the current availabili...

  19. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: November 2002   Java Programming Language level 1 :  28 & 29.11.02  (2 days) December 2002   LabVIEW - DSC (English) :  2 - 3.12.02  (2 days) FileMaker (Français) :  2 - 5.12.02  (4 jours) PCAD Schémas - Débutants :  5 & 6.12.02  (2 jours) PCAD PCB - Débutants :  9 - 11.12.02  (3 jours) FrontPage 2000 - level 1:  9 & 10.12.02  (2 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Technical Training M...

  20. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: November 2002   Hands-on Object-Oriented Design and Programming with C++:  19 - 21.11.02  (3 days)  December 2002   LabVIEW - DSC (English) :  2 - 3.12.02  (2 days) AutoCAD 2002 - niveau 2 :  2 & 3.12.02  (2 jours) FileMaker (Français) :  2 - 5.12.02  (4 jours) PCAD Schémas - Débutants :  5 & 6.12.02  (2 jours) PCAD PCB - Débutants :  9 - 11.12.02  (3 jours) FrontPage 2000 - level 1:  9 & 10.12.02  (2 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisiona...

  1. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74460

    2001-01-01

    Places are available in the following courses: LabView Base 1 : 27-29.3.01 (3 jours) Contract Follow-up : 9.4.01 (3 heures) Introduction à PowerPoint : 24.4.01 (1 journée) Publier sur le Web : 25-27.4.01 (3 demi-journées) Programmation TSX Premium 2 : 15-16.5.01 (5 jours) LabView Base 2 : 27-29.3.01 (2 jours) Hands-on Object-oriented Analysis, Design & Programming with C++ :  23-27.4.01 (5 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt.

  2. [Not Available].

    Science.gov (United States)

    Huguier, Michel; Romestaing, Patrick

    2014-10-01

    In France, the number of students admitted to the second year of medical studies is limited (numerus clausus) by law. In 1971 this limit was first based according to hospital training capacity and subsequently 1979 it has been based on demographic trends. An objective of 250 physicians per 100 000 inhabitants seemed reasonable and required 6 000 students to be trained each year. In 1979, it was decided to restrict the number of students temporarily because of a likely demographic slump after the year 2000. These steps were introduced progressively, in order not to unfairly treat a particular student class. The numerus clausus is also modulated geographically to take into account differences in medical density, as most students set up in the region where they did their medical studies. It is logical to practice preselection for admission to medical school, yet in France every baccalaureat holder can enrol any medical school, and students are totally opposed to preselection. This is why selection takes place at the end of the first year. In the late 1980s, the numerus clausus should have been increased by the health and education ministries, but this was in fact done only ten years later. Estimates of medical demography are complicated by three factors. First, many physicians from European Union member states (mainly Belgium and Romania) practice in France. Second, some students not admitted to the second year of medical studies go to learn medicine in aforeign country before returning to sit the French national examination at the end of the sixth year. Third, public hospitals hire foreign physicians from outside the EU (mainly Algeria and Morocco), who then stay in France permanently. Thus, EU-level decisions are needed to harmonize the medical numerus clausus across member states. The hiring of physicians from non EU countries by French hospitals should be more tightly controlled.

  3. [Not Available].

    Science.gov (United States)

    Blanchard, Elodie; de Lara, Manuel Tunon

    2013-01-01

    Pholcodine is an opioid that has been widely used worldwide since 1950 for the treatment of non-productive cough in children and adults. The results of early preclinical studies but also those of recent clinical trials have shown the antitussive efficacy of pholcodine to be superior to that of codeine, of longer duration, and with an equivalent or safer toxicity profile. Also, there is no risk of addiction. Concern had been raised over a possible cross-sensitisation with neuromuscular blocking agents. While a recent assessment of the available data by the European Medicines Agency (EMA) has confirmed the favourable risk-benefit ratio of pholcodine, further studies are needed to clear this point.

  4. Spatiotemporal Changes in Atmospheric Deposition Rates Across The Czech Republic Estimated in The Selected Biomonitoring Campaigns. Examples of Results Available For Landscape Ecology and Land Use Planning

    Directory of Open Access Journals (Sweden)

    Suchara Ivan

    2015-11-01

    Full Text Available Several large-scale and fine-scale biomonitoring surveys were carried out in the Czech Republic to estimate current and long-term accumulated atmospheric deposition rates using moss, spruce bark and forest floor humus as bioindicators since the end of 1980s. The results of the bioindicator analyses significantly correlated with available figures of deposition rates detected at the EMEP or Czech national measurement stations.

  5. Technical training - Places available

    CERN Multimedia

    2003-01-01

    * Etant donné le délai d'impression du Bulletin, ces places peuvent ne plus être disponibles au moment de sa parution. Veuillez consulter notre site Web pour avoir la dernière mise à jour. ** The number of places available may vary. Please check our Web site to find out the current availability. Des places sont disponibles dans les cours suivants : Places are available in the following courses: Hands-on Introduction to Python Programming 12 – 14.11.03 (3 days) ACCESS 2000 – niveau 1 13 & 14.11.03 (2 jours) C++ for Particle Physicists 17 – 21.11.03 (6 x 3-hour lectures) Programmation automate Schneider TSX Premium – niveau 2  18 – 21.11.03 (4 jours) Planification de projet avec MS-Project/Project Planning with MS-Project (gratuit/free of charge – langue à définir/language to be defined) : 18 & 25.11.03 (2 jours/2 days) JAVA 2 Enterprise Edition – Part 1 : WEB...

  6. Percepção do processo saúde-doença: significados e valores da educação em saúde

    Directory of Open Access Journals (Sweden)

    Ana Maria Chagas Sette Câmara

    Full Text Available A relevância sociológica do estudo das representações sociais do processo saúde-doença está no fato de que elas fundamentam práticas e atitudes dos seus atores, assim como as relações que eles estabelecem com o seu contexto social e com aquilo que lhes acontece. O problema dessa pesquisa consiste em conhecer as representações sociais do processo saúde-doença dos profissionais do PSF, considerando que esse conhecimento pode ser fundamental para o desenvolvimento de práticas educativas em saúde. A abordagem metodológica desta pesquisa foi qualitativa, tendo por base as representações sociais dos profissionais de apoio e das equipes de saúde da família do Centro de Saúde Milionários, em Belo Horizonte, Minas Gerais. Para a coleta de dados, foi utilizada entrevista individual semi-estruturada abordando os seguintes aspectos: processo saúde-doença; educação em saúde; e barreiras ou dificuldades para prescrição/adoção de hábitos saudáveis. Os dados foram analisados pela técnica de análise de conteúdo, a partir das categorias: dimensões do processo saúde-doença; barreiras ou dificuldades para adoção de hábitos saudáveis; e significados e valores da educação em saúde. Os dados apontam que há necessidade de modificações conceituais na formação permanente desses profissionais e da inclusão do enfoque coletivo, abordando o conceito ampliado de saúde com seus determinantes sociais e contextuais. Faz-se necessária também a busca de novas metodologias de educação em saúde, para que os profissionais do PSF possam ir além da informação e consigam a ressignificação dos conceitos do processo saúde-doença, podendo de fato estabelecer novas práticas e novos processos de trabalho em saúde.

  7. A eterna busca da verdade em Die Lehrlinge zu Saïs, de Novalis

    Directory of Open Access Journals (Sweden)

    Natália Corrêa Porto Sanches Fadel

    2010-01-01

    Full Text Available The purpose of this essay is to undergo an investigation geared towards identifying the consolidation of the symbolized Upper or Ideal Truth illustrated by the figure of the goddess Saïs in the fragmentary novel Die Lehrlinge zu Saïs, from Novalis, written in 1801. As part of our approach, we traced a parallel between the allegorical use of Saïs myth by Novalis and in Schiller´s poem Das verschleierte Bild zu Saïs, aiming at a better characterization of Novalis' concept of the Ideal Truth. Lastly, we analyzed the fairy tale Hyazinth und Rosenblüte, which is part of the novel Die Lehrlinge zu Saïs, where it is possible to envisage the finding of the Ideal Truth searched by the poets of German Early Romanticism, especially by Novalis.

  8. Reflexões sobre o papel das unidades de economia da saúde no âmbito de sistemas nacionais de saúde

    Directory of Open Access Journals (Sweden)

    Fabiola Sulpino Vieira

    Full Text Available Resumo O objetivo deste texto é apresentar algumas reflexões sobre o papel e a relevância das unidades de economia da saúde (UES no âmbito de sistemas nacionais de saúde. Parte-se dos fundamentos deste campo de conhecimento e de sua contribuição à gestão em saúde para tecer considerações sobre o papel e a relevância dessas unidades. São discutidas questões como o conhecimento dos gestores da saúde e lideranças políticas sobre economia da saúde, a necessidade de atuação transversal da UES na organização e de corpo técnico multidisciplinar qualificado, assim como a natureza técnica e política do trabalho, as possibilidades e limites para sua atuação, seus aspectos e a relação com grupos externos de pesquisa. Por fim, ressalta-se que o trabalho de equipe interna especializada em economia da saúde constitui um dos meios para qualificar o processo de tomada de decisão nas organizações públicas de saúde, visando à otimização do uso dos recursos e à equidade em sua alocação.

  9. Contribuições do PET-Saúde/Redes de Atenção Psicossocial à Saúde da Família

    Directory of Open Access Journals (Sweden)

    Larissa de Almeida Rézio

    2015-12-01

    Full Text Available O estudo objetivou analisar as contribuições do Programa de Educação pelo Trabalho para a Saúde – PET-Saúde/Redes de Atenção Psicossocial à Saúde - a uma unidade de Estratégia de Saúde da Família em Cuiabá, Mato Grosso, Brasil. Trata-se de um estudo descritivo, com abordagem qualitativa, utilizando entrevista com cinco profissionais de saúde e dois acadêmicos bolsistas e registros de atividades realizadas no serviço. À luz da análise de conteúdo temática, sistematizamos quatro subtemas: “articulação da rede”; “qualificação da assistência à saúde mental”, “melhora do conhecimento dos profissionais” e “superação de estigmas sobre o paciente em sofrimento psíquico”. Houve sensibilização dos profissionais e bolsistas sobre a importância do acompanhamento das pessoas com sofrimento mental na atenção básica, em articulação com serviços de saúde mental.

  10. Saúde mental nas práticas em saúde: a experiência do PROLIG

    Directory of Open Access Journals (Sweden)

    Samantha Mucci

    Full Text Available O presente trabalho apresenta o relato de experiências do Serviço de Atenção Psicossocial Integrada em Saúde (SAPIS nos Programas de Ligação (PROLIG. O SAPIS foi implantado em junho de 2002, no Hospital São Paulo (HSP, com o objetivo de promover uma atenção mais ampla às necessidades gerais e específicas do hospital no que diz respeito aos aspectos psicossociais bem como de reorganizar a inclusão de profissionais de saúde mental nas enfermarias e ambulatórios. Esse estudo tem como objetivo descrever a atuação do psicólogo como profissional de ligação em saúde mental no atendimento às demandas específicas de unidades do HSP. A tarefa do profissional de ligação em saúde mental envolve a assistência psicológica ao paciente e seu familiar assim como o desempenho do papel de especialista em saúde mental junto à equipe multiprofissional. Temos encontrado em nossa prática, no entanto, algumas dificuldades para a implementação e a manutenção de algumas propostas. Concluímos que a atuação do psicólogo como profissional de ligação de saúde mental tem promovido mudanças nos cuidados em saúde nessa instituição, porém ainda exige uma profunda reflexão e maior envolvimento da instituição e de políticas de saúde que viabilizem mudanças estruturais para a construção de uma efetiva prática integral e integrada nessa área.

  11. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: LabVIEW base 1 : 22 - 24.4.02 (3 jours) CLEAN 2002 : working in a cleanroom:  24.4.02  (half-day, pm) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) AutoCAD : Mise à jour AutoCAD r-14 vers 2002 : 25 & 26.4.02 (2 jours) Cotations selon les normes GPS de l'ISO : 29 - 30.4.02 (2 jours) Introduction to the CERN Engineering Data Management System:  7.5.02  (1 day) LabVIEW Basics 2: 13 & 14.5.02 (2 days) AutoCAD Mechanical 6 PowerPack (F) : 13-14, 17, 21, 27-28.5.02 (6 jours) WorldFIP - Généralités : 14.5.2002 (1/2 journée) WorldFIP - Développer avec MicroFIP HANDLER : 14.5 - après-midi, 15.5.02 - matin (1 jour) WorldFIP - FullFIP FDM : FIP Device Manager (F) : 15.5 - après-midi, 16.5.02 - matin (1 jour) LabVIEW DAQ (F) : 15 & 16.5.02 (2 jours) EXCEL 2000 - niveau 2 : 22 & 23.5.02 (2 jours)...

  12. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: The CERN Engineering Data Management System for Advanced users : 16.4.02  (1 day) Migration from AutoCAD 14 towards AutoCAD Mechanical6 PowerPack:  17 - 19.4 and 2 &3.5.02  (5 days) AutoCAD - niveau 1 : 22, 23, 29, 30.4 et 6, 7.5.02 (6 jours) LabVIEW base 1 : 22 - 24.4.02 (3 jours) CLEAN 2002 : working in a cleanroom:  24.4.02  (half-day, pm) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) AutoCAD : Mise à jour AutoCAD r-14 vers 2002 : 25 & 26.4.02 (2 jours) Cotations selon les normes GPS de l'ISO : 29 - 30.4.02 (2 jours) Introduction to the CERN Engineering Data Management System:  7.5.02  (1 day) LabVIEW Basics 2: 13 & 14.5.02 (2 days) AutoCAD Mechanical 6 PowerPack (F) : 13-14, 17, 21, 27-28.5.02 (6 jours) WorldFIP - Généralités : 14.5.2002 (1/2 journée) WorldFIP - Développer avec Micr...

  13. Places available **

    CERN Multimedia

    2003-01-01

    Des places sont disponibles dans les cours suivants : Places are available in the following courses : Introduction à Windows 2000 au CERN : 25.2.03 (1/2 journée) LabView base 2/LabView Basics 2 : 10 & 11.3.03 (2 jours/2 days) langue à définir/Language to be decided C++ for Particle Physicists : 10 - 14.3.03 (6 X 3-hour lectures) Introduction to PVSS : 10.3.03 (half day, afternoon) Basic PVSS : 11 - 13.3.03 (3 days) LabView avancé /LabView Advanced : 12 - 14.3.03 (3 jours/3days) Langue à définir/Language to be decided AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 17, 18, 24 & 25.3.03 (6 jours) PVSS - JCOP Framework Tutorial : 14.3.03 (1 day) CLEAN-2002 : Working in a cleanroom : 2.4.03 (half-day, afternoon, free course, registration required) LabView base 1/LabView Basics 1 : 9 - 11.4.03 (3 jours/3 days) Langue à définir/Language to be decided DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (...

  14. Places available **

    CERN Multimedia

    2003-01-01

    Des places sont disponibles dans les cours suivants : Places are available in the following courses : WorldFIP 2003 pour utilisateurs : 11-14.2.03 (4 jours) DISP-2003 ? Spring I Term : Introduction to Digital Signal Processing : 20, 27.2, 6, 13, 20, 27.3, 3.4.03 (7 X 2-hour lectures) AXEL-2003 - Introduction to Accelerators : 24-28.2.03 (10 X 1-hour lectures) AutoCAD 2002 - niveau 1 : 24, 25.2 & 3, 4.3.03 (4 jours) Introduction à Windows 2000 au CERN : 25.2.03 (1/2 journée) LabView base 2/LabView Basics 2 : 10 & 11.3.03 (2 jours/2 days) langue à définir/Language to be decided C++ for Particle Physicists : 10 ? 14.3.03 (6 X 3-hour lectures) Introduction to PVSS : 10.3.03 (half day, afternoon) Basic PVSS : 11 - 13.3.03 (3 days) LabView avancé /LabView Advanced : 12 - 14.3.03 (3 jours/3days) Langue à définir/language to be decided AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 17, 18, 24 & 25.3.03 (6 jours) PVSS - JCOP Framework Tutorial : 14.3.03 (1 day) MAGNE-03 - Magnetism for Technical Ele...

  15. Places available **

    CERN Multimedia

    2003-01-01

    Des places sont disponibles dans les cours suivants : Places are available in the following courses : DISP-2003 - Spring I Term : Introduction to Digital Signal Processing : 20, 27.2, 6, 13, 20, 27.3, 3.4.03 (7 X 2-hour lectures) AXEL-2003 - Introduction to Accelerators : 24 - 28.2.03 (10 X 1-hour lectures) AutoCAD 2002 - niveau 1 : 24, 25.2 & 3, 4.3.03 (4 jours) Introduction à Windows 2000 au CERN : 25.2.03 (1/2 journée) LabView base 2/LabView Basics 2 : 10 & 11.3.03 (2 jours/2 days) langue à définir/Language to be decided C++ for Particle Physicists : 10 - 14.3.03 (6 X 3-hour lectures) Introduction to PVSS : 10.3.03 (half day, afternoon) Basic PVSS : 11 - 13.3.03 (3 days) LabView avancé /LabView Advanced : 12 - 14.3.03 (3 jours/3days) Langue à définir/language to be decided AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 17, 18, 24 & 25.3.03 (6 jours) PVSS - JCOP Framework Tutorial : 14.3.03 (1 day) CLEAN-2002 : Working in a cleanroom : 2.4.03 (half-day, afternoon, free course, regis...

  16. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Automates et réseaux de terrain : 13 & 14.11.01 (3 jours) Introduction à Windows 2000 au CERN : 12 - 14.11.01 (1/2 journée) Introduction to Windows 2000 at CERN :  14.11.01  (half-day) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Sécurité dans les installations cryogéniques : 21 - 22.11.2001 (2 demi-journées) Introduction to C Programming :  21- 23.11.01 (3 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) Contract Follow-up (F) : 26.11.01 (1/2 journée) Object-Oriented Analysis and Design :  27 - 30.11.2001  (4 days) Introduction to the CERN Engineering Data Management System :  30.11.2001 (1 day) Electromagnetic Compatibility (EMC): Introduction (bilingual) :  3.12.01 (half-day) Introduction to the CERN Engineering Data Management System : 07.12.2001...

  17. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: October 2002   Introduction to the CERN Engineering Data Management System (free of charge):  29.10.2002  (1 day) The CERN EDMS for Advanced users (free of charge):  30.10.2002  (1 day) November 2002   LabView hands-on (bilingue/bilingual): 5.11.02 (matin/morning) LabView DAQ hands-on (bilingue/bilingual):  5.11.02  (après-midi afternoon) Introduction au PC et Windows 2000 au CERN :  6 & 7.11.02  (2 jours) Oracle 8i : Access the Database with Java:  7 & 8.11.02  (2 days) AutoCAD 2002 - niveau 2 :  7 & 8.11.02  (2 jours) Introduction to PVSS (free of charge):  11.11.2002 pm  (1/2 day) Basic PVSS:  12 - 14.11.02  (3 days) EXCEL 2000 - niveau 1 :  12 & 13.11.02  (2 jours) CLEAN-2002: Working in a Cleanroom (English, free ...

  18. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Contract Follow-up (F) : 30.10.01 (1/2 journée) The CERN Engineering Data Management System for Electronics Design :  30.10.01 (1 day) Nouveautés d'Excel 2000 : 5.11.01 (1/2 journée) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) Introduction à Windows 2000 au CERN : 6.11.01 (1/2 journée) The Java programming language Level 1: 8 - 9.11.01 (2 days) LabView Base 1 : 12 - 14.11.01 (3 jours) LabVIEW DAQ (F) : 15 & 16.11.01 (2 jours) Automates et réseaux de terrain : 13 & 14.11.01 (2 jours) Introduction to PERL 5 :  15 - 16.11.01  (2 days) LabVIEW - DAQ : 15 - 16.11.01 (2 jours) Introduction to XML :  19 - 20.11.01 (2 days) Introduction to C Programming :  21- 23.11.01 (3 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) Object-Oriented Analysis and Design :  27 - 30.11.2001 (4 days) Hands...

  19. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: ELEC-2002 : Spring Term :  9, 11, 16, 18, 23, 25, 30.4.02 (7 * 2.5 hours) Object-Oriented Analysis & Design: 16 - 19.4.02  (4 days) The CERN Engineering Data Management System for Advanced users:  16.4.02  (1 day) Migration from AutoCAD 14 towards AutoCAD Mechanical6 PowerPack:  17 - 19.4 and 2 &3.5.02  (5 days) AutoCAD - niveau 1 : 22, 23, 29, 30.4 et 6, 7.5.02 (6 jours) LabVIEW base 1 : 22 - 24.4.02 (3 jours) CLEAN 2002 : working in a cleanroom:  24.4.02  (half-day, pm) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) AutoCAD : Mise à jour AutoCAD r-14 vers 2002 : 25 & 26.4.02 (2 jours) LabVIEW Basics 2 : 13 & 14.5.02 (2 days) EXCEL 2000 - niveau 1 : 15 & 16.5.02 (2 jours) LabVIEW DAQ (F) : 15 & 16.5.02 (2 jours) EXCEL 2000 - niveau 2 : 22 & 23.5.02 (2 jours) LabVIEW Basics 1:  3 - 5.6.02&a...

  20. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: ELEC-2002 : Spring Term :  9, 11, 16, 18, 23, 25, 30.4.02 (7 * 2.5 hours) Object-Oriented Analysis & Design: 16 - 19.4.02  (4 days) The CERN Engineering Data Management System for Advanced users:  16.4.02  (1 day) Migration from AutoCAD 14 towards AutoCAD Mechanical6 PowerPack:  17 - 19.4 and 2 &3.5.02  (5 days) AutoCAD - niveau 1 : 22, 23, 29, 30.4 et 6, 7.5.02 (6 jours) LabVIEW base 1 : 22 - 24.4.02 (3 jours) CLEAN 2002 : working in a cleanroom:  24.4.02  (half-day, pm) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) AutoCAD : Mise à jour AutoCAD r-14 vers 2002 : 25 & 26.4.02 (2 jours) Cotations selon les normes GPS de l'ISO : 29 - 30.4.02 (2 jours) Introduction to the CERN Engineering Data Management System:  7.5.02  (1 day) LabVIEW Basics 2 : 13 & 14.5.02 (2 days) AutoCAD Mechanical 6 PowerPack (F) : 13-...

  1. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Introduction to C Programming :  21- 23.11.01 (3 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) Contract Follow-up (F) : 26.11.01 (1/2 journée) Habilitation électrique : électriciens network : 27 - 29.11.2001 (3 jours) Object-Oriented Analysis and Design :  27 - 30.11.2001  (4 days) Introduction to the CERN Engineering Data Management System :  30.11.2001 (1 day) Electromagnetic Compatibility (EMC): Introduction (bilingual) :  3.12.01 (half-day) Introduction to the CERN Engineering Data Management System : 07.12.2001 (1 day) LabVIEW - Basics 1 :  10 - 12.12.01 (3 days) LabVIEW - Basics 2 :  13 - 14.12.01 (2 days) EXCEL 2000 - niveau 2 : 15 - 16.1.02 (2 jours) C++ Programming Level 2 - Traps and Pitfalls :  15 - 18.1.2002  (4 days) Nouveautés de WORD 2000 : 18.1.02 (1/2 journée) FileMaker P...

  2. Places available **

    CERN Document Server

    2003-01-01

    Des places sont disponibles dans les cours suivants : Places are available in the following course : Introduction to the CERN Engineering Data Management System : 28.1.03 (1 day) AutoCAD 2002 - niveau 1 : 24, 25.2 et 3, 4.3.03 (4 jours) AutoCAD 2002 - niveau 2 : 27 & 28.2.03 (2 jours) C++ for Particle Physicists : 10 - 14.3.03 (6 X 3 hour lectures) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 17, 18, 24 & 25.3.03 (6 jours) CLEAN-2002 : Working in a cleanroom : 25.3.03 (half-day, afternoon, free course, registration required) Formation Siemens SIMATIC /Siemens SIMATIC Training : Introduction à STEP7 /Introduction to STEP7 : 11 & 12.3.03 / 3 & 4.6.03 (2 jours/2 days) Programmation STEP7/STEP7 Programming : 31.3 - 4.4.03 / 16 - 20.6.03 (5 jours/5 days) Réseau Simatic Net /Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 Ces cours seront donnés en français ou anglais en fonction des demandes / These courses will be given in French or English following the requests. * Etant do...

  3. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) Programmation de pilotes périphériques : 5 - 8.5.03 (4 jours) Oracle iDS Reports : Build Internet Reports : 5 - 9.5.03 (5 days) LabView DAQ (language to be defined) : 8 & 9.5.03 AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.0 (6 jours) FrontPage 2000 - niveau 1 : 20 & 21.5.03 (2 jours) AutoCAD 2002 - niveau 2 : 3 & 4.6.03 (2 jours) EXCEL 2000 - niveau 1 : 10 & 11.6.03 (2 jours) EXCEL 2000 - level 1 : 12 & 13.6.03 (2 days) PowerPoint 2000 (F) : 17 & 18.6.03 (2 jours) FrontPage 2000 - niveau 2 : 19 & 20.6.03 (2 jours) LabView DSC (langue à décider/language to be defined) : 19 & 20.6.03 EXCEL 2000 - niveau 2 : 24 & 25.6.03 (2 jours) Siemens SIMATIC Training : Introduction to STEP7 : 3 & 4.6.03 (2 days) STEP7 Programming : 16 - 20.6.03 (5 days) Simatic Net Network : 26 & 27.6.03 ...

  4. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) Oracle iDS Reports : Build Internet Reports : 5 - 9.5.03 (5 days) LabView DAQ (language to be defined) : 8 & 9.5.03 AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03 (6 jours) AutoCAD 2002 - niveau 2 : 3 & 4.6.03 (2 jours) LabView DSC (language to be defined) : 19 & 20.6.03 Siemens SIMATIC Training : Introduction to STEP7 : 3 & 4.6.03 (2 days) STEP7 Programming : 16 - 20.6.03 (5 days) Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 (sessions of 2 days) These courses will be given in French or English following the requests. Cours de sécurité : Etre TSO au CERN : Prochaines sessions : 24, 25 & 27.6.03 - 4, 5 & 7.11.03 (session de 3 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description ...

  5. [Not Available].

    Science.gov (United States)

    Calbiac, Pascale De; Lamoureux, Fabien; Pourrat, Xavier; Bretault, Lydia; Marchand, Sophie; Grassin, Jacqueline; Antier, Daniel

    2006-01-01

    Treatment of Bronchial Superinfections: Data Related to Stability of Antibiotics in Portable Pumps. Given many data about the stability of antibiotics in portable pump (elastomer) are lacking, this study was designed to make a point about available data and to evaluate the stability of antibiotics when exposed to temperature within 35°C (average temperature measured in real conditions of use). First, to collect information about the stability of antibiotics in portable pump and to confront them with the local antibiotics protocols dedicated to the treatment of bronchial superinfection in patients with cystic fibrosis; second, to evaluate the stability of piperacillin associated with tazobactam at 35°C. While measured concentrations in tazobactam did not show significant variation during the study, piperacillin measurements showed a major reduction of concentration (up to 33%), both time and concentration related to. Such information must be pointed out to prescribers and patients to ensure a cold accumulator is placed in the pump can'ying-bag and to limit the duration of infusion to 24h with a single pump. This experimental program will keep on going with the stability study of both ticarcillin and cefsulodin in portable pump. Copyright © 2006 Société Française de Pharmacologie et de Thérapeutique. Publié par Elsevier Masson SAS.

  6. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Introduction au PC et à Windows 2000 au CERN : 29 - 30.1.02 (2 jours) LabView Base 1 : 4 - 6.2.02 (3 jours) LabView DAQ  (F) : 7 & 8.2.02 (2 jours) Hands-on Object-Oriented Design & Programming with Java :  11 - 13.02.02 (3 days) PVSS basics :  18 - 22.2.02 (5 days) Introduction à Windows 2000 : 18.2.02 (1 demi-journée) Introduction to the CERN Engineering Data Management System :  20.2.02 (1 day) The CERN Engineering Data Management System for Advanced users :  21.2.02  (1 day) C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) Cours sur la migration AutoCAD : AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electr...

  7. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) Programming the Web for Control Applications : 11, 12, 18, 19.3.2002  (4 * 2 hour lectures) Habilitation électrique : recyclage HT/BT (Français) : 13 - 14.3.2002 (2 * 2 heures) Introduction à la CAO CADENCE : 19 & 20.3.02 (2 jours) LabVIEW base 1 : 22 - 24.4.02 (3 jours) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) LabVIEW Basics 2 : 13 & 14.5.02 (2 days) LabVIEW DAQ (F) : 15 & 16.5.02 (2 jours) Cours sur la migration AutoCAD :   AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at : Technical Training or fil...

  8. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: LabVIEW - Basics 1 :  10 - 12.12.01 (3 days) Introduction to XML :  12 & 13.12.01 (2 days) Introduction au PC et Windows 2000 : 12 & 14.12.01 (2 jours) LabVIEW - Basics 2 :  13 - 14.12.01 (2 days) Habilitation électrique : superviseurs : 17.12.2001 (1/2 journée) MS-Project 2000 : 10 & 11.01.02 (2 jours) EXCEL 2000 - niveau 2 : 15 - 16.1.02 (2 jours) Sécurité dans les installations cryogéniques: 15-17.1.2002 (2 demi-journées) C++ Programming Level 2 - Traps and Pitfalls :  15 - 18.1.2002  (4 days) ELEC-2002 Winter Term: Readout and system electronics for Physics  15.1.2002 - 7.2.2002 (8 half- days) Nouveautés de WORD 2000 : 18.1.02 (1/2 journée) LabView hands-on : 21.01.02 (1/2 journée) LabView DAQ hands-on : 21.01.02 (1/2 journée) FileMaker Pro : 22 -...

  9. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2002-01-01

    Places are available in the following courses: LabView hands-on : 21.01.02 (1/2 journée) LabView DAQ hands-on : 21.01.02 (1/2 journée) FileMaker Pro : 22 - 25.1.02 (4 jours) MS-Project 2000 : 22, 24 & 25.01.02 (3 jours) Introduction au PC et à Windows 2000 au CERN : 29 - 30.1.02 (2 jours) LabView Base 1 : 4 - 6.2.02 (3 jours) LabView DAQ  (E) :  7 & 8.02.02 (2 days) Hands-on Object-Oriented Design & Programming with Java :  11 - 13.02.02 (3 days) PVSS basics :  11 - 15.2.02 (5 days) Introduction à Windows 2000 : 18.2.02 (1 demi-journée) Introduction to the CERN Engineering Data Management System :  20.2.02 (1 day) The CERN Engineering Data Management System for Advanced users :  21.2.02  (1 day) C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) Cours sur la migration AutoCAD : AutoCAD : Mise à...

  10. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel.74924

    2001-01-01

    Places are available in the following courses: Habilitation électrique : superviseurs : 5.12.01 (1/2 journée) LabVIEW - Basics 1 :  10 - 12.12.01 (3 days) Introduction au PC et Windows 2000 : 12 & 14.12.01 (2 jours) LabVIEW - Basics 2 :  13 - 14.12.01 (2 days) Habilitation électrique : superviseurs : 17.12.2001 (1/2 journée) EXCEL 2000 - niveau 2 : 15 - 16.1.02 (2 jours) Sécurité dans les installations cryogéniques: 15-17.1.2002 (2 demi-journées) C++ Programming Level 2 - Traps and Pitfalls :  15 - 18.1.2002  (4 days) ELEC-2002 Winter Term: Readout and system electronics for Physics  15.1.2002 - 7.2.2002 (8 half- days) Nouveautés de WORD 2000 : 18.1.02 (1/2 journée) LabView hands-on : 21.01.02 (1/2 journée) LabView DAQ hands-on : 21.01.02 (1/2 journée) FileMaker Pro : 22 - 25.1.02 (4 jours) Frontpage...

  11. PLACES AVAILABLE

    CERN Multimedia

    Enseignement Technique; Tel. 74924

    2001-01-01

    Places are available in the following courses: MS-Project 2000 : 10 & 11.01.02 (2 jours) EXCEL 2000 - niveau 2 : 15 - 16.1.02 (2 jours) Sécurité dans les installations cryogéniques: 15-17.1.2002 (2 demi-journées) C++ Programming Level 2 - Traps and Pitfalls :  15 - 18.1.2002  (4 days) ELEC-2002 Winter Term: Readout and system electronics for Physics  15.1.2002 - 7.2.2002 (8 half- days) Nouveautés de WORD 2000 : 18.1.02 (1/2 journée) LabView hands-on : 21.01.02 (1/2 journée) LabView DAQ hands-on : 21.01.02 (1/2 journée) FileMaker Pro : 22 - 25.1.02 (4 jours) MS-Project 2000 : 24 & 25.01.02 (2 jours) Introduction au PC et à Windows 2000 au CERN : 29 - 30.1.02 (2 jours) LabView Base 1 : 4 - 6.2.02 (3 jours) LabView DAQ  (E) :  7 & 8.02.02 (2 days) Hands-on Object-Oriented Design & Programming with Java :&nbs...

  12. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: PVSS Basics :  8 - 12.4.02  (5 days) AutoCAD : Mise à jour AutoCAD r-14 vers 2002 : 25 & 26.4.02 (2 jours) ELEC-2002 : Spring Term :  9, 11, 16, 18, 23, 25, 30.4.02 (7 * 2.5 hours) Object-Oriented Analysis & Design: 16 - 19.4.02  (4 days) Migration from AutoCAD 14 towards AutoCAD Mechanical6 PowerPack:  17 - 19.4 and 2 &3.5.02  (5 days) LabVIEW base 1 : 22 - 24.4.02 (3 jours) LabVIEW DSC (F) 25 & 26.4.02 (2 jours) LabVIEW Basics 2 : 13 & 14.5.02 (2 days) EXCEL 2000 - niveau 2 : 22 & 23.5.02 (2 jours) LabVIEW DAQ (F) : 15 & 16.5.02 (2 jours) LabVIEW Basics 1:  3 - 5.6.02  (3 days) LabVIEW DAQ (E):  6 & 7.6.02  (2 days) If you wish to participate in one of these courses, please discuss with your supervisor and apply electronically directly from the course description pages that...

  13. PLACES AVAILABLE

    CERN Multimedia

    Monique DUVAL

    2002-01-01

    Places are available in the following courses: LabView Basics 1 :  4 - 6.3.02  (3 days) CLEAN-2002 : Working in a Clean Room :  7.3.2002  (half day) LabView Base 2 : 11 & 12.3.02 (2 jours) C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) Programming the Web for Control Applications : 11, 12, 18, 19.3.2002  (4 * 2 hour lectures) Habilitation électrique : recyclage HT/BT (Français) : 13 - 14.3.2002 (2 * 2 heures) LabView Advanced :  13 - 15.3.02 (3 days) Introduction to the CERN Engineering Data Management System (EDMS) :  20.3.2002  (1 day) The CERN (EDMS) for Advanced Users :  21.3.2002  (1 day) LabVIEW DSC : 25 - 26.4.2002 (2 jours) LabVIEW DAQ : 15 - 16.5.2002 (2 jours) Cours sur la migration AutoCAD :   AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé ...

  14. PLACES AVAILABLE

    CERN Multimedia

    Technical Traininf; Tel. 74924

    2001-01-01

    Places are available in the following courses: Electromagnetic Compatibility (EMC): Introduction (bilingual) :  3.12.01 (half-day) Habilitation électrique : superviseurs : 5.12.01 (1/2 journée) Introduction to the CERN Engineering Data Management System : 07.12.2001 (1 day) LabVIEW - Basics 1 :  10 - 12.12.01 (3 days) Introduction au PC et Windows 2000 : 12 & 14.12.01 (2 jours) LabVIEW - Basics 2 :  13 - 14.12.01 (2 days) Habilitation électrique : superviseurs : 17.12.2001 (1/2 journée) EXCEL 2000 - niveau 2 : 15 - 16.1.02 (2 jours) C++ Programming Level 2 - Traps and Pitfalls :  15 - 18.1.2002  (4 days) Nouveautés de WORD 2000 : 18.1.02 (1/2 journée) LabView hands-on : 21.01.02 (1/2 journée) LabView DAQ hands-on : 21.01.02 (1/2 journée) FileMaker Pro : 22 - 25.1.02 (4 jours) Introduction au PC et à Windows 2000 au CERN : 29 - 30.1....

  15. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : FrontPage 2000 - niveau 1 : 20 & 21.5.03 (2 jours) PIPES-2003 : Pratique du sertissage de tubes métalliques et multicouches : 21.5.03 (1 jour) Introduction à la CAO Cadence : de la saisie de schéma Concept-HDL au PCB : 20 & 22.5.03 (2 jours) AutoCAD 2002 - niveau 2 : 3 & 4.6.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 5, 6, 12, 13, 26, 27.6.03 (6 jours) EXCEL 2000 - niveau 1 : 10 & 11.6.03 (2 jours) Conception de PCB rapides dans le flot Cadence : 11.6.03 (matin) EXCEL 2000 - level 1 : 12 & 13.6.03 (2 days) PowerPoint 2000 (F) : 17 & 18.6.03 (2 jours) Réalisation de PCB rapides dans le flot Cadence : 17.6.03 (matin) FrontPage 2000 - niveau 2 : 19 & 20.6.03 (2 jours) LabView DSC (langue à décider/language to be defined) : 19 & 20.6.03 EXCEL 2000 - niveau 2 : 24 & 25.6.03 (2 jours) Siemens SIMATIC Training: Introduction to STEP7 : 3 & 4.6.03 (2 days) STEP7 Programming : 16 - 20.6.03 (5 days) Simatic...

  16. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : FrontPage 2000 - niveau 1: 20 & 21.5.03 (2 jours) PIPES-2003 : Pratique du sertissage de tubes métalliques et multicouches: 21.5.03 (1 jour) Introduction à la CAO Cadence: de la saisie de schéma Concept-HDL au PCB : 20 & 22.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (E): 5, 6, 12, 13, 26, 27.6.03 (6 days) EXCEL 2000 - niveau 1: 10 & 11.6.03 (2 jours) Conception de PCB rapides dans le flot Cadence: 11.6.03 (matin) EXCEL 2000 - level 1: 12 & 13.6.03 (2 days) Introduction to PVSS: 16.6.03 (half-day, pm) Basic PVSS: 17 - 19.6.03 (3 days) Réalisation de PCB rapides dans le flot Cadence: 17.6.03 (matin) LabView DSC (language to be defined): 19 & 20.6.03 PVSS - JCOP Framework Tutorial: 20.6.03 (1 day) EXCEL 2000 - niveau 2: 24 & 25.6.03 (2 jours) Siemens SIMATIC Training: Introduction to STEP7: 3 & 4.6.03 (2 days) STEP7 Programming: 16 - 20.6.03 (5 days) Simatic Net Network: 26 & 27.6.03 (2 days) These courses will be given...

  17. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: EXCEL 2000 - niveau 1 : 3 et 4.10.01 (2 jours) Automates et réseaux de terrain : 3 - 4.10.2001 (2 jours) Introduction à Outlook : 5.10.01 (1 journée) C++ for Particle Physicists : 8 - 12.10.01 (6 lectures) Cadence Board Design tools : Upgrading to release 14 : 3 1-day sessions on 9, 10 & 11.10.01 MS-Project 2000 - niveau 1 : 15 - 18.10.01 (4 demi-journées) LabView Base 2 : 18 & 19.10.01 (2 jours) WORD 2000 : importer et manipuler des images : 19.10.01 (1 journée) The CERN Engineering Data Management System for Electronics Design :  30.10.01 (1 day) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) The Java programming language Level 1: 8 - 9.11.01 (2 days) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Introduction to XML :  19 - 20.11.01 (2 days) Programming TSX Premium 1 :  19 - 23.11.01  (5 days) Introd...

  18. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Contract Follow-up (F) : 30.10.01 (1/2 journée) The CERN Engineering Data Management System for Electronics Design :  30.10.01 (1 day) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) Nouveautés d'EXCEL : 5.11.01 (1/2 journée) Introduction a Windows 2000 au CERN : 6.11.01 (1/2 journée) The Java programming language Level 1: 8 - 9.11.01 (2 days) LabView Base 1 : 12 - 14.11.01 (3 jours) Automates et réseaux de terrain : 13 & 14.11.01 (2 jours) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Introduction to XML :  19 - 20.11.01 (2 days) Programming TSX Premium 1 :  19 - 23.11.01  (5 days) Introduction to C Programming :  21- 23.11.01 (3 days) The Java programming language Level 2:  26 - 28.11.01 (3 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) Autocad Migration support courses: a detail...

  19. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: MS-Project 2000 - niveau 1 : 15 - 18.10.01 (4 demi-journées) LabView Base 2 : 18 & 19.10.01 (2 jours) WORD 2000 : importer et manipuler des images : 19.10.01 (1 journée) Contract Follow-up (F) : 30.10.01 (1/2 journée) The CERN Engineering Data Management System for Electronics Design :  30.10.01 (1 day) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) The Java programming language Level 1: 8 - 9.11.01 (2 days) LabView Base 1 : 12 - 14.11.01 (3 jours) Automates et réseaux de terrain : 13 & 14.11.01 (2 jours) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Introduction to XML :  19 - 20.11.01 (2 days) Programming TSX Premium 1 :  19 - 23.11.01  (5 days) Introduction to C Programming :  21- 23.11.01 (3 days) The Java programming language Level 2:  26 - 28.11.01 (3 days) Programmation TSX Premium 2 : 26 ...

  20. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Cadence Board Design tools : Upgrading to release 14 :  3 1-day sessions on 9, 10 & 11.10.01 MS-Project 2000 - niveau 1 : 15 - 18.10.01 (4 demi-journées) LabView Base 2 : 18 & 19.10.01 (2 jours) WORD 2000 : importer et manipuler des images : 19.10.01 (1 journée) Contract Follow-up (F) :  30.10.01 (1/2 journée) The CERN Engineering Data Management System for Electronics Design :  30.10.01 (1 day) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) The Java programming language Level 1: 8 - 9.11.01 (2 days) LabView Base 1 : 12 - 14.11.01 (3 jours) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Introduction to XML :  19 - 20.11.01 (2 days) Programming TSX Premium 1 :  19 - 23.11.01  (5 days) Introduction to C Programming :  21- 23.11.01 (3 days) The Java programming language Level 2:  26 - 28.11.01 (...

  1. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Introduction à Windows 2000 au CERN : 2 sessions de _ journée les 24 et 25.9.01 PROFIBUS : 25 - 26.9.01 (2 jours) PROFIBUS : 27 - 28.9.01 (2 days) EXCEL 2000 - niveau 1 : 3 et 4.10.01 (2 jours) Automates et réseaux de terrain : 3 - 4.10.2001 (2 jours) Introduction à Outlook : 5.10.01 (1 journée) Frontpage 2000 - niveau 1 : 8 et 9.10.01 (2 jours) C++ for Particle Physicists : 8 - 12.10.01 (6 lectures) MS-Project 2000 - niveau 1 : 15 - 18.10.01 (4 demi-journées) Programmation TSX Premium 1 : 15 - 19.10.01 (5 jours) WORD 2000 : importer et manipuler des images : 19.10.01 (1 journée) Programmation TSX Premium 1 : 22 - 26.10.01 (5 jours) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) The Java programming language Level 1: 8 - 9.11.01 (2 days) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Introduction to XML :  19 - 20.11.01 (2...

  2. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: LabView DAQ  (F) : 7 & 8.2.02 (2 jours) Hands-on Object-Oriented Design & Programming with Java :  11 - 13.02.02 (3 days) PVSS basics :  18 - 22.2.02 (5 days) Introduction à Windows 2000 : 18.2.02 (1 demi-journée) Introduction to the CERN Engineering Data Management System :  20.2.02 (1 day) Introduction à la CAO CADENCE : 20 & 21.2.02 (2 jours) The CERN Engineering Data Management System for Advanced users :  21.2.02  (1 day) LabView Basics 1 :  4 - 6.3.02  (3 days) Introduction au VHDL et utilisation du simulateur de CADENCE : 6 & 7.3.02 (2 jours) LabView Base 2 : 11 & 12.3.02 (2 jours) C++ for Particle Physicists :  11 - 15.3.2002  (6 * 3 hour lectures) LabView Advanced :  13 - 15.3.02 (3 days) Cours sur la migration AutoCAD :   AutoCAD : Mise à...

  3. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: The CERN EDMS for Local Administrators (free of charge) : 24 & 25.9.03 (2 days) HeREF-2003 : Techniques de la réfrigération Hélium (cours en français avec support en anglais) : 6 - 10.10.2003 (7 demi-journées) The Java Programming Language Level 1 : 6 - 7.10.2003 (2 days) Java 2 Enterprise Edition - Part 2 : Enterprise JavaBeans : 8 - 10.10.2003 (3 days) FileMaker - niveau 1 : 9 & 10.10.03 (2 jours) EXCEL 2000 - niveau 1 : 20 & 22.10.03 (2 jours) AutoCAD 2002 - niveau 1 : 20, 21, 27, 28.10.03 (4 jours) CLEAN-2002 : Working in a Cleanroom (free of charge) : 23.10.03 (half day) AutoCAD Mechanical 6 PowerPack (E) : 23, 24, 30, 31.10 & 12, 13.11.03 (6 days) AutoCAD 2002 - niveau 2 : 10 & 11.11.03 (2 jours) ACCESS 2000 - niveau 1 : 13 & 14.11.03 (2 jours) FrontPage 2000 - niveau 1 : 20...

  4. Places available **

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: PIPES-2003 - Pratique du Sertissage de tubes métalliques et multicouches : 26.8.03 (stage pratique) The CERN Engineering Data Management System (EDMS) for Engineers : 27.8.03 (1 day, free of charge) CLEAN-2002 : Travailler en salle blanche : 4.9.03 (une demi-journée, séminaire gratuit) The CERN Engineering Data Management System (EDMS) for Local Administrators : 24 & 25.9.03 (2 days, free of charge) Siemens SIMATIC Training : Programmation STEP7 - niveau 1 : 29 - 2.10.03 (4 jours) - ouverture des inscriptions fin août Programmation STEP7 - niveau 2 : 13 - 17.10.03 (5 jours) - ouverture des inscriptions fin août Réseau Simatic Net : 22 & 23.10.03 (2 jours) - ouverture des inscriptions fin août CLEAN-2002 : Working in a Cleanroom : 23.20.03 (half day, free of charge) These courses will be given in French or Englis...

  5. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : The CERN EDMS for Local Administrators : 24 & 25.9.03 (2 days, free of charge) HeREF-2003 : Techniques de la réfrigération Hélium (cours en français avec support en anglais) : 6 - 10.10.2003 (7 demi-journées) The Java Programming Language Level 1 : 6 - 7.10.2003 (2 days) Java 2 Enterprise Edition - Part 2 : Enterprise JavaBeans : 8 - 10.10.2003 (3 days) FileMaker - niveau 1 : 9 & 10.10.03 (2 jours) EXCEL 2000 - niveau 1 : 20 & 22.10.03 (2 jours) AutoCAD 2002 - niveau 1 : 20, 21, 27, 28.10.03 (4 jours) CLEAN-2002 : Working in a Cleanroom : 23.10.03 (half day, free of charge) AutoCAD 2002 - Level 1 : 3, 4, 12, 13.11.03 (4 days) AutoCAD 2002 - niveau 2 : 10 & 11.11.03 (2 jours) ACCESS 2000 - niveau 1 : 13 & 14.11.03 (2 jours) AutoCAD Mechanical 6 PowerPack (E) : 17, 18, 24, 25.11 & 1, 2.12.03 (6...

  6. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : EXCEL 2000 - niveau 1 : 10 & 11.6.03 (2 jours) Conception de PCB rapides dans le flot Cadence : 11.6.03 (matin) EXCEL 2000 - level 1 : 12 & 13.6.03 (2 days) Introduction to PVSS : 16.6.03 (p.m.) Basic PVSS : 17 - 19.6.03 (3 days) Réalisation de PCB rapides dans le flot Cadence : 17.6.03 (matin) PVSS - JCOP Framework Tutorial : 20.6.03 (1 day) EXCEL 2000 - niveau 2 : 24 & 25.6.03 (2 jours) Siemens SIMATIC Training : Introduction to STEP7 : 3 & 4.6.03 (2 jours/2 days) STEP7 Programming : 16 - 20.6.03 (5 jours/5 days) Simatic Net Network : 26 & 27.6.03 (2 jours/2 days) These courses will be given in French or English following the requests. Programmation automate Schneider : Programmation automate Schneider TSX Premium - 1er niveau : 10 - 13.6.03 (4 jours) - audience : toute personne qui veux maitriser la msie en uvre et la programmation d'un automate TSX Premium - objectifs : maitriser la mise en uvre et la programmation d'un autom...

  7. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: CLEAN-2002 : Travailler en salle blanche (séminaire gratuit) : 4.9.03 (une demi-journée) The CERN EDMS for Local Administrators (free of charge) : 24 & 25.9.03 (2 days) HeREF-2003 : Techniques de la réfrigération Hélium (cours en français avec support en anglais) : 6 - 10.10.2003 (7 demi-journées) The Java Programming Language Level 1 : 6 - 7.10.2003 (2 days) Java 2 Enterprise Edition - Part 2 : Enterprise JavaBeans : 8 - 10.10.2003 (3 days) FileMaker - niveau 1 : 9 & 10.10.03 (2 jours) EXCEL 2000 - niveau 1 : 20 & 22.10.03 (2 jours) AutoCAD 2002 - niveau 1 : 20, 21, 27, 28.10.03 (4 jours) CLEAN-2002 : Working in a Cleanroom (free of charge) : 23.10.03 (half day) AutoCAD Mechanical 6 PowerPack (E) : 23, 24, 30, 31.10 & 12, 13.11.03 (6 days) AutoCAD 2002 - niveau 2 : 10 & 11.11.03 (2 jours)...

  8. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: November 2002   Introduction to PVSS (free of charge): 11.11.02  (afternoon) EXCEL 2000 - niveau 1 :  12 & 13.11.02  (2 jours) CLEAN-2002: Working in a Cleanroom (English, free of charge):  13.11.2002  (afternoon) AutoCAD 2002 - niveau 1 :  14, 15, 21, 22.11.02  (4 jours) Hands-on Object-Oriented Design and Programming with C++:  19 - 21.11.02  (3 days)  EXCEL 2000 - niveau 2 :  25 & 26.11.02  (2 jours) FrontPage 2000 - niveau 1 :  27 & 28.11.02  (2 jours) December 2002   LabVIEW - DSC (English) :  2 - 3.12.02  (2 days) AutoCAD 2002 - niveau 2 :  2 & 3.12.02  (2 jours) FileMaker (Français) :  2 - 5.12.02  (4 jours) PCAD Schémas - Débutants :  5 & 6.12.02 ...

  9. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Introduction à Windows 2000 au CERN : 2 sessions de _ journée les 24 et 25.9.01 PROFIBUS : 25 - 26.9.01 (2 jours) PROFIBUS : 27 - 28.9.01 (2 days) PowerPoint 2000 : 1 et 2.10.01 (2 jours) EXCEL 2000 - niveau 1 : 3 et 4.10.01 (2 jours) Automates et réseaux de terrain : 3 - 4.10.2001 (2 jours) PCAD Schémas - débutants : 4 - 5.10.01 (2 jours) Introduction à Outlook : 5.10.01 (1 journée) Frontpage 2000 - niveau 1 : 8 et 9.10.01 (2 jours) PCAD PCB - débutants : 8 - 10.10.01 (3 jours) C++ for Particle Physicists : 8 - 12.10.01 (6 3-hour lectures) MS-Project 2000 - niveau 1 : 15 - 18.10.01 (4 demi-journées) LabView Basics 1 :  15 - 17.10.01  (3 days) Programmation TSX Premium 1 : 15 - 19.10.01 (5 jours) WORD 2000 : importer et manipuler des images : 19.10.01 (1 journée) Programmation TSX Premium 1 : 22 - 26.10.01...

  10. PLACES AVAILABLE

    CERN Multimedia

    Technical training; Tel. 74924

    2001-01-01

    Places are available in the following courses: PVSS Basics : 20 - 24.8.01 (5 days) PROFIBUS : 25 - 26.9.01 (2 jours) PROFIBUS : 27 - 28.9.01 (2 days) PCAD Schémas - débutants : 4 - 5.10.01 (2 jours) PCAD PCB - débutants : 8 - 10.10.01 (3 jours) Programming TSX Premium 1: 15 - 19.10.01 (5 days) Programmation TSX Premium 1 : 22 - 26.10.01 (5 jours) Programming TSX Premium 2: 19 - 23.11.01 (5 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) The following LabView courses will be given in either English or French according to demand LabVIEW - Base 1 / LabVIEW - Basics 1 : 10 - 12.9.01 (3 jours / 3 days) LabVIEW - DAQ / LabVIEW - DAQ : 13 - 14.9.01 (2 jours / 2 days) LabVIEW - Base 1 / LabVIEW - Basics 1 : 15 - 17.10.01 (3 jours / 3 days) LabVIEW - Base 2 / LabVIEW - Basics 2 : 18 - 19.10.01 (2 jours / 2 days) LabVIEW - Base 1 / LabVIEW - Basics 1 : 12 - 14.11.01 (3 jours / 3 days) LabVIEW - DAQ / LabVIEW - DAQ : 15 - 16.11.01 (2 jours / 2...

  11. PLACES AVAILABLE

    CERN Multimedia

    Technical training; Tel. 74924

    2001-01-01

    Places are available in the following courses: PROFIBUS : 25 - 26.9.01 (2 jours) PROFIBUS : 27 - 28.9.01 (2 days) Automates et réseaux de terrain : 3 - 4.10.2001 (2 jours) PCAD Schémas - débutants : 4 - 5.10.01 (2 jours) PCAD PCB - débutants : 8 - 10.10.01 (3 jours) Programmation TSX Premium 1 : 15 - 19.10.01 (5 jours) Programmation TSX Premium 1 : 22 - 26.10.01 (5 jours) Programming TSX Premium 2: 19 - 23.11.01 (5 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) Autocad Migration support courses: a detailed calendar will be published shortly for this series of sessions which will start on 15.10.2001. Registration is already open AutoCAD : Mise à jour AutoCAD r-14 vers 2002 (2 jours) AutoCAD Mechanical PowerPack 6 basé sur AutoCAD 2002 (5 jours) The following LabView courses will be given in either English or French according to demand LabVIEW - Base 1 / LabVIEW - Basics 1 : 10 - 12.9.01 (3 jours / 3 days)...

  12. PLACES AVAILABLES

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: PVSS Basics : 20 - 24.8.01 (5 days) PROFIBUS : 25 - 26.9.01 (2 jours) PROFIBUS : 27 - 28.9.01 (2 days) PCAD Schémas - débutants : 4 - 5.10.01 (2 jours) PCAD PCB - débutants : 8 - 10.10.01 (3 jours) Programming TSX Premium 1: 15 - 19.10.01 (5 days) Programmation TSX Premium 1 : 22 - 26.10.01 (5 jours) Programming TSX Premium 2: 19 - 23.11.01 (5 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) The following LabView courses will be given in either English or French according to demand LabVIEW - Base 1 / LabVIEW - Basics 1 : 10 - 12.9.01 (3 jours / 3 days) LabVIEW - DAQ / LabVIEW - DAQ : 13 - 14.9.01 (2 jours / 2 days) LabVIEW - Base 1 / LabVIEW - Basics 1 : 15 - 17.10.01 (3 jours / 3 days) LabVIEW - Base 2 / LabVIEW - Basics 2 : 18 - 19.10.01 (2 jours / 2 days) LabVIEW - Base 1 / LabVIEW - Basics 1 : 12 - 14.11.01 (3 jours / 3 days) LabVIEW - DAQ / LabVIEW - DAQ : 15 - 16.11.01 (2 jours / 2...

  13. Places available **

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : CLEAN-2002 : Working in a cleanroom (free course, registration required): 11.4.03 (half-day, afternoon, ) LabView Basics 2 : 10 - 11.4.03 (3 days) DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) AutoCAD 2002 - niveau 1 : 29, 30.4 et 7, 8.5.03 (4 jours) Oracle iDS Reports : Build Internet Reports : 5 - 9.5.03 (5 days) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03 (6 jours) Formation Siemens SIMATIC /Siemens SIMATIC Training : Introduction à STEP7 /Introduction to STEP7 : 3 & 4.6.03 (2 jours/2 days) Programmation STEP7/STEP7 Programming : 31.3 - 4.4.03 / 16 - 20.6.03 (5 jours/5 days) Réseau Simatic Net /Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 These courses will be given in French or English following the requests. Cours de sécurité : Etre TSO au CERN : Prochaines sessions : 24, 25 & 27.6....

  14. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : CLEAN-2002 : Working in a cleanroom (free course, registration required): 11.4.03 (half-day, afternoon, ) LabView Basics 2 : 10 - 11.4.03 (3 days) DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) AutoCAD 2002 - niveau 1 : 29, 30.4 et 7, 8.5.03 (4 jours) Oracle iDS Reports : Build Internet Reports : 5 - 9.5.03 (5 days) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03(6 jours) Formation Siemens SIMATIC /Siemens SIMATIC Training : Introduction à STEP7 /Introduction to STEP7 : 3 & 4.6.03 (2 jours/2 days) Programmation STEP7/STEP7 Programming : 31.3 - 4.4.03 / 16 - 20.6.03 (5 jours/5 days) Réseau Simatic Net /Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 These courses will be given in French or English following the requests. Cours de sécurité : Etre TSO au CERN : Prochaines sessions : 24, 25 & 27.6...

  15. Places available **

    CERN Multimedia

    2003-01-01

    Des places sont disponibles dans les cours suivants : Places are available in the following courses : C++ for Particle Physicists : 10 - 14.3.03 (6 X 3-hour lectures) Introduction to PVSS : 10.3.03 (half day, afternoon) Basic PVSS : 11 - 13.3.03 (3 days) PVSS - JCOP Framework Tutorial : 14.3.03 (1 day) CLEAN-2002 : Working in a cleanroom : 2.4.03 (half-day, afternoon, free course, registration required) LabView base 1/LabView Basics 1 : 9 - 11.4.03 (3 jours/3 days) Langue à définir/language to be decided DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) AutoCAD 2002 - niveau 1 : 29, 30.4 et 7, 8.5.03 (4 jours) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03 (6 jours) Formation Siemens SIMATIC /Siemens SIMATIC Training : Introduction à STEP7 /Introduction to STEP7 : 11 & 12.3.03 / 3 & 4.6.03 (2 jours/2 days) Programmation STEP7/STEP7 Programming : 31.3 - 4.4.03 / 16...

  16. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : Introduction to PVSS : 10.3.03 (half-day, afternoon) CLEAN-2002 : Working in a cleanroom : 2.4.03 (half-day, afternoon, free course, registration required) LabView Basics 1 : 9 - 11.4.03 (3 days) Language to be decided. DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures). AutoCAD 2002 - niveau 1 : 29, 30.4 et 7, 8.5.03 (4 jours) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03 (6 jours) Siemens SIMATIC Training: Introduction to STEP7 : 3 & 4.6.03 (2 days) STEP7 Programming : 31.3 - 4.4.03 / 16 - 20.6.03 (5 days) Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 These courses will be given in French or English following the requests. Cours de sécurité: Etre TSO au CERN : 3 sessions sont programmées pour 2003 : 25, 26 & 28.3.03 - 24, 25 & 27.6.03 - 4, 5 & 7.11.03 (sessions de 3 jours) ** The number o...

  17. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : CLEAN-2002 : Working in a cleanroom (free course, registration required) : 2.4.03 (half-day, afternoon) LabView base 1/LabView Basics 1 (Langue à définir/ language to be decided) : 9 - 11.4.03 (3 jours/3 days) DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) AutoCAD 2002 - niveau 1 : 29, 30.4 et 7, 8.5.03 (4 jours) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03(6 jours) Formation Siemens SIMATIC /Siemens SIMATIC Training : Introduction à STEP7 /Introduction to STEP7 : 3 & 4.6.03 (2 jours/2 days) Programmation STEP7/STEP7 Programming : 31.3 - 4.4.03 / 16 - 20.6.03 (5 jours/5 days) Réseau Simatic Net /Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 These courses will be given in French or English following the requests. Cours de sécurité : Etre TSO au CERN : 3 sessions sont programmées pour 2003 : 25...

  18. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses : CLEAN-2002 : Working in a cleanroom (free course, registration required): 11.4.03 (half-day, afternoon) LabView Basics 2 : 10 - 11.4.03 (3 days) DISP-2003 - Spring II Term : Advanced Digital Signal Processing : 30.4, 7, 14, 21.5.03 (4 X 2-hour lectures) AutoCAD 2002 - niveau 1 : 29, 30.4 et 7, 8.5.03 (4 jours) Oracle iDS Reports : Build Internet Reports : 5 - 9.5.03 (5 days) AutoCAD 2002 - niveau 2 : 5 & 6.5.03 (2 jours) AutoCAD Mechanical 6 PowerPack (F) : 12, 13, 20, 21, 27 & 28.5.03(6 jours) Formation Siemens SIMATIC /Siemens SIMATIC Training : Introduction à STEP7 /Introduction to STEP7 : 3 & 4.6.03 (2 jours/2 days) Programmation STEP7/STEP7 Programming : 16 - 20.6.03 (5 jours/5 days) Réseau Simatic Net /Simatic Net Network : 15 & 16.4.03 / 26 & 27.6.03 These courses will be given in French or English following the requests. Cours de sécurité : Etre TSO au CERN : Prochaines sessions : 24, 25 & 27.6.03 - 4, 5 & 7....

  19. PLACES AVAILABLE

    CERN Document Server

    Enseignement Technique; Tél. 74924; Technical Training; Monique Duval; Tel. 74924

    2000-01-01

    Places are available in the following courses : Premiers pas avec votre PC 12 - 15.9.00 (4 demi-journées) WORD 20, 21 et 26, 27.9.2000 (4 jours) JAVA programming level 1 25 - 26.9.2000 (2 days) Gaz inflammables 1 26.9.2000 (1 journée) Advanced aspects of PERL 5 6.10.2000 (1 day) Initiation au WWW 10 - 12.10.00 (3 demi-journées) WORD : importer et manipuler des images 16.10.2000 (1 journée) FileMaker 17, 18 et 24, 25.10.00 (4 jours) Nouveautés de WORD 19 et 20.10.2000 (2 jours) ACCESS 1er niveau 30 - 31.10.00 (2 jours)Introduction à PowerPoint 6.11.00 (1 journée)Nouveautés d’EXCEL 7.11.2000(4 demi-journées)Excel 13, 14 et 20, 21.11.00 (4 jours) LabView hands-on 13.11.2000(4 hours)LabView Basics 1 14 - 16.11.2000 (3 days) MS-Project 1er niveau 14-17.11.00 (4 demi-journées) If you wish to participate in one of these courses, please discuss with your supervisor and apply elec...

  20. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: LabView hands-on (bilingue/bilingual): 5.11.02 (matin/morning) LabView DAQ hands-on (bilingue/bilingual):  5.11.02  (après-midi afternoon) Introduction au PC et Windows 2000 au CERN:  6 & 7.11.02  (2 jours) Oracle 8i : Access the Database with Java:  7 & 8.11.02  (2 days) AutoCAD 2002 - niveau 2:  7 & 8.11.02  (2 jours) Introduction to PVSS (free of charge):  11.11.2002 pm  (1/2 day) Basic PVSS:  12 - 14.11.02  (3 days) EXCEL 2000 - niveau 1:  12 & 13.11.02  (2 jours) CLEAN-2002: Working in a Cleanroom (English, free of charge):  13.11.2002  (afternoon) LabView Base 1 :  13 - 15.11.02  (3 jours) AutoCAD 2002 - Level 1:  14, 15, 21, 22.11.2002  (4 days) LabVIEW - Advanced:  18 - 20.11.02  (3 days) Auto...

  1. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: LabView Base 1 :  23 - 25.9.02  (3 jours) Object-Oriented Analysis & Design using UML:  25 - 27.9.02  (3 days) LabView DAQ (E):  26 - 27.9.02  (2 days) Introduction to Oracle 8i : SQL and PL/SQL:  7 - 11.10.02  (5 days) CLEAN-2002 : Working in a Cleanroom (free of charge):  10.10.02  (half-day, p.m.) AutoCAD 2002 - niveau 2 :  14 - 15.10.02  (2 jours) Introduction à DesignSpace :  16.10.02  (1 journée) Introduction to DesignSpace:  17.10.02  (1 day) AutoCAD 2002 - Level 1:  17, 18, 24, 25.10.02  (4 days) AutoCAD Mechanical 6 PowerPack (F) :  21, 22, 23.10 et 4, 5, 6.11.02  (6 jours) Introduction à ANSYS/Introduction to ANSYS (langue à définir suivant demande/ Language to be chosen according to demand):...

  2. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: November 2002   LabView hands-on (bilingue/bilingual): 5.11.02 (matin/morning) LabView DAQ hands-on (bilingue/bilingual):  5.11.02  (après-midi afternoon) PCAD Schémas - Débutants :  5 & 6.11.02  (2 jours) PCAD PCB - Débutants :  9 - 11.11.02  (3 jours) Introduction au PC et Windows 2000 au CERN :  6 & 7.11.02  (2 jours) Oracle 8i : Access the Database with Java :  7 & 8.11.02  (2 days) Introduction to PVSS (free of charge):  11.11.2002 pm  (1/2 day) Basic PVSS:  12 - 14.11.02  (3 days) EXCEL 2000 - niveau 1 :  12 & 13.11.02  (2 jours) CLEAN-2002: Working in a Cleanroom (English, free of charge):  13.11.2002  (afternoon) LabView Base 1 :  13 - 15.11.02  (3 jours) AutoCAD 2002 - niveau 1 :  14, 15, 21, 22.11.02  (4 jours) LabVIEW - Advanced:  18 - 20.11.02  (3 days) Hands-on Object-Oriented Design and Programming with C++ :  19 - 21.11.02  (3 days)  LabVIEW - Basics 2:  21 - 22.11.02 ...

  3. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Java 2 Enterprise Edition - Part 2: Enterprise JavaBeans:  18 - 20.9.02  (3 days) AutoCAD 2002 - niveau 1 :  19, 20, 26, 27.9.02  (4 jours) LabView Base 1 :  23 - 25.9.02  (3 jours) Object-Oriented Analysis & Design using UML:  25 - 27.9.02  (3 days) LabView DAQ (E):  26 - 27.9.02  (2 days) Introduction to Oracle 8i : SQL and PL/SQL:  7 - 11.10.02  (5 days) CLEAN-2002 : Working in a Cleanroom (free of charge):  10.10.02  (half-day, p.m.) AutoCAD 2002 - niveau 2 :  14 - 15.10.02  (2 jours) Introduction à DesignSpace :  16.10.02  (1 journée) Introduction to DesignSpace:  17.10.02  (1 day) AutoCAD 2002 - Level 1:  17, 18, 24, 25.10.02  (4 days) AutoCAD Mechanical 6 PowerPack (F) :  21, 22, 23.10 et 4, 5, 6.11....

  4. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Introduction à DesignSpace :  16.10.02  (1 journée) AutoCAD Mechanical 6 PowerPack (F) :  21, 22, 23.10 et 4, 5, 6.11.02  (6 jours) Introduction à ANSYS 21 - 25.10.02  (5 jours/days) HREF-2002: Helium Refrigeration Techniques (English-French, bilingual) :  21 - 25.10.2002  (7 half days) LabVIEW Basics 1 (English):  21 - 23.10.02  (3 days) LabVIEW Basics 2 (English):  24 & 25.10.02  (2 days) Oracle 8i : Access the Database with Java:  7 & 8.11.02  (2 days) AutoCAD 2002 - niveau 2 :  7 & 8.11.02  (2 jours) AutoCAD 2002 - Level 1:  14, 15, 21, 22.11.02  (4 days) LabVIEW - Advanced (English) :  18 - 20.11.2002  (3 days) AutoCAD 2002 - niveau 1 :  19, 20, 25, 26.11.02 (4 jours) Oracle iDS Designer: First Class:&...

  5. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Introduction to Oracle 8i : SQL and PL/SQL:  7 - 11.10.02  (5 days) CLEAN-2002 : Working in a Cleanroom (free of charge):  10.10.02  (half-day, p.m.) AutoCAD 2002 - niveau 2 :  14 - 15.10.02  (2 jours) Introduction à DesignSpace :  16.10.02  (1 journée) Introduction to DesignSpace:  17.10.02  (1 day) AutoCAD 2002 - Level 1:  17, 18, 24, 25.10.02  (4 days) AutoCAD Mechanical 6 PowerPack (F) :  21, 22, 23.10 et 4, 5, 6.11.02  (6 jours) Introduction à ANSYS/Introduction to ANSYS (langue à définir suivant demande/ Language to be chosen according to demand):  21 - 25.10.02  (5 jours/days) HREF-2002: Helium Refrigeration Techniques (English-French, bilingual) :  21 - 25.10.2002  (7 half days) HREF-2002: Techniques de la Réfri...

  6. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: PIPES-2003 - Pratique du sertissage de tubes métalliques et multicouches :26.8.03(stage pratique) The CERN EDMS for Engineers (free of charge) : 27.8.03 (1 day) CLEAN-2002 : Travailler en salle blanche (séminaire gratuit) : 4.9.03(une demi-journée) The CERN EDMS for Local Administrators (free of charge) : 24 & 25.9.03 (2 days) HeREF-2003 : Techniques de la réfrigération Hélium (cours en français avec support en anglais) : 6 - 10.10.2003 (7 demi-journées) The Java Programming Language Level 1 : 6 - 7.10.2003 (2 days) Java 2 Enterprise Edition - Part 2 : Enterprise JavaBeans : 8 - 10.10.2003 (3 days) FileMaker - niveau 1 : 9 & 10.10.03 (2 jours) EXCEL 2000 - niveau 1 : 20 & 22.10.03 (2 jours) AutoCAD 2002 - niveau 1 : 20, 21, 27, 28.10.03 (4 jours) CLEAN-2002 : Working in a Cleanroom (free of charge) : 23.10.03 (half day) AutoCAD Mechanical 6 PowerPack (E) : 23, 24, 30, 31.10 & 12, 13.11.03 (6 days) AutoCAD 2002 - niveau 2...

  7. PLACES AVAILABLE

    CERN Multimedia

    Monique Duval

    2002-01-01

    Places are available in the following courses: Introduction to Oracle 8i : SQL and PL/SQL:  7 - 11.10.02  (5 days) CLEAN-2002 : Working in a Cleanroom (free of charge):  10.10.02  (half-day, p.m.) LabView Hands-on (bilingue/bilingual) : 10.10.02 (matin/morning) LabView DAQ Hands-on (bilingue/bilingual)  10.10.02 (après-midi /afternoon) Introduction à DesignSpace :  16.10.02  (1 journée) Introduction to DesignSpace:  17.10.02  (1 day) AutoCAD Mechanical 6 PowerPack (F) :  21, 22, 23.10 et 4, 5, 6.11.02  (6 jours) Introduction à ANSYS/Introduction to ANSYS (langue à définir suivant demande/ Language to be chosen according to demand):  21 - 25.10.02  (5 jours/days) HREF-2002: Helium Refrigeration Techniques (English-French, bilingual) :  21 - 25.10.2002  (7 half days) HREF-2002: Techniques de la...

  8. Places available**

    CERN Multimedia

    2003-01-01

    Places are available in the following courses: The CERN EDMS for Local Administrators : 24 & 25.9.03 (2 days, free of charge) HeREF-2003 : Techniques de la réfrigération Hélium cours en français avec support en anglais) : 6 - 10.10.2003 (7 demi-journées) The Java Programming Language Level 1 : 6 - 7.10.2003 (2 days) Java 2 Enterprise Edition - Part 2 : Enterprise JavaBeans : 8 - 10.10.2003 (3 days) FileMaker - niveau 1 : 9 & 10.10.03 (2 jours) EXCEL 2000 - niveau 1 : 20 & 22.10.03 (2 jours) AutoCAD 2002 - niveau 1 : 20, 21, 27, 28.10.03 (4 jours) CLEAN-2002 : Working in a Cleanroom : 23.10.03 (half day, free of charge) AutoCAD 2002 - Level 1 : 3, 4, 12, 13.11.03 (4 days) AutoCAD 2002 - niveau 2 : 10 & 11.11.03 (2 jours) ACCESS 2000 - niveau 1 : 13 & 14.11.03 (2 jours) AutoCAD Mechanical 6 PowerPack (E) : 17, 18, 24, 25.11 & 1, 2.12.03 (6 days) FrontPage 2000 - niveau 1 : 20 & 21.11.03 (2 jours) MAGNE-03 : Magnétisme pour l'électrotechnique : 25 - 27.11.03 (3 jours) ...

  9. PLACES AVAILABLE

    CERN Multimedia

    Technical Training; Tel. 74924

    2001-01-01

    Places are available in the following courses: Nouveautés d'EXCEL : 5.11.01 (1/2 journée) Introduction a Windows 2000 au CERN : 6.11.01 (1/2 journée) UNIX pour non-programmeurs : 5 - 7.11.01 (3 jours) Design Patterns :  7 - 8.11.01 (2 days) The Java programming language Level 1: 8 - 9.11.01 (2 days) Automates et réseaux de terrain : 13 & 14.11.01 (3 jours) Introduction à Windows 2000 au CERN : 12 - 14.11.01 (1/2 journée) Introduction to Windows 2000 at CERN :  14.11.01  (half-day) Introduction to PERL 5 :  15 - 16.11.01  (2 days) Introduction to C Programming :  21- 23.11.01 (3 days) Programmation TSX Premium 2 : 26 - 30.11.01 (5 jours) Contract Follow-up (F) : 26.11.01 (1/2 journée) Object-Oriented Analysis and Design :  27 - 30.11.2001  (4 days) Hands-on Object-Oriented Design and Programming with C++ :  11 - 13.12.2...

  10. Concentrations of Available Heavy Metals in Mediterranean Agricultural Soils and their Relation with Some Soil Selected Properties: A Case Study in Typical Mediterranean Soils

    Directory of Open Access Journals (Sweden)

    José Rato Nunes

    2014-12-01

    Full Text Available The characterization of the content of trace metals in soils is an instrument in many programs of environmental protection, including the establishment of regional-level standards to detect sites affected by contamination. The objectives of the present study were to study the available levels of Cd, Cr, Cu, Ni, Pb, and Zn in surface horizons of agricultural soils in a typical European Mediterranean region, to establish the geochemical baseline concentration (GBC, background level (BL, and reference value (RV of each of these available metals, and to investigate their possible correlations with soil properties. To establish the GBC and RV values, we used the “standard threshold method”. Topsoil samples (0–20 cm were collected from 630 sites, and extracted with Diethylene Triamine Pentaacetic Acid (DTPA to determine their available heavy metal concentrations. The GBC values established were: 0.04 to 0.90 mg kg−1, 0.70 to 2.50 mg kg−1, 0.10 to 6.30 mg kg−1, 0.30 to 7.90 mg kg−1, 0.29 to 4.50 mg kg−1, and 0.18 to 2.50 mg kg−1 for Cd, Cr, Cu, Ni, Pb, and Zn, respectively. Soil properties were found to be correlated with the available heavy metal content, suggesting that the enhanced mobility of heavy metals are related to anthropic activities.

  11. [Not Available].

    Science.gov (United States)

    Hainschitz, I; Rieger, K; Siegl, H

    2002-06-01

    In Austria an index of 3 μg/kg of Ochratoxin A for coffee, 0,3 μg/kg for fruit juices and 0,2 μg/kg for beer is discussed. The laboratory of the food inspection authority of the state of Vorarlberg investigated the contribution of selected foodstuffs to the daily OTA intake and compared it with the recommendation of the scientific food committee of the EC. The focal point of this study was on beverages (coffee, coffee substitutes, beer and fruit juices) and their ingredients.ZUSAMMENFASSUNG: Die Untersuchungsergebnisse von Bier, Fruchtsaft und Kaffee [Diagramm 1] zeigen, dass die Mehrzahl der Proben nur sehr schwach bis gar nicht belastet waren. Die OTA-Belastung lag bei der Mehrzahl der Proben unter der Nachweisgrenze von 0,3 μg/kg bzw. 0,01μg/1. Einzelne Proben waren aber erheblich belastet, sodass bei starkem Konsum (Fruchtsaft im Sommer) eine überschreitung der vom SCF vorgeschlagenen Höchstmenge nicht auszuschließen ist. Die Ergebnisse der Kaffeemitteluntersuchung [Diagramm 2] belegen eine höhere OTA-Belastung bei mehr als der Hälfte der Proben. Wenn die vom SCF vorgeschlagene Höchstaufnahme von 5 ng pro Tag und kg Körpergewicht zu Grunde gelegt wird, resultiert für eine 60 kg schwere Person ein Wert von 0,3 μg/Tag. Das bedeutet bei einem mit 100 μg/kg OTA kontaminierten Kaffeeersatz und dem Konsum nur einer Tasse (5 - 7 g Pulver), dass alleine aus dieser Quelle diese Höchstaufnahme deutlich überschritten wird. Der Eintrag über die restliche Nahrung wie Cerealien, die für etwa die Hälfte der OTA-Aufnahme verantwortlich sind, bleibt hier unberücksichtigt. Die Untersuchungen belegen, dass die Einhaltung der in österreich vorgeschlagenen Richtwerte bei Bier, Fruchtsäften und Kaffee keine Schwierigkeiten bereitet. Für Kaffeemittel und andere Trockenfrüchte als Weintrauben [3] wurde allerdings noch kein Richtwert vorgeschlagen. Die Ergebnisse belegen aber, dass gerade für Kaffemittel und verschiedene Trockenfrüchte vor dem Hintergrund

  12. Indutores de mudança na formação dos profissionais de saúde: pró-saúde e PET-SAÚDE

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    Full Text Available Na última década, a formação de profissionais de saúde tem sido reformulada no intuito de atender às necessidades de saúde das pessoas e não somente suas demandas. Políticas públicas de educação e saúde promovidas em parceria com o Ministério da Educação (MEC e o Ministério da Saúde (MS sinalizaram uma reforma curricular imprescindível nos cursos de graduação da área de saúde(1,2 .A formalização dessa mudança teve seu marco com a instituição das Diretrizes Curriculares Nacionais (DCN para os cursos de graduação no campo da saúde. Todos os instrumentos vigentes orientam a construção do perfil dos egressos por meio de um modelo acadêmico e profissional em que atitudes, habilidades e conteúdos almejem a formação generalista, humanista, crítica e reflexiva, com competência para a atuação em todos os níveis de atenção à saúde, embasando suas condutas nos rigores científico e ético(3-7.Não por acaso, todos os documentos ressaltam os mesmos campos de competência a serem desenvolvidos durante a formação dos diferentes profissionais da área: atenção à saúde, tomada de decisões, comunicação, liderança, educação permanente, administração e gerenciamento(3-7, pois a saúde, como um complexo campo de atuação, não consegue imprimir ações resolutivas através de uma única disciplina ou área do saber.A proposta preconizada pelo MEC e MS de produzir transformação nos processos de formação, trabalho e ampliação da cobertura dos serviços tem sido concretizada mediante programas indutores, como o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para a Saúde (PET–Saúde(1,2.O Pró-Saúde, implementado no país desde 2005 através da divulgação de editais, pretende sintonizar a formação em saúde com as necessidades sociais, considerando as dimensões históricas, culturais e econômicas da população(8

  13. The Staphylococcus aureus Membrane Protein SA2056 Interacts with Peptidoglycan Synthesis Enzymes

    Directory of Open Access Journals (Sweden)

    Brigitte Berger-Bächi

    2013-01-01

    Full Text Available The yet uncharacterized membrane protein SA2056 belongs to the ubiquitous RND (Resistance-Nodulation-cell Division family of transmembrane efflux transporters. The sa2056 gene is located downstream of femX, the gene encoding the essential, non-ribosomal peptidyl-transferase adding the first glycine in the staphylococcal cell wall pentaglycine interpeptide. Due to its proximity to and weak co-transcription with femX, we assumed that sa2056 may somehow be involved in peptidoglycan synthesis. Specific antibodies against SA2056 showed that this protein is expressed during growth and present in the membrane fraction of cell preparations. Using a bacterial two hybrid system, SA2056 was shown to interact (i with itself, (ii with FemB, which adds glycines 4 and 5 to the peptidoglycan interpeptide and (iii with the essential penicillin binding proteins, PBP1 and PBP2, required for cell division and incorporation of the peptidoglycan into the cell wall. Unexpectedly, deletion of sa2056 led to no phenotype regarding growth, antibiotic resistances or cell morphology; nor did sa2056 deletion in combination with femB inactivation alter b-lactam and lysostaphin sensitivity and resistance, respectively, pointing to possible redundancy in the cell wall synthesis pathway. These results suggest an accessory role of SA2056 in S. aureus peptidoglycan synthesis, broadening the range of biological functions of RND proteins.

  14. Data of evolutionary structure change: 1A4SA-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SA-2ONNF 1A4S 2ONN A F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...HHHHH ------ EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- ... 2ONN F 2ONNF

  15. Programa de saúde mental Programme in mental health

    Directory of Open Access Journals (Sweden)

    Cid Guimarães

    1975-12-01

    Full Text Available É apresentado o programa de Saúde Mental decorrente de convênio estabelecido pela Secretaria da Saúde do Estado de São Paulo com a Universidade de São Paulo, através da Faculdade de Saúde Pública. Este convênio tem por finalidade a realização de estudos na área de Saúde Mental, tais como assistência psiquiátrica preventiva e pesquisas visando a medir transtornos mentais através de casos de óbito e na população da cidade e de cursos e atividades curriculares e extra-curriculares.The School of Public Health is conducting a project, sponsored by the Health Department of the State of S. Paulo Government, aiming at: studying the integration of a team of mental health workers in a polivalent community health center; carrying out two large surveys on the incidence and prevalence of mental disorders and some of their characteristics; promoting courses and seminars on Mental Health for the personnel of Community Health Centers.

  16. Fonoaudiologia em saúde pública

    Directory of Open Access Journals (Sweden)

    Regina M. Freire

    1992-06-01

    Full Text Available Objetivou-se obter o entendimento das funções do fonoaudiólogo enquanto profissional da saúde. Discutem-se as dificuldades ligadas à implantação de um serviço novo, estranho às Unidades Básicas de Saúde. A seguir, analisa-se a demanda pelo serviço de Fonoaudiologia em postos de saúde, e verifica-se que 32% da população que busca esse serviço está em idade escolar e vem encaminhada pelas escolas, com queixa de problemas de aprendizagem. Uma aproximação maior dessas crianças, através do atendimento fonoaudiológico, delineia uma outra realidade: a de que não se pode considerar como distúrbio/desvio/problema/patologia marcas gráficas que se constituem como indícios do choque entre o processo de letramento e o de alfabetização. Entendendo a problemática do ponto de vista da saúde pública, propõe-se um programa de atendimento ao professor, cujo objetivo é o esclarecimento da escola com relação ao seu papel de co-construtora do processo de letramento da criança, devolvendo-lhe a responsabilidade pelo sucesso e/ou fracasso da alfabetização.

  17. Saúde e meio ambiente nas cidades: os desafios da saúde ambiental

    Directory of Open Access Journals (Sweden)

    Nelson Gouveia

    1999-02-01

    Full Text Available Dentro de alguns poucos anos, nosso planeta contará com mais habitantes em áreas urbanas do que em áreas rurais. A urbanização desenfreada, sem mecanismos regulatórios e de controle, típica dos países periféricos, trouxe consigo enormes repercussões na saúde da população. Problemas como a insuficiência dos serviços básicos de saneamento, coleta e destinação adequada do lixo e condições precárias de moradia, tradicionalmente relacionados com a pobreza e o subdesenvolvimento, somam-se agora à poluição química e física do ar, da água e da terra, problemas ambientais antes considerados "modernos". Novamente, é sobre as populações mais carentes que recai a maior parte dos efeitos negativos da urbanização, gerando uma situação de extrema desigualdade e iniqüidade ambiental e em saúde. Para reverter esse quadro é preciso que haja uma reincorporação das questões do meio ambiente nas políticas de saúde, e a integração dos objetivos da saúde ambiental numa ampla estratégia de desenvolvimento sustentável. Uma abordagem mais integrada, com mecanismos intersetoriais que possibilitem um diálogo amplo entre as partes, trará enormes benefícios na conquista de melhores condições de vida nas cidades. A saúde ambiental hoje tem o desafio de promover uma melhor qualidade de vida e saúde nas cidades e a oportunidade de enfrentar o absurdo quadro de exclusão social, sob a perspectiva da eqüidade.In a matter of few years there will be more urban than rural dwellers worldwide. The rapid urbanisation lacking adequate control and regulatory mechanisms typical of developing countries, brought along huge effects to the health of the population Environmental problems traditionally related to poverty and underdevelopment such as insufficient provision of sanitation services, waste collection and disposal, and precarious housing conditions, are now added to environmental problems considered of "modern life" such as the

  18. Cobertura de Planos de Saúde na população brasileira, segundo a Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    Full Text Available Resumo O objetivo do estudo é descrever as coberturas de planos de saúde no Brasil, conforme características sociodemográficas, a partir dos dados da Pesquisa Nacional de Saúde, realizada em 2013, e comparar com dados administrativos da Agencia Nacional de Saúde Suplementar para este mesmo ano. Foram utilizados dados da Pesquisa Nacional de Saúde e do Sistema de Informações de Beneficiários da Agência Nacional de Saúde para o ano de 2013. Foi descrita a cobertura dos planos de saúde segundo estratificação para Brasil, urbano/rural, Grandes Regiões, Unidades da Federação e Capitais, sexo, faixa etária, nível de instrução, posição na força de trabalho, cor/raça e estado de saúde. Como resultado, a proporção de pessoas que referiu ter algum plano de saúde no Brasil foi de 27,9% (IC95%: 27,1-28,8. Foi observada diferença significativa com relação a nível de instrução, sendo maior para os que referiram ter educação superior completa (68,8% IC95%: 67,2-70,4 e para aqueles que referiram ter ocupação (32,5% IC95%: 31,5-33,5. O aumento da cobertura de planos de saúde na população brasileira reflete a melhora da oferta de empregos e do crescimento da economia do país na época.

  19. Nas Trilhas (desconhecidas da saúde: a política pública de saúde para os homens no Brasil.

    Directory of Open Access Journals (Sweden)

    Marlene Neves Strey

    2012-11-01

    Full Text Available Neste estudo abordamos as diferentes formas de masculinidades e sua relação com a saúde, contempladas na Política de Atenção Integral à saúde do Homem (PNAISH implementada no Brasil no ano de 2009. Através de uma análise documental dessa política, pretendemos compreender os discursos masculinos que nela estão, bem como analisar a relação entre o discurso da política e as diferentes formas de produção de saúde. Devido a não estarem acostumados a se expor a um profissional de saúde, os homens sentem-se envergonhados, e além disso, atribuem sua baixa procura aos serviços de saúde, à falta de cuidados e escuta adequadas com um olhar de gênero que possa dar conta de suas demandas. Essa nova política de saúde para os homens criada no Brasil pretende atuar de maneira a atingir uma mudança cultural, que possibilite aos homens maior cuidado com sua saúde. Além disso, olhar para os modos de produção de masculinidades nos dias atuais e seus discursos sobre saúde é estar atento aos comportamentos que, devido à herança pautada nas diferenças entre os sexos, contribui para obstaculizar o acesso dos homens aos serviços de saúde.

  20. A política de saúde bucal em pauta no Conselho Municipal de Saúde no Município de Nova Friburgo - RJ

    Directory of Open Access Journals (Sweden)

    Rafael Gomes Ditterich

    Full Text Available Objetivo O presente estudo teve como objetivo analisar, por meio dos documentos técnicos do Conselho Municipal de Saúde (CMS, a organização dos serviços de saúde bucal no Município de Nova Friburgo - RJ, a partir da institucionalização da Política Nacional de Saúde Bucal. Metodologia Para a análise documental, utilizou-se o registro de frequência e categorização por assunto: saúde bucal das atas do CMS de junho/2006 a agosto/2011, do Plano Municipal de Saúde de 2003-2005 e 2010-2013, e os documentos encaminhados entre 2005 e 2011. Resultado Os registros analisados até 2012 indicaram que a população estava desassistida na questão da média complexidade, como também no acesso à água fluoretada. As equipes de saúde bucal ainda não tinham sido qualificadas e ampliadas, como é bem colocado como prioridade no Brasil Sorridente. O Município ainda não desenvolvia programas de prevenção e promoção de saúde bucal de forma contínua e efetiva. Conclusão Concluiu-se que a Política Nacional de Saúde Bucal, até o ano de 2012, não tinha ainda reflexo nas ações de saúde bucal em Nova Friburgo.

  1. Possibilidades do WHOQOL-bref para a promoção da saúde na estratégia saúde da família

    Directory of Open Access Journals (Sweden)

    Anna Maria Chiesa

    2011-12-01

    Full Text Available A ampliação das ações de promoção da saúde na Estratégia Saúde da Família pode contribuir para a construção da integralidade, mas, ainda persistem lacunas de tecnologias para instrumentalizar os profissionais a analisarem os potenciais de saúde da população. O objetivo deste estudo é sintetizar as contribuições do WHOQOL-bref para instrumentalizar ações de promoção da saúde na Estratégia Saúde da Família. Foi realizada uma metassíntese qualitativa a partir de pesquisas realizadas pelo grupo Modelos tecnoassistenciais e a promoção da saúde com o uso do WHOQOL-bref e sua interface com a promoção da saúde. As sínteses das cinco pesquisas mostraram que existem relações conceituais entre os domínios do WHOQOL-bref e a promoção da saúde, legitimando este como um instrumento para a promoção da saúde. A utilização do WHOQOL-bref pode facilitar o vinculo e o cuidado longitudinal na Estratégia Saúde da Família.

  2. Compilation of selected marine radioecological data for the US Subseabed Program: Summaries of available radioecological concentration factors and biological half-lives

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, L.S.; Marietta, M.G.; Jackson, D.W.

    1987-04-01

    The US Subseabed Disposal Program has compiled an extensive concentration factor and biological half-life data base from the international marine radioecological literature. A microcomputer-based data management system has been implemented to provide statistical and graphic summaries of these data. The data base is constructed in a manner which allows subsets to be sorted using a number of interstudy variables such as organism category, tissue/organ category, geographic location (for in situ studies), and several laboratory-related conditions (e.g., exposure time and exposure concentration). This report updates earlier reviews and provides summaries of the tabulated data. In addition to the concentration factor/biological half-life data base, we provide an outline of other published marine radioecological works. Our goal is to present these data in a form that enables those concerned with predictive assessment of radiation dose in the marine environment to make a more judicious selection of data for a given application. 555 refs., 19 figs., 7 tabs.

  3. Antioxidant activity and polyphenol and procyanidin contents of selected commercially available cocoa-containing and chocolate products in the United States.

    Science.gov (United States)

    Miller, Kenneth B; Stuart, David A; Smith, Nancy L; Lee, Chang Y; McHale, Nancy L; Flanagan, Judith A; Ou, Boxin; Hurst, W Jeffrey

    2006-05-31

    In the United States, commercially available foods, including cocoa and chocolate, are being marketed with statements referring to the level of antioxidant activity and polyphenols. For cocoa-containing foods, there has been no comprehensive survey of the content of these and other chemistries. A survey of cocoa and chocolate-containing products marketed in the United States was conducted to determine antioxidant activity and polyphenol and procyanidin contents. Commercially available samples consisted of the top market share products in each of the following six categories: natural cocoa, unsweetened baking chocolate, dark chocolate, semisweet baking chips, milk chocolate, and chocolate syrup. Composite samples were characterized using four different methods: oxygen radical absorbance capacity (ORAC), vitamin C equivalence antioxidant capacity (VCEAC), total polyphenols, and procyanidins. All composite lots were further characterized for percent nonfat cocoa solids (NFCS) and percent fat. Natural cocoas had the highest levels of antioxidant activities, total polyphenols, and procyanidins followed by baking chocolates, dark chocolates and baking chips, and finally milk chocolate and syrups. The results showed a strong linear correlation between NFCS and ORAC (R (2) = 0.9849), total polyphenols (R (2) = 0.9793), and procyanidins (R (2) = 0.946), respectively. On the basis of principal component analysis, 81.4% of the sample set was associated with NFCS, antioxidant activity, total polyphenols, and procyanidins. The results indicated that, regardless of the product category, NFCS were the primary factor contributing to the level of cocoa antioxidants in the products tested. Results further suggested that differences in cocoa bean blends and processing, with the possible exception of Dutching, are minor factors in determining the level of antioxidants in commercially available cocoa-containing products in the United States.

  4. KELEMBAGAAN DAN STRATEGI PENINGKATAN DAYA SAING KOMODITAS CABAI KAPUPATEN GARUT

    Directory of Open Access Journals (Sweden)

    Silmi Tsurayya

    2015-03-01

    Full Text Available The objectives of this study were to identify supply chains, analyze the institutions, formulate strategies for competitiveness enhancement, design competitiveness enhancement model, and determine the main strategies in competitiveness enhancement of chili pepper in Garut District. This study used primary data (observations, interviews, and questionnaires and secondary data (literature study. The data were processed and analyzed by Descriptive Analysis, SWOT Analysis, the House Model, and Pairwise Comparison. The results of this study showed that: 1 there were 6 supply chain structures in chili pepper distribution; 2 the major institutional sectors contributed to competitiveness enhancement of chili pepper including public sector, voluntary sector, and private sector; 3 SWOT Analysis obtained 15 alternative strategies; 4 the House Model as competitiveness enhancement model had 3 pillars consisting of products, human resource, and institutional and marketing; 5 the main strategies in competitiveness enhancement of chili pepper included Increase in the number of productions, Market expansion, and Partnership Strengthening and development. The managerial implications of the study suggest: 1 land expansion and plant arrangement pattern to ensure continuity of production quantities; 2 Optimization of the role of Agribusiness Sub-Terminal as the marketing institution; and 3 Maximization in the government’s role in facilitating farmer groups with associations or corporations.Keywords: institutional, the house model, competitiveness, chili, SWOTABSTRAKPenelitian ini bertujuan mengidentifikasi rantai pasok, menganalisis kelembagaan, merumuskan strategi peningkatan daya saing, merancang model peningkatan daya saing, dan menentukan strategi utama dalam peningkatan daya saing  komoditas cabai di Kabupaten Garut. Data yang digunakan terdiri dari data primer (observasi, wawancara, dan kuesioner dan data sekunder (studi literatur. Metode pengolahan dan

  5. WRKY Transcription Factors Involved in Activation of SA Biosynthesis Genes

    Directory of Open Access Journals (Sweden)

    Bol John F

    2011-05-01

    Full Text Available Abstract Background Increased defense against a variety of pathogens in plants is achieved through activation of a mechanism known as systemic acquired resistance (SAR. The broad-spectrum resistance brought about by SAR is mediated through salicylic acid (SA. An important step in SA biosynthesis in Arabidopsis is the conversion of chorismate to isochorismate through the action of isochorismate synthase, encoded by the ICS1 gene. Also AVRPPHB SUSCEPTIBLE 3 (PBS3 plays an important role in SA metabolism, as pbs3 mutants accumulate drastically reduced levels of SA-glucoside, a putative storage form of SA. Bioinformatics analysis previously performed by us identified WRKY28 and WRKY46 as possible regulators of ICS1 and PBS3. Results Expression studies with ICS1 promoter::β-glucuronidase (GUS genes in Arabidopsis thaliana protoplasts cotransfected with 35S::WRKY28 showed that over expression of WRKY28 resulted in a strong increase in GUS expression. Moreover, qRT-PCR analyses indicated that the endogenous ICS1 and PBS3 genes were highly expressed in protoplasts overexpressing WRKY28 or WRKY46, respectively. Electrophoretic mobility shift assays indentified potential WRKY28 binding sites in the ICS1 promoter, positioned -445 and -460 base pairs upstream of the transcription start site. Mutation of these sites in protoplast transactivation assays showed that these binding sites are functionally important for activation of the ICS1 promoter. Chromatin immunoprecipitation assays with haemagglutinin-epitope-tagged WRKY28 showed that the region of the ICS1 promoter containing the binding sites at -445 and -460 was highly enriched in the immunoprecipitated DNA. Conclusions The results obtained here confirm results from our multiple microarray co-expression analyses indicating that WRKY28 and WRKY46 are transcriptional activators of ICS1 and PBS3, respectively, and support this in silico screening as a powerful tool for identifying new components of stress

  6. Genome sequencing and annotation of Morganella sp. SA36

    Directory of Open Access Journals (Sweden)

    Samy Selim

    2015-12-01

    Full Text Available We report draft genome sequence of Morganella sp. Strain SA36, isolated from water spring in Aljouf region, Saudi Arabia. The draft genome size is 2,564,439 bp with a G + C content of 51.1% and contains 6 rRNA sequence (single copies of 5S, 16S & 23S rRNA. The genome sequence can be accessed at DDBJ/EMBL/GenBank under the accession no. LDNQ00000000.

  7. Gripe Suína: Saúde em destaque

    Directory of Open Access Journals (Sweden)

    HELOÍZA FELTRIN BANDEIRA

    2009-05-01

    Full Text Available

    O texto tem por objetivo analisar alguns

    fatos ligados à crise mundial na saúde causada pelo

    virus da Influenza A.

  8. Percepção de gerentes sobre a assistência à saúde coletiva

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    2002-02-01

    Full Text Available Este estudo tem como objetivo conhecer a percepção de gestores e gerentes dos serviços de saúde sobre a assistência à saúde coletiva no contexto do Sistema Único de Saúde (SUS no Distrito Federal (DF. Trata-se de uma pesquisa qualitativa realizada por meio de entrevistas semi-estruturadas com gestores e gerentes da Regional Norte de Saúde do Distrito Federal. Conclui-se que a implantação dos princípios do SUS ainda é um desafio a ser enfrentado, tanto pela comunidade como pelos profissionais de saúde, que precisam unir esforços para encontrar estratégias que redirecionem a assistência à saúde coletiva.

  9. Prefeitos eleitos, descentralização na saúde e os compromissos com o SUS

    Directory of Open Access Journals (Sweden)

    Lenaura de Vasconcelos Costa Lobato

    Full Text Available O artigo analisa a municipalização na saúde por meio das proposições para a política de saúde de prefeitos eleitos no ano de 2012. Realizou-se análise documental das plataformas de governo dos então candidatos e de documentos oficiais da política e da gestão municipais de saúde - Relatórios das Conferências Municipais de Saúde e Planos Municipais de Saúde - de 24 municípios brasileiros nas cinco regiões do País. Os resultados indicam que os programas das candidaturas, em geral, incorporam a defesa do direito à saúde, embora principalmente através da ampliação da oferta de serviços médicos.

  10. Biogas: a renewable energy? How to master its production and to select its way of valorization?; Biogaz: une energie renouvelable? Comment maitriser sa production et choisir son mode de valorisation?

    Energy Technology Data Exchange (ETDEWEB)

    Verchin, J.C. [ATEE, CLub Biogaz, 94 - Arcueil (France); Metivier, D. [Ministere de l' Economie, des Finances et de l' Industrie, 75 - Paris (France). Direction Generale de L' Energie et des Matieres Premieres; Dumas, B. [Solagro, 31 - Toulouse (France)] [and others

    2000-12-01

    This document brings together 13 testimonies of experts about the development and valorization of biogas (methane): 1 - presentation of the Biogas Club; 2 - status of biogas regulation: French policy, the available means for developing the valorization of biogas, European overview; 3 - overview of the different methanation processes: methanation of municipal wastes, the Danish experience, the processing of municipal waste using the DRANCO system, the KOMPOGAS Compact process for small methanation facilities; 4 - the valorization techniques: power generation, the suitability of thermal valorization with medium-size waste disposal centers, the injection of methane in the French natural gas network, biogas as a local source of renewable fuel in Germany, France and Netherlands. (J.S.)

  11. Investigation of pyrrolizidine alkaloids including their respective N-oxides in selected food products available in Hong Kong by liquid chromatography electrospray ionisation mass spectrometry.

    Science.gov (United States)

    Chung, Stephen W C; Lam, Aaron C H

    2017-07-01

    This study determined the levels of pyrrolizidine alkaloids (PAs), including their respective N-oxides, in foodstuffs available in Hong Kong by liquid chromatography-electrospray ionisation tandem mass spectrometry. A total of 234 samples (48 food items) were collected randomly from a local market and analysed. About 50% of samples were found to contain detectable amount of PAs. Amongst the 48 food items, PAs were not detected in 11 food items, including barley flour, beef, cattle liver, pork, pig liver, chicken meat, chicken liver, milk, non-fermented tea, Melissa tea and linden tea. For those found to contain detectable PAs, the summed PA content ranged up to 11,000 µg kg(-1). The highest sum of PA content among the 37 food items calculated with lower bound was cumin seed, then followed by oregano, tarragon and herbs de Provence with ranges of 2.5-11,000, 1.5-5100, 8.0-3300 and 18-1300 µg kg(-1) respectively. Among the samples, the highest sum of PA content was detected in a cumin seed sample (11,000 µg kg(-1)), followed by an oregano (5100 µg kg(-1)), a tarragon (3300 µg kg(-1)) and a herbs de Provence (1300 µg kg(-1)). In general, the results of this study agreed well with other published results in peer-reviewed journals, except that the total PAs in honey and specific tea infusion in this study were comparatively lower.

  12. Pesquisa Mundial de Saúde: aspectos metodológicos e articulação com a Organização Mundial da Saúde World Health Survey: methodological aspects and interface with the World Health Organization

    Directory of Open Access Journals (Sweden)

    Célia Landmann Szwarcwald

    2008-05-01

    Full Text Available No ano 2000, o Relatório da Organização Mundial de Saúde (OMS foi dedicado à proposição de uma metodologia para a avaliação de desempenho dos sistemas de saúde dos países membros. O Relatório 2000 trouxe à agenda da OMS o comprometimento com os objetivos louváveis de avaliação dos sistemas de saúde, monitoramento das desigualdades em saúde e alcance da equidade no financiamento da saúde. Entretanto, o instrumental utilizado foi exposto a inúmeras críticas, tanto de cunho metodológico como conceitual. Como parte deste processo, para suprir informações sobre o estado de saúde das populações, a OMS propôs a elaboração da Pesquisa Mundial de Saúde (PMS em vários países membros. No Brasil, a PMS foi conduzida no ano de 2003, e objetivou estabelecer parâmetros consistentes para avaliar o estado de saúde da população e a assistência prestada de acordo com as expectativas da população usuária, além de mensurar as desigualdades socioeconômicas em saúde. O inquérito foi realizado em 5000 indivíduos com 18 anos e mais de idade, em âmbito nacional. A amostragem foi realizada em três estágios. No primeiro, foram selecionados 250 setores censitários, com probabilidade proporcional ao tamanho. Em cada setor, foram selecionados 20 domicílios, por amostragem inversa. Em cada domicílio, um morador adulto foi selecionado com eqüiprobabilidade. O questionário modular, originalmente desenvolvido pela OMS, foi adaptado para se adequar às características do nosso meio. Nesse artigo, são descritos os aspectos metodológicos da pesquisa e o processo de articulação com a Organização Mundial da Saúde para a condução da PMS no Brasil.The World Health Organization (WHO Report, year 2000, was dedicated to the proposition of a methodology for health system performance assessment of member countries. Despite its laudable goals of evaluating health system responsiveness and of monitoring inequalities in health

  13. Investigating aspects of explicitation in sometranslations of Sa'di's Golestan based on a parallel corpus

    Directory of Open Access Journals (Sweden)

    محمد رضا پهلوان نژاد

    2010-12-01

    Full Text Available The present study aims to test Explicitation Hypothesis using a parallel one-directional Persian-English corpus. To this end, ten anecdotes selected randomly form Sa'di's Golestan and their three English translations extracted from Gulistān's translations by Edward Rehatsek (2004, Edward B. Eastwick (1979, and James Ross (1890 were studied. The anecdotes and their translations were compared sentence by sentence to investigate aspects of explicitation and extract the explicitation cases using Klaudy's (2004 typology. The findings of the study confirmed the Explicitation Hypothesis and showed that all types of explicitation, namely obligatory, optional, pragmatic, and translation-inherent were used by the translators, with the obligatory explicitation having the highest frequency. Keywords: Explicitation Hypothesis, parallel corpus, Klaudy's typology, obligatory explicitation, optional explicitation, pragmatic explicitation, translation-inherent explicitation

  14. The preliminary study of autophagy induction of SA and MeSA by confocal

    Science.gov (United States)

    Yun, Lijuan; Chen, Wenli

    2010-02-01

    Autophagy appears to be a highly conserved process from unicellular to multicellular eukaryotes which contributes to the equilibrium of intracelluar environment. While it would be harmful to the cells when it is excessive by inducing programmed cell death (PCD). It is a protein degradation process in which cells recycle cytoplasmic contents when subjected to environmental stress conditions or during certain stages of development. Previous studies have demonstrated autophagy can be induced during abiotic or biotic stresses. salicylic acid (SA) and methyl salicytic (MeSA) are endogenous signal molecules. We found SA and MeSA can induce autophagy in Arabidopsis thaliana respectively. While autophagy was not induced by SA or MeSA in tobacco suspension cells under the same concentration and period. The differences in stuctures or physiological states may contribute to the results.

  15. SA3654 Component characterization. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Meir, G.W.

    1996-06-01

    AlliedSignal Inc., Federal Manufacturing & Technologies (FM&T), was provided with production capability assurance program (PCAP) funding to develop, characterize, and qualify purchased product components for use on the PRESS-A program. The SA3654, N-Channel, Power MOSFET was identified as a component needing such activity to support PRESS-A. This report presents the characterization activities and results for the SA3654.

  16. SaVi: satellite constellation visualization

    CERN Document Server

    Wood, Lloyd

    2012-01-01

    SaVi, a program for visualizing satellite orbits, movement, and coverage, is maintained at the University of Surrey. This tool has been used for research in academic papers, and by industry companies designing and intending to deploy satellite constellations. It has also proven useful for demonstrating aspects of satellite constellations and their geometry, coverage and movement for educational and teaching purposes. SaVi is introduced and described briefly here.

  17. Saúde mental na Estratégia Saúde da Família: a avaliação de apoio matricial

    Directory of Open Access Journals (Sweden)

    Fernanda Barreto Mielke

    2010-12-01

    Full Text Available O objetivo deste artigo é avaliar o apoio matricial na perspectiva de 14 profissionais de uma unidade de saúde da família em um estudo avaliativo qualitativo realizado a partir da Avaliação de Quarta Geração. Os dados foram coletados por meio de observação e entrevistas e analisados pelo Método Comparativo Constante, enfocando a inclusão de ações de saúde mental na Estratégia Saúde da Família. Os profissionais das equipes estudadas avaliaram a necessidade de retaguarda assistencial e orientações técnicas de equipes especializadas em saúde mental para a realização de ações de saúde mental no território, o que poderia ser implementado por meio do apoio matricial. Avaliamos que este arranjo organizacional é importante na construção de ações de saúde mental no território.

  18. Homossexualidade e o direito à saúde: um desafio para as políticas públicas de saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Grayce Alencar Albuquerque

    Full Text Available Objetivou-se evidenciar a atuação das políticas públicas direcionadas à saúde da população homossexual brasileira. Trata-se de uma revisão integrativa da literatura, realizada na Scientific Eletronic Library Online (SciELO e na Literatura Latino-Americana e do Caribe em Ciências da Saúde (Lilacs, utilizando os Decs: políticas públicas, assistência integral à saúde e homossexualidade. A saúde LGBT é apontada como vulnerável mesmo após a publicação de importantes documentos que garantem o acesso e a inclusão do grupo na saúde. A fragilidade na efetivação das propostas preconizadas vão ao encontro ao atendimento discriminatório e heteronormativo prestado pelos profissionais de saúde.

  19. A música popular brasileira na construção do conhecimento em Saúde Pública: o tema processo de trabalho e saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    2014-01-01

    Full Text Available Este estudo destaca temas relativos ao trabalho e à saúde na música popular brasileira, especialmente no samba. Tem como objetivo apresentar um corpo de conhecimentos sobre o tema processo de trabalho e saúde. Nas canções selecionadas foram identificadas categorias tomadas como ponto de partida para discussão com a literatura. Com o desenvolvimento do texto, percebe-se o manancial da canção popular para proporcionar conteúdos sobre múltiplas dimensões do processo de trabalho e do processo saúde-doença dos trabalhadores, inclusive a dimensão coletiva e histórica da luta pelo direito à saúde. Esta pesquisa resultou na valorização da música popular brasileira como uma forma de se entenderem as relações trabalho-saúde e de se desenvolver conhecimento em Saúde Coletiva.

  20. Percepções e atuação do Agente Comunitário de Saúde em saúde mental

    Directory of Open Access Journals (Sweden)

    Maria Angélica Pagliarini Waidman

    2012-10-01

    Full Text Available Este estudo teve como objetivo identificar as percepções de Agentes Comunitários de Saúde acerca de saúde e transtorno mental, bem como verificar o preparo desses agentes para atuar na área. Trata-se de uma pesquisa qualitativa que utilizou como técnica de coleta de dados a entrevista semiestruturada e, para interpretação dos dados, a técnica de análise de conteúdo. Foram entrevistados 45 Agentes Comunitários de Saúde da Estratégia Saúde da Família, pertencentes às 21 unidades básicas de saúde do município de Maringá, PR. Os resultados obtidos demonstram os preconceitos em relação ao transtorno mental desses profissionais, que reconhecem a importância de se trabalhar tanto com o portador quanto com a família, mas não se sentem capacitados para prestar uma assistência adequada. Por compartilharem o mesmo contexto social e por conhecerem de perto a dinâmica da comunidade, vislumbramos os agentes como importantes facilitadores no cuidado à saúde mental.

  1. Comunicação entre usuários e trabalhadores de saúde em colegiados de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Marcelen Palu Longhi

    2013-02-01

    Full Text Available Atualmente, têm sido observados problemas relativos à comunicação nos fóruns de participação social da saúde. O presente estudo tem o objetivo de analisar a comunicação entre usuários e trabalhadores de saúde, em colegiados da Saúde da Família. O referencial teórico utilizado foi a Teoria da Ação Comunicativa de Habermas. Realizou-se uma pesquisa qualitativa. Os dados coletados revelaram duas dimensões que se entrelaçavam: distanciamentos e aproximações entre usuários e trabalhadores de saúde. Quanto aos distanciamentos, destacaram-se a presença de relações assimétricas, de coerção e de manipulação por parte dos trabalhadores de saúde, processos que prejudicam a participação dos usuários. Por outro lado, estiveram presentes momentos de interação e lutas por direitos, abordados nas aproximações entre usuários e trabalhadores de saúde. Por fim, consideramos que a comunicação nos colegiados da Saúde da Família apresenta potencialidades e limites, sendo que estes devem ser problematizados, especialmente, por meio da educação permanente em saúde.

  2. Práticas de cuidado à saúde de mulheres camponesas

    Directory of Open Access Journals (Sweden)

    Iraí Maria de Campos Teixeira

    2014-12-01

    Full Text Available O presente artigo apresenta resultados de pesquisa acerca de práticas de cuidado à saúde de mulheres camponesas do Assentamento Monte Alegre VI – SP. A metodologia, qualitativa, constou de observação participante, entrevistas individuais e coletivas, tendo ocorrido 15 visitas no período de abril de 2010 a julho de 2011. Participaram doze moradoras, das quais, seis agentes comunitárias de saúde. As práticas de cuidado à saúde referem-se a: companheirismo, diálogo, escuta ativa, mobilizações sociais, assistência multiprofissional dos serviços de saúde, uso de plantas medicinais, crença religiosa como apoio social e dietas. Tais práticas somam-se e articulam-se. As participantes ensinam e aprendem sobre o cuidado à saúde nas relações entre elas, nas intergeracionais e nas com os profissionais de saúde, além de recorrerem a outras fontes de informação e outros processos formativos específicos, como do Programa Saúde da Família.

  3. Saúde bucal coletiva: caminhos da odontologia sanitária à bucalidade

    Directory of Open Access Journals (Sweden)

    Narvai Paulo Capel

    2006-01-01

    Full Text Available O ensaio aborda o surgimento das primeiras atividades odontológicas sob responsabilidade do poder público no Brasil e sua evolução no século XX, enfatizando a emergência do marco referencial denominado odontologia sanitária. Caracteriza, sumariamente, a odontologia social e preventiva e a odontologia de mercado, indicando as principais publicações que se ocuparam dessas correntes. As características essenciais da saúde bucal coletiva e da bucalidade são apresentadas, tecendo-se considerações sobre a articulação da saúde bucal coletiva com a saúde coletiva. Discutem-se as implicações do conceito de bucalidade para a organização da prática odontológica e a necessidade de reorientação do trabalho clínico nos serviços de saúde bucal, no âmbito do Sistema Único de Saúde brasileiro. Indicam-se os elementos essenciais de uma agenda para a saúde bucal coletiva, com base nas proposições apresentadas na 3ª Conferência Nacional de Saúde Bucal.

  4. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  5. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    2012-12-01

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  6. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  7. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  8. Simultaneous Estimation of Geophysical Parameters with Microwave Radiometer Data based on Accelerated Simulated Annealing: SA

    Directory of Open Access Journals (Sweden)

    Kohei Arai

    2012-07-01

    Full Text Available Method for geophysical parameter estimations with microwave radiometer data based on Simulated Annealing: SA is proposed. Geophysical parameters which are estimated with microwave radiometer data are closely related each other. Therefore simultaneous estimation makes constraints in accordance with the relations. On the other hand, SA requires huge computer resources for convergence. In order to accelerate convergence process, oscillated decreasing function is proposed for cool down function. Experimental results show that remarkable improvements are observed for geophysical parameter estimations.

  9. Saúde internacional: alguns aspectos conceituais contemporâneos

    Directory of Open Access Journals (Sweden)

    Villa Tereza Cristina Scatena

    2001-01-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca de algumas abordagens contemporâneas de Saúde Internacional, que suscitam o apontamento de questões que merecem ser refletidas e discutidas, permitindo subsidiar a compreensão no campo da Saúde Internacional em seus aspectos conceituais e operacionais, no processo de integração econômico-social das regiões de fronteira.

  10. AziSA: an architecture for underground measurement and control networks - 2nd International Conference on Wireless Communications...

    CSIR Research Space (South Africa)

    Stewart, R

    2008-08-01

    Full Text Available AziSA is an architecture for measurement and control networks that can be used to collect, store and facilitate the analysis of data from challenging underground environments. AziSA defines four node classes, two (Classes Four and Three...

  11. Triagem em saúde mental infantil

    Directory of Open Access Journals (Sweden)

    Fabiana Vieira Gauy

    Full Text Available Este estudo foi conduzido para comparar os resultados de um procedimento grupal aberto e um procedimento individual estruturado para avaliação do comportamento da criança conforme o relato materno. Participaram deste estudo 29 mães que buscavam atendimento para seus filhos em uma unidade de saúde mental infanto-juvenil. As primeiras 15 mães que procuraram o serviço foram entrevistadas individualmente conforme um roteiro estruturado desenvolvido a partir do CBCL e depois foram entrevistadas em grupo, em formato aberto. As outras 14 mães participaram da entrevista grupal aberta e em seguida participaram da entrevista individual estruturada. Os resultados das entrevistas foram comparados tomando como referência as 67 categorias comportamentais identificadas a partir do roteiro individual e quatro variáveis contextuais relatadas nos dois procedimentos. Os resultados mostram que um número substancialmente maior de comportamentos-problema foi identificado através de entrevista individual estruturada do que através de entrevista grupal aberta realizada com os mesmos informantes. É possível que o uso de um roteiro estruturado em entrevistas grupais possa oferecer mais informações com otimização do tempo de avaliação.

  12. Planejamento, gestão e ações à saúde do homem na estratégia de saúde da família

    Directory of Open Access Journals (Sweden)

    Leonardo Peixoto Pereira

    2014-12-01

    Full Text Available Objetivo: Analisar a situação do planejamento, da gestão e das ações de saúde diante da perspectiva de implantação da Política de Atenção à Saúde do Homem na Estratégia de Saúde da Família no município de Jequié. Métodos: Tratou-se de um estudo qualitativo. Entrevistaram-se gestores municipais dos serviços de saúde, profissionais de saúde da Estratégia de Saúde da Família e homens com 25 a 59 anos residentes nas áreas adscritas das unidades de saúde estudadas; realizou-se análise documental do Plano de Saúde e Relatórios de Gestão na Secretaria Municipal de Saúde e análise de conteúdo, modalidade temática. Resultados: Não há atividades assistenciais; de prevenção e promoção à saúde masculina desenvolvidas e os processos de implantação da atenção à saúde do homem encontram-se incipientes. Conclusão: É preciso ampliar o diálogo e reorganizar as estratégias de planejamento e gestão para compreender as reais necessidades masculina e articular com os atores envolvidos a implantação das ações de atenção à saúde do homem.

  13. O debate sobre educação em saúde no âmbito do Conselho Municipal de Saúde de Vitória, ES, Brasil

    Directory of Open Access Journals (Sweden)

    Welington Serra Lazarini

    2014-12-01

    Full Text Available Analisou-se a relação entre educação em saúde e a política de participação e controle social em saúde da Secretaria Municipal de Saúde de Vitória-ES, Brasil, entre 2005 e 2012. Realizou-se análise documental nos planos municipais de saúde, relatórios de gestão e em 139 atas do Conselho Municipal de Saúde. Evidenciou-se que a gestão orientou sua política pela participação, mas restringiu-se ao Conselho Municipal de Saúde. A educação em saúde foi tratada pontualmente durante as reuniões. Quando debatida, foi como modelo tradicional, configurando-se em estratégia para vigilância. A Educação Popular em Saúde foi mencionada no segundo governo, mas sem a redefinição das práticas. Sinaliza-se a necessidade de reconhecer as diferentes formas de participação social em Vitória e ampliar o debate acerca do modelo dialógico da educação em saúde.

  14. Access Network Selection Based on Fuzzy Logic and Genetic Algorithms

    Directory of Open Access Journals (Sweden)

    Mohammed Alkhawlani

    2008-01-01

    Full Text Available In the next generation of heterogeneous wireless networks (HWNs, a large number of different radio access technologies (RATs will be integrated into a common network. In this type of networks, selecting the most optimal and promising access network (AN is an important consideration for overall networks stability, resource utilization, user satisfaction, and quality of service (QoS provisioning. This paper proposes a general scheme to solve the access network selection (ANS problem in the HWN. The proposed scheme has been used to present and design a general multicriteria software assistant (SA that can consider the user, operator, and/or the QoS view points. Combined fuzzy logic (FL and genetic algorithms (GAs have been used to give the proposed scheme the required scalability, flexibility, and simplicity. The simulation results show that the proposed scheme and SA have better and more robust performance over the random-based selection.

  15. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  16. Desafios e possibilidades no exercício da preceptoria do Pró-PET-Saúde

    Directory of Open Access Journals (Sweden)

    Patrícia Acioli de Barros Lima

    2015-12-01

    Full Text Available O Sistema Único de Saúde (SUS e as Diretrizes Nacionais de Educação (DCNs direcionam o cuidado e a formação em saúde. Para fazer essa integração, o Ministério da Educação e o Ministério da Saúde criaram o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para Saúde (PET/Saúde, que necessitam de preceptores aptos a gerir suas práticas. O objetivo deste trabalho foi analisar os desafios e as possibilidades no exercício da preceptoria do Pró-PET-Saúde. Os sujeitos foram trinta preceptores do Pró-PET-Saúde/Ufal. O instrumento utilizado para a coleta dos dados foi a entrevista semiestruturada, e esses foram analisados por meio da análise de conteúdo. Os resultados indicam que as possibilidades seriam: o trabalho interprofissional, reavaliar as práticas e a contribuição com a formação. Entre os desafios, estão: o despreparo pedagógico, trabalho interprofissional e a deficiência na infraestrutura.

  17. Promoção da saúde e trabalho: um ensaio analítico

    Directory of Open Access Journals (Sweden)

    Cleonice Andréa Alves Cavalcante

    2008-03-01

    Full Text Available Este artigo teve como propósito discutir a articulação entre promoção da saúde e trabalho, na perspectiva de aproximar as práticas em saúde do trabalhador, com o enfoque na promoção da saúde. Para tanto, discutimos a trajetória histórica da promoção da saúde e das políticas de saúde do trabalhador no Brasil, apontando suas dificuldades, limitações e perspectivas. Em seguida, analisamos a temática sob o olhar de diferentes autores que discutem o assunto, no sentido de detectar as novas abordagens e perspectivas da relação promoção da saúde e trabalho propostas. Concluímos que a articulação entre Promoção da Saúde e trabalho não só é viável como extremamente importante no processo de implementação de uma política de saúde do trabalhador, que o considere sujeito ativo e participativo, além de contribuir para diminuir lacunas e encontrar respostas para questões não contempladas pelas atuais práticas em saúde do trabalhador no Brasil.

  18. A construção de um modelo de saúde complexo e transdisciplinar

    Directory of Open Access Journals (Sweden)

    Regina Stella Spagnuolo

    2005-02-01

    Full Text Available A saúde como um estado dinâmico coerente e construtivo do ser vivo é o fundamento da proposta deste texto. Nessa ótica, uma visão sistêmica e integrativa do ser humano a ser cuidado na prática diária da saúde está sendo proposta com base nos conceitos de pesquisadores e educadores das últimas décadas. Conceitos de caos, complexidade, transdisciplinaridade e auto-organização são introduzidos e fazem mais sentido como temas orientadores dos procedimentos sugeridos. Maneiras de promover a saúde assim compreendida são discutidas em algumas situações práticas, incluindo o atual programa oficial da Estratégia da Saúde da Família.

  19. O sistema social da saúde: conceito, limites e possibilidades

    Directory of Open Access Journals (Sweden)

    Sandra Regina Martini Vial

    2014-06-01

    Full Text Available Discutem-se as possibilidades de definir o sistema da saúde como um sistema social, diferenciado funcionalmente, a partir da ótica da Teoria dos Sistemas Sociais, utilizando os pressupostos gerais da Teoria e a estrutura apresentada por Niklas Luhmann sobre o sistema médico. Apresentam-se alguns “desassossegos” provocados pela Teoria; as possíveis relações entre o sistema da saúde e o que Luhmann chamou de sistema médico e como esse sistema, atualmente, pode ser considerado sistema da saúde; e, por fim, a nossa concepção do sistema da saúde na atualidade.

  20. A Generalized Eigensolver based on Smoothed Aggregation (GES-SA) for Initializing Smoothed Aggregation Multigrid (SA)

    Energy Technology Data Exchange (ETDEWEB)

    Brezina, M; Manteuffel, T; McCormick, S; Ruge, J; Sanders, G; Vassilevski, P S

    2007-05-31

    Consider the linear system Ax = b, where A is a large, sparse, real, symmetric, and positive definite matrix and b is a known vector. Solving this system for unknown vector x using a smoothed aggregation multigrid (SA) algorithm requires a characterization of the algebraically smooth error, meaning error that is poorly attenuated by the algorithm's relaxation process. For relaxation processes that are typically used in practice, algebraically smooth error corresponds to the near-nullspace of A. Therefore, having a good approximation to a minimal eigenvector is useful to characterize the algebraically smooth error when forming a linear SA solver. This paper discusses the details of a generalized eigensolver based on smoothed aggregation (GES-SA) that is designed to produce an approximation to a minimal eigenvector of A. GES-SA might be very useful as a standalone eigensolver for applications that desire an approximate minimal eigenvector, but the primary aim here is for GES-SA to produce an initial algebraically smooth component that may be used to either create a black-box SA solver or initiate the adaptive SA ({alpha}SA) process.

  1. Cuidados paliativos: o desafio das equipes de saúde

    Directory of Open Access Journals (Sweden)

    Fernanda de Carvalho Braga

    2013-12-01

    Full Text Available O avanço tecnológico possibilitou tanto a redução da morte quanto o prolongamento da vida. Essa última traz consigo a necessidade de se pensar em como cuidar de pessoas fora de perspectiva de cura, especialmente porque tal cuidado inclui aspectos psicossociais, com implicações tanto para as relações entre os profissionais quanto com o paciente e sua família. Este estudo teve como objetivo buscar na literatura nacional artigos sobre equipes de saúde que oferecem cuidados paliativos. Realizou-se uma revisão de produção em periódicos nacionais com os descritores cuidados paliativos, equipe de saúde e neonatologia. Foram identificados 62 trabalhos, porém somente 11 atenderam ao critério de relacionar pelo menos dois descritores. Nenhum artigo relacionou as três palavras-chaves. O baixo número de publicações evidencia a necessidade de mais pesquisas nessa área, pois proporcionar qualidade de vida desde o diagnóstico da doença até o momento do óbito representa grande estresse para os profissionais de saúde.

  2. Saúde, este obscuro objeto de desejo

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    1997-07-01

    Full Text Available Exploram-se no presente ensaio as relações entre saúde e desejo, envolvendo um dado querer denominado "saúde" e as formas que este querer adquire no contexto do viver contemporâneo. Aponta-se ao final para uma situação radical no que toca à saúde, vítima de um processo irreversível de expansão, que acaba por inviabilizar qualquer tentativa de defini-la, levando a uma perda total de sentido, no contexto de um universo humano tentendo à completa robotização.The present essay explores the relations between health and desire involving a given yearning named "health" and the forms that such feeling acquires in the contemporaneous context of living. It ultimately points to a radical situation in terms of health, victim of a irreversible process of expansion that eventually makes any attempt of definition not viable, leading to a total loss of meaning within a human universe tending to complete robotization.

  3. O impacto da homofobia na saúde do adolescente

    Directory of Open Access Journals (Sweden)

    Taison Regis Penariol Natarelli

    2015-12-01

    Full Text Available Resumo Objetivo: Objetivou-se conhecer os tipos de violência sofrida por adolescentes homossexuais e compreender a influência da homofobia na saúde dessa população. Métodos: Foram realizadas entrevistas, em profundidade, com nove adolescentes residentes em um município do interior de São Paulo que se autodeclararam homossexuais. Resultados: Os tipos de violência sofridos e referidos pelos adolescentes foram: física, verbal, psicológica e sexual. A homofobia provoca percepções negativas sobre si mesmo e a não adoção de hábitos de vida saudáveis relacionados aos cuidados com alimentação, prática de atividades físicas, padrão de sono e ideações suicidas. Foram relatadas situações de homofobia nos serviços de saúde. Conclusão: Adolescentes homossexuais são vulneráveis a diferentes tipos de violência. A dificuldade de acesso aos serviços de saúde é um fator concorrente ao aumento da vulnerabilidade. A contribuição deste estudo reside na problematização de tópicos que podem auxiliar na construção do cuidado integral dos adolescentes homossexuais.

  4. Eventos de massa, desastres e Saúde Pública

    Directory of Open Access Journals (Sweden)

    Camilla Figueiredo de Castro

    2014-09-01

    Full Text Available O Brasil tem sediado eventos de massa (EM e seus participantes estão sujeitos a riscos à saúde. Objetivou-se sistematizar as principais relações, de interesse da Saúde Pública, entre eventos de massa e ocorrência de desastres. Foram realizadas três estratégias metodológicas: revisão da literatura de EM, com busca sistemática, sistematização das principais informações sobre EM e seleção e sistematização das Referências que tratavam do tema desastre em suas palavras-chave, título ou Resumo. Foram selecionadas 28 Referências sobre EM, a maioria artigo científico, revisão de literatura, de 2012 e de natureza esportiva. Os principais assuntos abordados foram sistemas de vigilância e planejamento dos EM. Evidenciou-se a pouca informação analítica sobre os EM, bem como a importância de eventos não transmissíveis para a ocorrência de desastres, com destaque aos relacionados à multidão. O risco de desastres deve ser considerado no planejamento dos EM, para aumentar a capacidade de resposta considerando áreas estratégicas como: emergência médica, vigilância de doenças transmissíveis e vetores, segurança alimentar e dos serviços de saúde, saúde ambiental e laboratório. Ressalta-se a importância de pesquisas analíticas e de registro das experiências relacionadas aos EM, para a redução de risco de desastres.

  5. A narrativa nas pesquisas qualitativas em saúde

    Directory of Open Access Journals (Sweden)

    Marcelo Eduardo Pfeiffer Castellanos

    2014-04-01

    Full Text Available O forte interesse das ciências sociais e humanas em saúde nos estudos narrativos levou a várias formas de incorporação das contribuições desses estudos na pesquisa qualitativa em saúde. Torna-se importante refletir sobre os contextos e as características dessa incorporação. Para tanto, destacamos as principais questões teóricas aí envolvidas, assim como situamos essa incorporação no contexto da produção científica mais ampla das ciências sociais e humanas em saúde. Apontamos, também, a contribuição dos estudos narrativos para reflexão sobre as relações entre estrutura e ação social ou entre contextos específicos de interação social e contextos societários mais amplos. Essa contribuição pode ser identificada na análise das relações narrativamente estabelecidas entre interpretação, experiência e ação, ao longo do processo de saúde-doença-cuidado. Argumenta-se que as narrativas não somente organizam interpretações, mas também consistem em uma forma específica de agenciamento social. Nesse sentido, as interpretações narrativas e as performances narrativas podem ser vistas como elementos centrais da construção social de experiências e trajetórias de adoecimento e cuidado.

  6. The interdisciplinarity experienced in the PET- Saúde program A interdisciplinaridade vivenciada no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Sueli Moreira Pirolo

    2010-01-01

    Full Text Available Introduction: The incorporation of the oral health team in the Family Health Strategy (ESF, in 2000, enabled the adoption of a more active attitude of Primary Health Care in this field, in as much as oral health consists of an inseparable and integral part of the individual’s health. The interaction of health professionals becomes possible through policies like “PET-Saúde” which promotes the professional formation articulated with the ESF professionals as well as the process of integration of teaching, service and community in the perspective of interdisciplinarity. Objective: To report the experience of students during an interdisciplinary research. Description of the experience: This report was experienced in “PET-Saúde” of the Faculty of Medicine of Marília, at the “Man’s Health” subproject aiming at elaborating and validating a data collection instrument through Delphi Technique in order to help the health care team to detect early dental problems because of the damaged oral health pattern of the age group between 35 and 44 in Brazil. The members of this study are: medical and nursing students, a dentist preceptor and a nursing tutor. For the educational activities, the active methodology of teaching-learning was used. Conclusion: The reflexive actions, the moments for discussions provided the development of scientific investigation. The approximation of the process of validation through Delphi Technique also allowed the expansion of multidisciplinary knowledge on oral health. This experience made it possible to qualify the academic-professional formation on the interdisciplinary approach, and it’s important to strengthen the interaction among professionals and the articulation of health actions.Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste

  7. Reciprocal crosstalk between jasmonate and salicylate defence-signalling pathways modulates plant volatile emission and herbivore host-selection behaviour

    NARCIS (Netherlands)

    Wei, J.; Loon, van J.J.A.; Gols, R.; Menzel, T.R.; Li, N.; Kang, L.; Dicke, M.

    2014-01-01

    The jasmonic acid (JA) and salicylic acid (SA) signalling pathways, which mediate induced plant defence responses, can express negative crosstalk. Limited knowledge is available on the effects of this crosstalk on host-plant selection behaviour of herbivores. We report on temporal and dosage effects

  8. Atlas mundial da saúde

    OpenAIRE

    Barrozo, Ligia Vizeu

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans. O Atlas mondial de la santé faz parte da série Collection Atlas/M...

  9. Diretrizes Curriculares na saúde e as mudanças nos modelos de saúde e de educação

    Directory of Open Access Journals (Sweden)

    Carlos Otávio Fiúza Moreira

    2015-12-01

    Full Text Available Artigo produzido a partir de pesquisa bibliográfica e de questões formuladas para uma conferência no módulo “Educação na Saúde II” do Mestrado Profissional da Rede Nordeste de Formação em Saúde da Família. O texto discute questões dos campos da saúde e da educação relacionadas à emergência de novos modelos de saúde e de formação; analisa também as Diretrizes Curriculares Nacionais (DCN de três cursos da área da saúde (Medicina, Enfermagem e Odontologia como expressão desses novos modelos para saúde e para a educação. Uma questão transversal ao artigo são as relações entre os campos da saúde e da educação. Para isto, lança‑se mão do conceito de campo, desenvolvido pelo sociólogo Pierre Bourdieu. Considera‑se, ainda, o desafio de transformar as DCN em currículos e programas, ferramentas ou dispositivos necessários para fazer a passagem do que está prescrito para os cenários de ensino e aprendizagem.

  10. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Christiane Gasparini Araújo Costa

    2015-10-01

    Full Text Available ResumoA agricultura urbana e periurbana (AUP vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS, enquanto uma atividade de Promoção da Saúde (PS, e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abordagem qualitativa no município de Embu das Artes, SP. Da análise, emergiram as seguintes categorias: concepção de saúde, resultados na saúde, resgate de práticas e hábitos tradicionais e reorientação dos serviços de saúde. Identificou-se a estreita ligação entre a prática das hortas e as diretrizes e campos de ação da PS como: criação de ambientes saudáveis, reforço da ação comunitária, desenvolvimento de habilidades pessoais, estímulo à autonomia e empoderamento e demandas por reorientação dos serviços. As atividades de horta instituídas nas UBS se mostraram uma estratégia de implementação das práticas integrativas e complementares (PIC. Conclui-se que as atividades de cultivo nas hortas comunitárias mostram-se como práticas promotoras da saúde que integram elementos fundamentais das PIC.

  11. Vigilância ambiental em saúde e sua implantação no Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Christovam Barcellos

    2006-02-01

    Full Text Available A incorporação da vigilância ambiental no campo das políticas públicas de saúde é uma demanda relativamente recente no Brasil. Um dos principais desafios da vigilância ambiental em saúde é a definição do seu objeto e a especificidade de suas ações. O conceito ampliado de exposição, tratado não como um atributo da pessoa, mas do conjunto de relações complexas entre a sociedade e o ambiente, é central para a definição de indicadores e para a orientação da prática de vigilância ambiental. Entre as dificuldades encontradas para sua efetivação no Sistema Único de Saúde estão a necessidade de reestruturação das ações de vigilância em saúde e a formação de equipes multidisciplinares, com capacidade de diálogo com outros setores, além da construção de sistemas de informação capazes de auxiliar a análise de situações de saúde e a tomada de decisões. Nesse sentido, foi realizada uma revisão do objeto e conceitos da vigilância ambiental em saúde, bem como identificados os desafios para a sua implantação no Sistema Único de Saúde.

  12. Saúde Bucal no Âmbito Escolar e Familiar: da Autonomia à Transformação Social

    Directory of Open Access Journals (Sweden)

    Larissa Moreira de Souza

    Full Text Available RESUMO A promoção de saúde requer um trabalho com abordagens preventivas, educacionais, curativas e de controle da saúde pelo próprio indivíduo, sendo a motivação e a transformação social por meio da conscientização as únicas propostas viáveis para a diminuição das doenças bucais. O objetivo deste programa foi promover a saúde de forma ampla, atingindo vários atores sociais, e trabalhar a autonomia e a modificação de hábitos essenciais para alterações no fenômeno saúde-doença. Foi desenvolvido na rede pública de ensino do município de Patos (PB, com a participação de três eixos – a família, os educadores e as crianças –, tendo como ações as práticas de promoção e educação em saúde, análise do nível de conhecimento em saúde bucal, realização de tratamento restaurador atraumático, além de cursos de capacitação em saúde bucal para educadores e agentes comunitários de saúde. O projeto teve aceitação por todos os eixos assistidos e alcançou como resultado a melhoria nos níveis de saúde bucal e a criação de agentes multiplicadores de saúde, contribuindo para o desenvolvimento da autonomia e integralidade em saúde.

  13. Dificuldades na comunicação entre pessoas com deficiência auditiva e profissionais de saúde: uma questão de saúde pública Communication difficulties between individuals with hearing disability and health professionals: a public health matter

    Directory of Open Access Journals (Sweden)

    Shamyr Sulyvan de Castro

    2012-06-01

    Full Text Available OBJETIVO: Descrever a ocorrência de relatos de pessoas com deficiência auditiva e múltipla (auditiva e visual e/ou mobilidade quanto às dificuldades para ouvir e entender profissionais de saúde. MÉTODOS: Estudo transversal, do tipo inquérito de saúde, realizado com sujeitos selecionados a partir de outros dois estudos de base populacional. A coleta dos dados ocorreu de forma domiciliar, por meio de entrevistas realizadas por entrevistadores treinados, em São Paulo e região. Foram coletadas informações sobre a dificuldade de ouvir e entender o que os profissionais de saúde disseram no último serviço de saúde usado, além de dados demográficos (idade, gênero e raça, econômicos (renda do chefe da família, tipo de serviço de saúde procurado, uso de plano privado de saúde e necessidade de auxílio para ir ao serviço de saúde. RESULTADOS: Dos entrevistados, 35% relataram problemas para ouvir e entender os profissionais de saúde no último serviço visitado; 30,6% (IC95%: 23,4-37,8 para entender os médicos; 18,1% (IC95%: 12,0-24,1 para entender as enfermeiras; e 21,2% (IC95%: 14,8-27,6 para entender os outros funcionários. Não houve diferenças quando se considerou as variáveis demográficas, a necessidade de auxílio para tomar banho e se vestir, comer, levantar-se e/ou andar, possuir ou não plano privado de saúde e tipo de serviço de saúde visitado. CONCLUSÃO: Do total de pessoas entrevistadas, 35% relataram problemas para ouvir e entender o que foi dito por profissionais de saúde. Do total que relatou alguma dificuldade, 34,74% tinham deficiência auditiva e 35,38% deficiência múltipla.PURPOSE: To describe the occurrence of reports from people with hearing and/or multiple disabilities (hearing and visual and/or mobility regarding hearing and understanding health professionals. METHODS: Cross-sectional study through health survey, conducted with selected subjects from two population-based studies. Data

  14. Letramento funcional em saúde: reflexões e conceitos sobre seu impacto na interação entre usuários, profissionais e sistema de saúde

    Directory of Open Access Journals (Sweden)

    Maria da Penha Baião Passamai

    2012-06-01

    Full Text Available Letramento funcional em saúde (LFS é o grau pelo qual os indivíduos têm a capacidade para obter, processar e entender informações básicas e serviços necessários para a tomada de decisões adequadas em saúde. O tema preocupa pesquisadores/profissionais da saúde/formuladores de políticas públicas. Sua natureza interdisciplinar, relacional e interacional indica que o LFS sofre a influência dos sistemas de saúde/educacional, mídia, família, ambiente de trabalho/comunidade/decisão política. Analisam-se conceitos de LFS versus interação usuários-profissionais-sistema de saúde, norteando-se pelas questões: Em que consiste o LFS? Em que medida interfere na comunicação entre usuários, profissionais e sistema de saúde? Quais são suas consequências na saúde pública? Medidas para elevação do LFS devem melhorar as competências individuais e serviços de saúde humanizados, aperfeiçoando suas comunicações, escritas/orais, satisfazendo as necessidades/habilidades dos usuários.

  15. Atenção à saúde mental na Estratégia Saúde da Família: recursos não reconhecidos

    Directory of Open Access Journals (Sweden)

    Mariana de Oliveira Pasqualin Ribeiro

    2013-12-01

    Full Text Available Um dos pilares da política de Atenção Básica, a Estratégia Saúde da Família, realiza assistência descentralizada nos territórios adscritos, atendendo diferentes demandas, incluindo a saúde mental. Esta pesquisa teve como objetivo produzir sentidos com profissionais da Saúde da Família sobre seus recursos para o cuidado em saúde mental. Para tanto, foram realizados grupos focais com profissionais da saúde da família de um município do interior do estado de São Paulo. A análise do material foi realizada por procedimentos qualitativos de análise temática, com base nas contribuições do movimento construcionista social. Essa análise permitiu dar visibilidade a importantes recursos técnicos e relacionais da equipe para o cuidado em saúde mental, mas que pareciam pouco legitimados em seu cotidiano. Discutimos a necessidade de criação de espaços de reflexão onde os trabalhadores de saúde possam ressignificar suas ações, o que pode contribuir para a qualificação do atendimento em saúde mental na Atenção Básica.

  16. Da medicina do trabalho à saúde do trabalhador From occupational medicine to workers' health

    Directory of Open Access Journals (Sweden)

    René Mendes

    1991-10-01

    Full Text Available Ensaio de revisão sobre a evolução dos conceitos e práticas da medicina do trabalho à saúde do trabalhador, passando pela saúde ocupacional. Busca-se responder às seguintes questões: quais as características básicas da medicina do trabalho (na sua origem e na sua evolução; como e por que evoluiu a medicina do trabalho para a saúde ocupacional; por que o modelo da saúde ocupacional se mostrou insuficiente; em que contexto surge a saúde do trabalhador; quais as principais características da saúde do trabalhador.The evolution of the concepts and practice of occupational medicine, occupational health and workers' health is tentatively reviewed. An attemp is made to answer the following questions: what were the major characteristics of occupational medicine throughout its evolution? How and why did occupational medicine evolve into occupational health? Why has the "occupational health model" become inadequate? Writhin what context did workers' health arise? What are the principal characteristics of workers' health?

  17. Teatro do oprimido em saúde mental: participação social com arte

    Directory of Open Access Journals (Sweden)

    Érika Sales dos Santos

    2016-09-01

    Full Text Available Relato de experiência de intervenção do projeto Teatro do oprimido na saúde mental em um Centro de Atenção Psicossocial (CAPS de Fortaleza, Ceará, Brasil, no qual descrevemos como esta ferramenta é capaz de contribuir para o fortalecimento da participação social. O projeto foi elaborado por um grupo de residentes e preceptores da Residência Integrada em Saúde, com ênfase em Saúde Mental Coletiva, da Escola de Saúde Pública do Ceará. Utilizamos a pesquisa qualitativa. Em face do difícil contexto de efetivação da política de saúde mental no município, percebemos que a arte pode contribuir para a construção de uma atenção em saúde efetiva, emancipatória e apta a acolher as diversidades. Na nossa ótica, o teatro do oprimido é uma ferramenta importante para fortalecer a participação social e para reinventá-la, problematizando estigmas e impulsionando a garantia de direitos.

  18. A finitude humana e a saúde pública Human finitude and public health

    Directory of Open Access Journals (Sweden)

    Sergio Rego

    2006-08-01

    Full Text Available A morte é uma questão implícita na prática e na formação dos profissionais da saúde. Há, todavia, uma tendência dos profissionais de saúde de restringir sua discussão aos aspectos meramente técnicos, seja na assistência à saúde, seja nas ações de saúde pública. Este artigo analisa a importância da adoção do cuidado de qualidade no fim de vida como norteador das práticas assistenciais e a necessidade de que o campo da Saúde Pública tome esses cuidados como objeto de reflexão e de pesquisas. Por fim, aponta-se para aspectos relevantes para a formação de profissionais de saúde para que sejam respeitadores das diferenças e comprometidos com o diálogo.Death is an implicit subject in both health practice and health professionals' training. There is a tendency by health professionals to reduce this analysis merely to technical aspects. This paper analyzes the importance of adopting quality care at the end of life as a guide for public health care. We highlight relevant aspects for training health professionals to respect moral differences and to be prepared to discuss their own points of view.

  19. Kakaibang Halimuyak: Iba't Ibang Imahe ng Pangangapital sa Balintawak

    Directory of Open Access Journals (Sweden)

    Mariah Amour C. Miranda

    2015-06-01

    Full Text Available Ginagalugad ng sanaysay na ito ang isang pangunahing lugar na nadaraanan mula Norte patungong Maynila—ang Balintawak. Nagsisilbing manibela ng pagsusuri ang kontemporaneong pananaw sa lunan bilang pugad ng mga anyong may magkakasalungat na kahulugan. Binibigyang-pansin ng sanaysay ang iba't ibang imahe ng pagbebenta na matatagpuan sa Balintawak: ang billboard ng kumpanyang Bench na siyang pinakamalaki, ang mismong palengke, at ang mga lakong paninda sa tabing-kalsada. Sa pamamagitan nito, maipapakita ng sanaysay kung paano madadalumat ang Balintawak bilang isang panlipunang texto na sumasalamin sa mga magkakaibang pangangapital sa naturang lunan. This essay explores the space of Balintawak—a focal point of urban travel from northern Luzon to Manila. Using the contemporary view on space as a site of structures with contradictory meanings, the study seeks to understand how various images of market activities in Balintawak create meaningful representations. These images include the gigantic billboard of Bench, the central market itself, and flea markets in the area. The essay shows how Balintawak as a social text serves as a trading center of different forms of capital.

  20. A autonomia do paciente no processo terapêutico como valor para a saúde

    Directory of Open Access Journals (Sweden)

    Jussara Calmon Reis de Souza Soares

    2007-04-01

    Full Text Available No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomia caracteriza-se como relativa e relacional, inseparável da dependência. É também condição necessária para a saúde, compreendida em seu sentido mais amplo, como potência auto-recuperadora do organismo humano. Assim, autonomia passa a ser um valor fundamental a ser resgatado e defendido tanto na clínica, quanto no campo das ciências humanas e sociais em saúde. Discutem-se implicações do resgate da autonomia, ainda que como um vir-a-ser, como precondição para a saúde e a cidadania, para a própria vida.

  1. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Pinto

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  2. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Pinto Luiz Felipe

    2004-01-01

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  3. Saúde e qualidade de vida de jornalistas: estudo de revisão

    Directory of Open Access Journals (Sweden)

    Regina Zanella Penteado

    2016-06-01

    Full Text Available Objetivo: Realizar revisão sistemática da literatura voltada para a saúde e a qualidade de vida de jornalistas, relacionadas ao trabalho. Métodos: Foram realizadas buscas nas seguintes bases: LILACS, SciELO, Doaj, MEDLINE, Science Direct, Wiley Online Library, Springer Link e Clase. Foram priorizados artigos publicados em periódicos nacionais e internacionais, nos idiomas em português, inglês e espanhol, no período entre 2005 e 2015. O processo de seleção seguiu etapas e critérios pré-definidos do estudo, bem como a aplicação de Testes de Relevância. Resultados: A seleção resultou em oito publicações para revisão. Os aspectos e/ou questões do processo saúde-doença-cuidado de jornalistas, que têm sido enfatizados nas investigações, integram as categorias: saúde vocal/expressividade (três: 37,5%; saúde mental (quatro: 50% e saúde alimentar/nutricional (um: 12,5%; e eles vêm sendo abordados de maneira isolada. Faltam estudos pautados por uma concepção ampliada e abrangente de saúde e qualidade de vida. Conclusão: O estudo mostra a necessidade de pesquisas e investimentos na formação de uma cultura de promoção da saúde e qualidade de vida dos jornalistas, o que pode ocorrer na interdisciplinaridade das áreas de Saúde, Comunicação e Educação, com apoio das entidades de classe da categoria e da mídia.

  4. Promoção da Saúde na Escola: história e perspectivas

    Directory of Open Access Journals (Sweden)

    Andréa Monteiro de Castro Graciano

    2015-03-01

    Full Text Available Introdução: A promoção da saúde nas escolas envolve a educação em saúde, a criação de entornos saudáveis e a provisão de serviços de saúde. Este estudo objetivou realizar uma revisão crítica da literatura sobre a promoção da saúde nas escolas. Metodologia: Os critérios prévios de inclusão foram: artigos que relacionavam saúde escolar e promoção da saúde, sem limite temporal de publicação. Foram realizadas buscas eletrônicas nas principais bases de dados, entre janeiro e março de 2014. Foram utilizadas as seguintes palavras-chave e conjunto de palavras: promoção da saúde, saúde escolar, health promotion e school health [termo MeSH e termo palavra]. Também foram pesquisados estudos que preencheram os critérios de inclusão originados da lista de referências dos artigos selecionados. Revisão de literatura / Discussão: A saúde escolar avançou em sintonia com o conhecimento técnico-científico e com o desenvolvimento sócio-político, superando, de forma gradativa, o paradigma biomédico para a concepção da iniciativa das Escolas Promotoras de Saúde. No Brasil, foi instituído um novo programa para a saúde do escolar denominado Programa Saúde na Escola (PSE. O PSE se identifica como uma estratégia para a integração e articulação permanente entre as políticas e ações de educação e saúde. Considerações finais: Uma escola promotora de saúde caracteriza-se como uma escola que busca um estilo de vida, aprendizagem e trabalho que favoreça o desenvolvimento da saúde.

  5. DAYA SAING DAN STRATEGI PENGEMBANGAN MINYAK SAWIT DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Jauhar Samudera Nayantakaningtyas

    2012-11-01

    Full Text Available ABSTRACTThe aims of this study were to analyze the competitiveness of Indonesian Crude palm oil CPO products in the international market and to analyze the strategy to improve the competitiveness of Indonesian CPO. The analysis methods used this research were descriptive qualitative methods. The tools used to analyze the competitiveness of palm oil is Revealed Comparative Advantages and Porter Diamond Theory, while the development of the strategy used to determine the SWOT method. Based on the analysis of Porter's Diamond System and revealed comparative advantages, this study concluded that the competitiveness of Indonesian CPO was pretty strong, but it still needed a strategy to strengthen its competitiveness especially on derivative products. Some of the routine strategies that need to be done every year, are the development of the CPO industry human resources through training and innovation activities, paying attention to national and international issues by improving government policies, downstream industrial development and palm oil value-added increase, enhance cooperation with manufacturers from other countries through promotions.Keywords: crude palm oil, competitiveness, strategy, analysis of porter's diamondABSTRAKTujuan penelitian ini adalah menganalisis daya saing produk Crude Palm Oil (CPO Indonesia di pasar internasional dan menganalisis strategi peningkatan daya saing CPO Indonesia. Metode pengolahan dan analisis data yang digunakan dalam penelitian ini adalah metode deskriptif kualitatif. Alat  yang digunakan untuk menganalisis daya saing minyak sawit  adalah Revealed Comparative Advantages dan Teori Berlian Porter, sedangkan untuk mengetahui strategi pengembangan digunakan metode SWOT. Hasil analisis Sistem Berlian Porter dan revealed comparative advantages disimpulkan bahwa daya saing CPO Indonesia cukup kuat, namun masih diperlukan adanya strategi untuk memperkuat terutama pada produk turunan CPO. Strategi rutin yang harus

  6. Controle social do Sistema Único de Saúde: o que pensam os conselheiros municipais de saúde

    Directory of Open Access Journals (Sweden)

    Vera Dib Zambon

    2013-12-01

    Full Text Available Desafios estão presentes para a consolidação da participação da comunidade e este estudo objetiva analisar o controle social na perspectiva dos conselheiros municipais de saúde. Trata-se de estudo de abordagem qualitativa utilizando entrevistas semiestruturadas. Identificou-se que alguns conselheiros não reconhecem a participação social como diretriz do Sistema Único de Saúde. Apesar do reconhecimento dos conselhos como espaços deliberativos, identificam-se dificuldades como a centralização das decisões na gestão, a valorização do saber técnico e a não realização de conferências de saúde. Há limitações no efetivo exercício do papel de conselheiro, dificuldade de interlocução com as bases de representação e de acesso a informações. Aponta-se a necessidade de articulação dos conselheiros e capacitações. Conclui-se pela necessidade de valorização dos espaços colegiados instituídos no Pacto pela Saúde, para fortalecimento do controle social, com destaque à educação permanente em saúde.

  7. Estratégia saúde da família e saúde do trabalhador: um diálogo possível?

    Directory of Open Access Journals (Sweden)

    Francisco Antonio de Castro Lacaz

    Full Text Available Reflete-se sobre a omissão de práticas voltadas para a saúde dos trabalhadores no âmbito de atuação da Estratégia Saúde da Família (ESF e propõe-se a inclusão dessas práticas. Considera-se que a mudança do modelo de atenção médico-centrado exige uma nova abordagem que incorpore a análise de elementos da produção de bens, da circulação e do consumo. Fundamenta-se na teoria da determinação social do processo saúde-doença e nas categorias trabalho e reprodução social. Propõe-se que a incorporação da temática Saúde do Trabalhador (ST na ESF seja realizada pela operacionalização de: um instrumento que levante e analise variáveis e indicadores de reprodução social; um sistema de apoio matricial que integre os Centros de Referência em ST com as Unidades Básicas de Saúde; educação permanente das equipes da ESF em conteúdos de ST.

  8. Intervenções em saúde pública e seu impacto nas desigualdades sociais em saúde

    Directory of Open Access Journals (Sweden)

    José Leopoldo Ferreira Antunes

    2015-06-01

    Full Text Available Este artigo resume a avaliação de três programas de saúde pública em relação à sua eficácia e impacto sobre as desigualdades sociais na saúde. Foram examinadas a fluoração da água de abastecimento público no contexto brasileiro, a provisão de terapêutica antirretroviral para pacientes com Aids e a vacinação de idosos contra a gripe na cidade de São Paulo. As três intervenções foram consideradas efetivas, na medida em que propiciaram uma redução na carga de doença na população. No entanto, elas tiveram resultados conflitantes quanto ao impacto sobre as desigualdades em saúde. Concluiu-se, por fim, que os programas de saúde pública devem ser implementados com um alcance imediata e efetivamente universal, direcionando recursos adicionais aos grupos com mais necessidades de saúde. Essa estratégia reduziria, ao mesmo tempo, o nível geral de doença na população e as desigualdades na experiência de doenças entre os estratos sociais.

  9. Complexidade em Saúde da Família e formação do futuro profissional de saúde

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    2009-09-01

    Full Text Available As características do Sistema Único de Saúde (SUS e da Estratégia de Saúde da Família (ESF os aproximam do pensamento complexo, termo que não se refere à adjetivação de fenômeno de aspectos múltiplos, e sim ao marco teórico e epistemológico. Indícios de inadequação da formação dos profissionais de saúde para a atuação em Saúde da Família levaram a proposta de levantar a formação desses profissionais para a abordagem ampliada de saúde implicada no SUS/ESF. Foram realizados grupos focais com acadêmicos de Enfermagem, Medicina e Odontologia da Universidade Federal do Amazonas, analisado sob a perspectiva hermenêutica dialética. Os dados apontaram para a formação reducionista/biomédica nas três profissões assim como o foco no trabalho individual, e não em equipe multiprofissional, quadro inadequado ao SUS/ESF, que preconiza atuação profissional focada na complexidade do entorno sócioeconômico e antropológico dos usuários do sistema.

  10. Condicionalidades em saúde do programa Bolsa Família – Brasil: uma análise a partir de profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Alice Teles de Carvalho

    2014-12-01

    Full Text Available Este estudo apresenta a percepção de profissionais de equipes de Saúde da Família de municípios do Nordeste do Brasil acerca das mudanças na vida das famílias participantes do programa Bolsa Família, da relação destas com os serviços de saúde e do impacto na dinâmica de trabalho dos profissionais, a partir do acompanhamento das condicionalidades de saúde do programa Bolsa Família. As informações foram obtidas por meio de entrevistas semiestruturadas e encontros de grupo focal. Os profissionais acreditam que o programa ocasionou mudanças favoráveis na vida das famílias participantes, como a redução da pobreza, o aumento da frequência escolar das crianças e mudanças positivas na relação entre as famílias participantes e os serviços de saúde. No entanto, relataram dificuldades de caráter organizacional no acompanhamento das condicionalidades, sobretudo devido ao aumento da demanda de trabalho. É importante que as condicionalidades de saúde proporcionem oportunidades para a realização de ações que visem ao empoderamento e autonomia dos sujeitos quanto ao autocuidado e desenvolvimento da cidadania.

  11. Dinâmica do capital e sistemas locais de saúde: em busca de uma análise integradora do setor saúde

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Siliansky de Andreazzi

    2006-06-01

    Full Text Available Apresenta-se uma proposta metodológica direcionada à análise dos determinantes da oferta de atenção à saúde, com base na dinâmica da acumulação de capital a ser agregada aos elementos de definição das políticas de saúde mais convencionalmente empregados na área da Saúde Coletiva. A análise está baseada nos conceitos e métodos da Economia Industrial, já testados para o setor saúde em trabalhos desenvolvidos no âmbito europeu e por pesquisadores da CEPAL, aos quais se propõem agregar variáveis do contexto geral, que condicionam possibilidades e impõem limites às estratégias dos agentes locais, e análises de corte histórico que permitam identificar rugosidades. Destina-se a apoiar os gestores do SUS, estaduais e municipais, na sua atribuição de comando único do setor saúde sobre um determinado território, o que inclui o conjunto das possibilidades de regulação do setor privado - do planejamento da oferta ao controle de qualidade.

  12. Composition and Value of waste in landfills in SA

    CSIR Research Space (South Africa)

    Oelofse, Suzanna HH

    2015-09-01

    Full Text Available stream_source_info Oelofse1_2015.pdf.txt stream_content_type text/plain stream_size 3221 Content-Encoding UTF-8 stream_name Oelofse1_2015.pdf.txt Content-Type text/plain; charset=UTF-8 1 Composition and Value of waste... in landfills in SA German Chamber of Business From Mining to Urban Mining 16 September 2015 IFAT Environmental Technology Forum Africa 2015 by Prof Suzan Oelofse Research Group Leader: Waste for Development Competency Area: Solutions for a Green...

  13. The rebranding of Electrica Soluziona SA - a case study

    Directory of Open Access Journals (Sweden)

    Monica GOMOESCU

    2016-07-01

    Full Text Available This article intends to present the design and implementation stages of a rebranding campaign that took place in the Electrica Soluziona SA company. The rebranding targets a company that provides consultancy services and software solutions and that underwent a change of its main shareholders structure, as it was taken over by Indra Group. After being taken over by Indra, Electrica Soluziona has considerably enlarged its product portfolio and the market segments targeted. Thus, it was mandatory to define a complex rebranding campaign. The rebranding process was not determined only by the broadening of activity, but also by the change of visual identity elements, along with the desire of repositioning.

  14. A Criação da Secretaria Especial de Saúde Indígena

    Directory of Open Access Journals (Sweden)

    Luciana Benevides Ferreira

    2013-12-01

    Full Text Available O Subsistema de Atenção à Saúde Indígena foi criado em 1999 proporcionando aumento da cobertura das ações de saúde para os povos aldeados, mas a dificuldade de gestão e a insatisfação dos usuários levaram o governo brasileiro a transferir a responsabilidade sobre as ações de saúde indígena da Fundação Nacional de Saúde para o Ministério da Saúde. Esse processo foi marcado por uma ampla participação de representantes da população indígena, pelo diálogo intercultural e por várias rodadas de negociação no governo, culminando na criação, em 2010, da Secretaria Especial de Saúde Indígena. O objetivo deste artigo é descrever esse processo. O conhecimento do contexto e o acompanhamento de mudanças ocorridas na Política Nacional de Atenção à Saúde dos Povos Indígenas foram proporcionados pela participação em eventos relacionados ao tema e pela realização de entrevistas com presidentes dos Conselhos Distritais de Saúde Indígena.

  15. The Novel Transcriptional Regulator SA1804 Is Involved in Mediating the Invasion and Cytotoxicity of Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    JUNSHU eYANG

    2015-03-01

    Full Text Available The two-component regulatory system, SaeRS, controls expression of important virulence factors, including toxins and invasins, which contribute to the pathogenicity of Staphylococcus aureus. Previously, we conducted a transcriptomics study for identification of SaeRS regulon and found that inactivation of SaeRS dramatically enhances the transcription of a novel transcriptional regulator (SA1804. This led us to question whether SA1804 is involved in bacterial pathogenicity by regulating the expression of virulence factors. To address this question, we created sa1804, saeRS, and sa1804/saeRS double deletion mutants in a USA300 community-acquired MRSA strain, 923, and determined their impact on the pathogenicity. The deletion of sa1804 dramatically increased the cytotoxicity and enhanced the capacity of bacteria to invade into the epithelial cells (A549, whereas the deletion of saeRS eliminated the cytotoxicity and abolished the bacterial ability to invade into the epithelial cells. Moreover, the double deletions of sa1804 and saeRS appeared a similar phenotype with the saeRS null mutation. Furthermore, we determined the regulatory mechanism of SA1804 using qPCR and gel-shift approaches. Our data indicate that the novel virulence repressor SA1804 is dependent on the regulation of SaeRS. This study sheds light on the regulatory mechanism of virulence factors and allows for us further elucidate the molecular pathogenesis of S. aureus.

  16. Ang Kasaysayan at Panitikan sa Pagbuo ng Bayan: Rebyu ng Nobelang The Feet of Juan Bacnang ni F. Sionil Jose

    Directory of Open Access Journals (Sweden)

    Moreal Nagarit Camba

    2013-06-01

    Full Text Available Mababasa sa The Feet of Juan Bacnang (2011, ang pinakabagong nobela ni F. (Francisco Sionil Jose o Frankie sa kanyang mga kaibigan, ang mahigpit na ugnayan ng manunulat at ng kanyang bayan. Siya ang nagsisilbing zeitgeist ng maraming panahon; ang espiritu at boses ng nakaraan at kasalukuyan, isang manunulat na kumakatha ng mga akdang sumasalamin sa mayamang karanasan at kasaysayan ng kultura at lahing pinag-usbungan. Kung saan ang kanyang nobelang Juan Bacnang, katulad ng iba pa niyang naunang mga nobela, bagamat likhang-isip, ay repleksyon ng buhay, pasakit, at aspirasyon ng manunulat at lipunang lumikha rito; mga tunguhing hindi nalalayo sa layunin ng mga ninuno nitong anyong panitikan, ang mga epiko at kuwentong bayan. Ibig sabihin, ang akda bilang Weltanschauung na ayon kay Terry Eagleton ay “partikular na paraan ng pagtingin sa mundo; na may kaugnayan sa gahum na nagtatakda kung paano tingnan ang mundo na maituturing na ‘pag-iisip ng lipunan’ o ideyolohiya ng panahon”1 (sinipi ni Geok-Lin Lim A Modern National Epic 74. Dagdag pa rito, ang kanyang (mga nobela, partikular ang Juan Bacnang, ay nagsisilbing “siwang sa mga kurtinang-papel” sa kasaysayan;2 mga tala ng karanasan at pang-araw-araw na buhay, na madalas hindi naisusulat ng mga tradisyunal na historyador. Ito (ang mga tala, ayon kay Pierre Macherey, ang mga puwang o pinipi na boses na naisantabi ng maraming akdang pangkasaysayan (sinipi ni Eagleton Marxism and Literary Criticism 34-35.

  17. G-LoSA: An efficient computational tool for local structure-centric biological studies and drug design.

    Science.gov (United States)

    Lee, Hui Sun; Im, Wonpil

    2016-04-01

    Molecular recognition by protein mostly occurs in a local region on the protein surface. Thus, an efficient computational method for accurate characterization of protein local structural conservation is necessary to better understand biology and drug design. We present a novel local structure alignment tool, G-LoSA. G-LoSA aligns protein local structures in a sequence order independent way and provides a GA-score, a chemical feature-based and size-independent structure similarity score. Our benchmark validation shows the robust performance of G-LoSA to the local structures of diverse sizes and characteristics, demonstrating its universal applicability to local structure-centric comparative biology studies. In particular, G-LoSA is highly effective in detecting conserved local regions on the entire surface of a given protein. In addition, the applications of G-LoSA to identifying template ligands and predicting ligand and protein binding sites illustrate its strong potential for computer-aided drug design. We hope that G-LoSA can be a useful computational method for exploring interesting biological problems through large-scale comparison of protein local structures and facilitating drug discovery research and development. G-LoSA is freely available to academic users at http://im.compbio.ku.edu/GLoSA/.

  18. Studies of the aggregation of RNase Sa

    DEFF Research Database (Denmark)

    Khasa, Harshit; Kramer, Ryan; Maddux, Nathan

    2014-01-01

    Thirty-eight mutants of RNase Sa (ribonuclease from Streptomyces aureofaciens) were examined for their structure, thermal sensitivity, and tendency to aggregate. Although a biphasic correlation was seen between the effect of temperature on structure and the free energy of transfer changes in many...

  19. Caracterização das atividades de enfermagem em saúde coletiva desenvolvidas na regional norte de saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    Full Text Available O estudo teve como objetivo identificar e analisar as ações desenvolvidas pela equipe de enfermagem em saúde coletiva na Regional Norte de Saúde do Distrito Federal. Para a coleta de dados aplicou-se um questionário com a descrição das diversas atividades cotidianas da assistência a 29 enfermeiras, 91 auxiliares de enfermagem e 42 agentes de saúde. Para a melhor compreensão de como as atividades são desenvolvidas realizou-se grupos focais com cada uma das categorias profissionais. Os resultados mostram que todos elementos da equipe empregam grandes esforços para organizar, controlar e atender a demanda espontânea e ainda executar as atividades de auxilio às ações médicas, consequentemente priorizam o atendimento individual em detrimento do coletivo.

  20. Da Saúde Pública às Políticas Saudáveis — Saúde e Cidadania na Pós-modernidade

    Directory of Open Access Journals (Sweden)

    Antônio Ivo de Carvalho

    1996-01-01

    Full Text Available O artigo discute alternativas para o futuro da Saúde Pública, nos marcos do pensamento e das exigências da pós-modernidade. Apresenta os avanços sanitários alcançados na época moderna, e aborda os efeitos mórbidos da tecno-ciência. Com base nos aportes do pensamento pós-moderno, propõe uma agenda de desafios a serem enfrentados pela nova Saúde Pública. Especificamente, propõe novos aportes conceituais para lidar com as relações subjetivo-objetivo e coletivo-individual no campo sanitário. Discute, ainda, as condições e possibilidades de que a proposta de Políticas Saudáveis possa apontar para uma renovação da identidade da saúde pública.

  1. A modified CoSaMP algorithm for electromagnetic imaging of two dimensional domains

    KAUST Repository

    Sandhu, Ali Imran

    2017-05-13

    The compressive sampling matching pursuit (CoSaMP) algorithm is used for solving the electromagnetic inverse scattering problem on two-dimensional sparse domains. Since the scattering matrix, which is computed by sampling the Green function, does not satisfy the restricted isometry property, a damping parameter is added to the diagonal entries of the matrix to make the CoSaMP work. The damping factor can be selected based on the level of noise in the measurements. Numerical experiments, which demonstrate the accuracy and applicability of the proposed algorithm, are presented.

  2. PREPARATION OF SA-Fe CATION EXCHANGE MEMBRANE AND IT'S APPLICATION IN ELECTRODIALYSIS FOR TREATING WASTEWATER

    Institute of Scientific and Technical Information of China (English)

    GENG Yamin; CHEN Zhen; ZHENG Xi; HUANG Xuehong; CHEN Riyao

    2006-01-01

    An insoluble SA-Fe membrane was prepared by being linked soluble sodium alginate with FeCl3. SEM was used to observe its surface structure. IR spectrum indicated that Fe3+ was linked with -COOH and -OH in SA membrane. As a cationic exchanging membrane in electrodialysis the membrane was applied in treating inorganic wastewater with high concentration of inorganic ammonia and azote. The results of experiment showed that it was well-selective to ammonia and azote. The percentage of the removal of ammonia and azote in wastewater was up to 80%.

  3. Intralocus sexual conflict diminishes the benefits of sexual selection.

    Directory of Open Access Journals (Sweden)

    Alison Pischedda

    2006-11-01

    Full Text Available Evolution based on the benefits of acquiring "good genes" in sexual selection is only plausible with the reliable transmission of genetic quality from one generation to the next. Accumulating evidence suggests that sexually antagonistic (SA genes with opposite effects on Darwinian fitness when expressed in the two different sexes may be common in animals and plants. These SA genes should weaken the potential indirect genetic benefits of sexual selection by reducing the fitness of opposite-sex progeny from high-fitness parents. Here we use hemiclonal analysis in the fruit fly, Drosophila melanogaster, to directly measure the inheritance of fitness across generations, over the entire genome. We show that any potential genetic benefits of sexual selection in this system are not merely weakened, but completely reversed over one generation because high-fitness males produce low-fitness daughters and high-fitness mothers produce low-fitness sons. Moreover, male fitness was not inherited by sons, consistent with both theory and recent evidence connecting this form of SA variation with the X chromosome. This inheritance pattern may help to explain how genetic variation for fitness is sustained despite strong sexual selection, and why the ZW sex chromosome system found in birds and butterflies appears to foster the evolution of extreme secondary sexual characters in males.

  4. Sampling and sensitivity analyses tools (SaSAT for computational modelling

    Directory of Open Access Journals (Sweden)

    Wilson David P

    2008-02-01

    Full Text Available Abstract SaSAT (Sampling and Sensitivity Analysis Tools is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab®, a numerical mathematical software package, and utilises algorithms contained in the Matlab® Statistics Toolbox. However, Matlab® is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  5. O Direito à Saúde no Sistema Prisional

    Directory of Open Access Journals (Sweden)

    Gabrielle Jacobi KOLLING

    2013-04-01

    Full Text Available O direito à saúde é objeto de constante análise e, a cada momento, visualiza-se a necessidade de enfrentar diferentes interfaces desse direito fundamental. A complexidade inerente ao sistema social, e, por conseguinte, ao da saúde também, demanda-nos romper com a classificação de cidadãos de primeira e de segunda classe; isso não é republicano, tampouco democrático. A lógica dos desumanizados e excluídos (esquecidos e negligenciados deve ser cambiada pela lógica da inclusão. A análise enfocará a saúde no sistema prisional. Para isso, é condição de possibilidade analisarmos os condicionantes de saúde e os seus efeitos no panorama prisional-sanitário brasileiro. Observaremos, ainda, as ações governamentais para efetivar o direito à saúde no sistema prisional, em especial a Política Pública de Saúde “Plano Nacional de Saúde no Sistema Penitenciário”, que se apresenta como uma tentativa concreta de romper com a negligência do Estado em relação aos integrantes do sistema prisional, aos esquecidos, aos sem voz. ABSTRACT The right to health is matter of constant analysis and, at each moment the need to challenge the different interfaces of this basic right is visible. The innate complexity of the social system and, by consequence to the health system as well, demands that we break with the concept of first and second class citizens; this is not republican or even democratic. The de-humanized and excluded logic (forgotten and neglected must be traded for the inclusion logic. The analysis will focus the prison system’s health. For this is condition of possibility to analyze the health conditions and its effects in the Brazilian prison-sanitary scope. We will also observe the government’s actions to make the right to heath effective in the prison system, in special the Public Health Policy “Nacional Health Plan in the Prison System”, which is presented as a real attempt to break with the state’s negligence

  6. Assessing Greater Sage-Grouse Selection of Brood-Rearing Habitat Using Remotely-Sensed Imagery: Can Readily Available High-Resolution Imagery Be Used to Identify Brood-Rearing Habitat Across a Broad Landscape?

    Directory of Open Access Journals (Sweden)

    Matthew Westover

    Full Text Available Greater sage-grouse populations have decreased steadily since European settlement in western North America. Reduced availability of brood-rearing habitat has been identified as a limiting factor for many populations. We used radio-telemetry to acquire locations of sage-grouse broods from 1998 to 2012 in Strawberry Valley, Utah. Using these locations and remotely-sensed NAIP (National Agricultural Imagery Program imagery, we 1 determined which characteristics of brood-rearing habitat could be used in widely available, high resolution imagery 2 assessed the spatial extent at which sage-grouse selected brood-rearing habitat, and 3 created a predictive habitat model to identify areas of preferred brood-rearing habitat. We used AIC model selection to evaluate support for a list of variables derived from remotely-sensed imagery. We examined the relationship of these explanatory variables at three spatial extents (45, 200, and 795 meter radii. Our top model included 10 variables (percent shrub, percent grass, percent tree, percent paved road, percent riparian, meters of sage/tree edge, meters of riparian/tree edge, distance to tree, distance to transmission lines, and distance to permanent structures. Variables from each spatial extent were represented in our top model with the majority being associated with the larger (795 meter spatial extent. When applied to our study area, our top model predicted 75% of naïve brood locations suggesting reasonable success using this method and widely available NAIP imagery. We encourage application of our methodology to other sage-grouse populations and species of conservation concern.

  7. Experiência de ensino em medicina e enfermagem: promovendo a saúde da criança

    Directory of Open Access Journals (Sweden)

    Bruna Brenha Ribeiro

    Full Text Available Diante das mudanças curriculares do ensino médico e da importância da promoção de saúde e da atenção primária, este trabalho, fruto do PET-Saúde, possui como objetivo relatar uma experiência dos alunos do curso de Medicina e Enfermagem na integração entre ensino e serviço na Atenção Básica à Saúde. Além disso, mostra a importância do trabalho educativo na promoção de saúde e prevenção de doenças e evidencia os determinantes sociais no processo saúde-doença no território estudado. Este projeto foi dividido em duas fases: a primeira constou do cadastramento familiar do território adstrito à Unidade Saúde da Família do bairro utilizado como campo de ensino pela FMJ. A segunda trata da análise quanti-qualitativa realizada a partir dos dados colhidos, por meio dos quais foram elaboradas ações com foco na saúde da criança, saúde da mulher e saúde do adulto/idoso. Este artigo destaca as realizações na área de saúde da criança sobre os seguintes temas: acidentes na infância; aleitamento materno; obesidade; doenças respiratórias; anemia; e verminoses.

  8. Sampling and sensitivity analyses tools (SaSAT) for computational modelling.

    Science.gov (United States)

    Hoare, Alexander; Regan, David G; Wilson, David P

    2008-02-27

    SaSAT (Sampling and Sensitivity Analysis Tools) is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab, a numerical mathematical software package, and utilises algorithms contained in the Matlab Statistics Toolbox. However, Matlab is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  9. Assessing Greater Sage-Grouse Selection of Brood-Rearing Habitat Using Remotely-Sensed Imagery: Can Readily Available High-Resolution Imagery Be Used to Identify Brood-Rearing Habitat Across a Broad Landscape?

    Science.gov (United States)

    Westover, Matthew; Baxter, Jared; Baxter, Rick; Day, Casey; Jensen, Ryan; Petersen, Steve; Larsen, Randy

    2016-01-01

    Greater sage-grouse populations have decreased steadily since European settlement in western North America. Reduced availability of brood-rearing habitat has been identified as a limiting factor for many populations. We used radio-telemetry to acquire locations of sage-grouse broods from 1998 to 2012 in Strawberry Valley, Utah. Using these locations and remotely-sensed NAIP (National Agricultural Imagery Program) imagery, we 1) determined which characteristics of brood-rearing habitat could be used in widely available, high resolution imagery 2) assessed the spatial extent at which sage-grouse selected brood-rearing habitat, and 3) created a predictive habitat model to identify areas of preferred brood-rearing habitat. We used AIC model selection to evaluate support for a list of variables derived from remotely-sensed imagery. We examined the relationship of these explanatory variables at three spatial extents (45, 200, and 795 meter radii). Our top model included 10 variables (percent shrub, percent grass, percent tree, percent paved road, percent riparian, meters of sage/tree edge, meters of riparian/tree edge, distance to tree, distance to transmission lines, and distance to permanent structures). Variables from each spatial extent were represented in our top model with the majority being associated with the larger (795 meter) spatial extent. When applied to our study area, our top model predicted 75% of naïve brood locations suggesting reasonable success using this method and widely available NAIP imagery. We encourage application of our methodology to other sage-grouse populations and species of conservation concern.

  10. Molecular Analysis of South African Ovine Herpesvirus 2 Strains Based on Selected Glycoprotein and Tegument Genes.

    Directory of Open Access Journals (Sweden)

    Fulufhelo Amanda Doboro

    Full Text Available Ovine herpesvirus 2 (OvHV-2, is the causative agent of sheep-associated malignant catarrhal fever (SA-MCF, a generally fatal disease of cattle and other captive wild ruminants. Information on the OvHV-2 strains circulating in South Africa (SA and other African countries with regard to genetic structure and diversity, and pattern of distribution is not available. This study aimed to characterize the OvHV-2 strains circulating in SA using selected genes encoding glycoproteins and tegument proteins. To establish the genetic diversity of OvHV-2 strains, four genes, Ov 7, Ov 8 ex2, ORF 27 and ORF 73 were selected for analysis by PCR and DNA sequencing. Nucleotide and amino acid multiple sequence analyses revealed two genotypes for ORF 27 and ORF 73, and three genotypes for Ov 7 and Ov 8 ex2, randomly distributed throughout the regions. Ov 7 and ORF 27 nucleotide sequence analysis revealed variations that distinguished SA genotypes from those of reference OvHV-2 strains. Epitope mapping analysis showed that mutations identified from the investigated genes are not likely to affect the functions of the gene products, particularly those responsible for antibody binding activities associated with B-cell epitopes. Knowledge of the extent of genetic diversity existing among OvHV-2 strains has provided an understanding on the distribution patterns of OvHV-2 strains or genotypes across the regions of South Africa. This can facilitate the management of SA-MCF in SA, in terms of introduction of control measures or safe practices to monitor and control OvHV-2 infection. The products encoded by the Ov 7, Ov 8 ex2 and ORF 27 genes are recommended for evaluation of their coded proteins as possible antigens in the development of an OvHV-2 specific serodiagnostic assay.

  11. O complexo industrial da saúde e a necessidade de um enfoque dinâmico na economia da saúde

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2003-01-01

    Full Text Available O artigo desenvolve um enfoque analítico voltado para o estudo do complexo industrial da saúde, englobando o conjunto das atividades produtivas e suas relações de interdependência, segundo uma perspectiva de economia política e da inovação. A lógica empresarial capitalista penetra em todos os segmentos produtivos, envolvendo tanto as indústrias que já operavam tradicionalmente nessas bases quanto segmentos que possuíam formas de organização em que era possível verificar a convivência de lógicas empresariais com outras que dela se afastavam, como a produção de vacinas e produtos biológicos, fitoderivados e a prestação de serviços de saúde. O artigo analisa a interação entre o sistema de saúde e o sistema econômico-industrial, mostrando como tem havido uma dicotomia na relação entre ambos, que se exprime na deterioração do potencial de inovação do país e numa crescente e preocupante vulnerabilidade externa da política de saúde. Sugere-se que o enfoque neoclássico tradicional da economia da saúde é insuficiente para tratar do complexo industrial da saúde, dada a intensidade do processo de mudança estrutural, e a necessidade de um enfoque teórico alternativo que incorpore a dinâmica de transformação econômica e institucional, de acumulação e de inovação.

  12. Perfil social do usuário do sistema único de saúde na atenção primária em saúde

    Directory of Open Access Journals (Sweden)

    Aline Braido Pereira

    2012-01-01

    Full Text Available O Sistema Único de Saúde (SUS foi criado como uma política para toda população. Conhecer o perfil de seu usuário é de fundamental importância para sua organização. Sendo assim, o objetivodessa pesquisa foi delinear o perfil social do usuário do SUS na Atenção Básica em Saúde de Santa Maria/RS. Métodos: Pesquisa descritiva, realizada em uma Estratégia de Saúde da Família ( ESF e uma Unidade Básica de Saúde (UBS de Santa Maria/RS no período de março a abril de 2010, onde foram incluídos usuários adultos, de ambos os gêneros. Resultados: Um total d e 1 12 u suários participaram da pesquisa. A grande procura pelo serviço de saúde foi à emergência/urgência, com relação a opinião em relação ao SUS, 60% dos usuários da UBS consideram o SUS ruim e 40,4% dos usuários da ESF consideraram bom. Conclusão: Cabe aos trabalhadores, usuários e apoiadores de uma teoria sobre a produção de saúde, tratar de construir projetos objetivando as necessidades, bem como dos meios necessários para atendê-las.

  13. Pesquisa em saúde, política de saúde e eqüidade na América Latina

    Directory of Open Access Journals (Sweden)

    Alberto Pellegrini Filho

    2004-06-01

    Full Text Available O autor analisa as relações entre pesquisa de saúde, políticas de saúde e eqüidade na América Latina. Descreve novas tendências no modo de produção do conhecimento, que permitem maior integração entre as necessidades sociais e a pesquisa, facilitando o vínculo entre esta e o processo de definição de políticas. Analisa as manifestações das novas tendências na América Latina e finaliza com a descrição de algumas iniciativas promovidas pela OPAS no sentido de aproveitar as oportunidades abertas pelas novas tendências para a melhoria das condições de saúde na região. Busca defender a tese de que a informação e o conhecimento são bens públicos essenciais e que as iniqüidades de acesso a esses bens são importantes determinantes das iniqüidades em saúde. Para que as políticas de saúde e as políticas de pesquisa em saúde se integrem e se consolidem como políticas públicas voltadas a atender ao interesse público e à promoção da eqüidade, é necessário o fortalecimento do processo democrático de definição das mesmas, multiplicando os atores envolvidos, os espaços e oportunidades de interação entre eles e instrumentando sua participação com o acesso eqüitativo a informações e conhecimentos científicos pertinentes que permitam a defesa fundamentada de seus interesses.

  14. Setting priorities for mental health research in Brazil Agenda de prioridades de pesquisa para saúde mental no Brasil

    Directory of Open Access Journals (Sweden)

    Guilherme Gregório

    2012-12-01

    Full Text Available BACKGROUND: The main aim of this study is to review the agenda for research priorities of mental health in Brazil. METHODOLOGY: The first step was to gather 28 experts (22 researchers, five policy makers, and the coordinator representing all mental health fields from different geographical areas of the country. Participants were asked to list what they considered to be the most relevant mental health research questions for the country to address in the next 10 years. Seventeen participants answered this question; after redundancies were excluded, a total of 110 responses were collected. As the second step, participants were asked to rank which questions were the 35 most significant. The final step was to score 15 items for each of the 35 selected questions to determine whether it would be a answerable, b effective, c deliverable, d equitable, and e effective at reducing the burden of mental health. The ten highest ranked questions were then selected. RESULTS: There were four questions addressing primary care with respect to a the effectiveness of interventions, b "matrix support", c comparisons of different models of stepped care, and d interventions to enhance identification and treatment of common mental disorders at the Family Health Program. The other questions were related to the evaluation of mental health services for adults and children/adolescents to clarify barriers to treatment in primary care, drug addiction, and severe mental disorders; to investigate the cost-benefit relationship of anti-psychotics; to design interventions to decrease alcohol consumption; and to apply new technologies (telemedicine for education and supervision of non-specialists. CONCLUSION: This priority-setting research exercise highlighted a need for implementing investments at the primary-care level, particularly in the family health program; the urgent need to evaluate services; and policies to improve equity by increasing accessibility to services and

  15. Desigualdades socioeconômicas na saúde

    Directory of Open Access Journals (Sweden)

    Diaz Maria Dolores M.

    2003-01-01

    Full Text Available Este artigo analisa as desigualdades socioeconômicas na área da saúde no Brasil, por meio da mensuração de índice de concentração para a variável autoavaliação do estado de saúde. Utilizou-se a base de dados originada pela Pesquisa Domiciliar sobre Padrões de Vida - PPV - realizada pelo IBGE no período de março/1996 a março/1997, em convênio com o Banco Mundial. Entre os principais resultados, deve-se destacar a constatação de que existem diferenças estatisticamente significativas entre índices calculados a partir de distintas variáveis caracterizadoras do nível socioeconômico dos indivíduos. Neste caso, em particular, os indicadores calculados a partir da classificação baseada na variável renda indicou, sistematicamente, a presença de desigualdades na saúde ligeiramente superiores àquelas identificadas a partir da utilização das despesas familiares. Constatou-se, ainda, que os resultados obtidos são bastante robustos em relação às distintas ponderações utilizadas na construção das escalas de equivalência entre os indivíduos. Todas as simulações realizadas revelaram a presença de desigualdades que favorecem os indivíduos pertencentes às camadas mais elevadas das escalas socioeconômicas adotadas.

  16. O tratamento cartográfico da informação em saúde do trabalhador Mapping of information on worker's health

    Directory of Open Access Journals (Sweden)

    Raul Borges Guimarães

    2010-12-01

    Full Text Available Apesar do reconhecimento da importância dos conhecimentos geográficos e do uso das ferramentas de análise espacial nos estudos da saúde coletiva, esse é um campo ainda pouco explorado pelos pesquisadores brasileiros. Em levantamento realizado nas principais revistas científicas que veiculam os resultados de pesquisa em saúde do trabalhador, verificou-se o grande predomínio do uso de tabelas e gráficos como meio de organizar e apresentar os resultados obtidos, e o número reduzido de mapas. Para isso foram examinados todos os artigos publicados em quatro periódicos (Revista de Saúde Pública, Cadernos de Saúde Pública, Revista Saúde e Sociedade e Revista Brasileira de Epidemiologia no período de 1967 a 2009. Uma vez analisado o conjunto de artigos selecionados no estudo, aqueles que utilizaram representações cartográficas receberam atenção especial. Verificou-se que, embora ainda pouco utilizadas, as ferramentas do geoprocessamento e da geoestatística com suporte em SIG abrem um campo de novas possibilidades no uso da cartografia temática em saúde do trabalhador no Brasil. Contudo, recomenda-se para os editores das revistas científicas o detalhamento de normas técnicas para publicação de figuras cartográficas, assim como a elaboração de pareceres específicos que possam auxiliar os autores em vista das modificações necessárias para a melhoria da qualidade da comunicação visual de mapas e da correlação espacial por meio do tratamento cartográfico.Geographic studies and spatial analyses have been recognized in Brazilian public health papers. It is still, however, very little explored by researchers. In a survey of the leading scientific journals covering issues related to Brazilian worker's health, we found the predominant use of charts and tables as a way to organize and present results with a small number of maps. This survey was conducted by examining all papers published in four journals, covering the

  17. 什么是SA8000

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(SOCIAL ACCOUT ABILTY8000的英文简称)是其中最有名的标准之

  18. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Nogueira Vera Maria Ribeiro

    2004-01-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  19. Mulheres encarceradas em São Paulo: saúde mental e religiosidade

    Directory of Open Access Journals (Sweden)

    Paulo Augusto Costivelli de Moraes

    2006-01-01

    Full Text Available OBJETIVO: A religião tem um importante papel na vida de indivíduos encarcerados. A saúde mental e a possibilidade de reabilitação parecem ser favorecidas através da religião. Entretanto poucos estudos no Brasil abordaram a saúde mental em população carcerária feminina e a relacionaram com a religiosidade. O objetivo deste estudo é verificar o perfil de saúde mental e a relação entre religião, religiosidade e saúde mental numa amostra de mulheres encarceradas em São Paulo. MÉTODOS: Foram entrevistadas 358 mulheres, detentas da Penitenciária Feminina da Capital (São Paulo-SP. Foi aplicado um questionário amplo que abrangeu dados sociodemográficos e culturais (incluindo a religiosidade, assim como itens sobre saúde mental e perfil criminal. A avaliação psicopatológica foi feita com o General Health Questionnaire (GHQ-12. Análises estatísticas comparando as variáveis com o GHQ-12 foram realizadas. Foi utilizada também a análise de regressão logística multivariada para respostas dicotômicas para as variáveis que possivelmente interagiram com a saúde mental. RESULTADOS: A idade média da amostra foi 30,7 anos ± 8,5. A prevalência de possível caso psiquiátrico foi 26,6%. CONCLUSÕES: Uma maior religiosidade pessoal associou-se a menor freqüência de possível transtorno mental. Não foram encontradas associações entre tipo de crime e saúde mental.

  20. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Vera Maria Ribeiro Nogueira

    2004-06-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  1. Paism: um marco na abordagem da saúde reprodutiva no Brasil

    Directory of Open Access Journals (Sweden)

    Maria José Martins Duarte Osis

    Full Text Available O Programa de Assistência Integral à Saúde Mulher (PAISM foi lançado pelo Ministério da Saúde em 1983, sendo anunciado como uma nova e diferenciada abordagem da saúde da mulher. Paradoxalmente, o PAISM constitui-se também na primeira vez em que o Estado brasileiro propôs explicitamente, e implantou, embora de modo parcial, um programa que contemplava a regulação da fecundidade. Isso suscitou suspeitas acerca de possíveis intenções ocultas de controle da natalidade. Porém, analisando brevemente a história desse Programa e seu significado social, conclui-se que o PAISM foi pioneiro, inclusive no cenário mundial, ao propor o atendimento à saúde reprodutiva das mulheres, no âmbito da atenção integral à saúde, e não mais a utilização de ações isoladas em planejamento familiar. Por isso mesmo, os movimentos de mulheres, de imediato, passaram a lutar por sua implementação. Seu conteúdo inclui plenamente a definição de saúde reprodutiva adotada pela Organização Mundial da Saúde em 1988, ampliada e consolidada no Cairo em 1994 e em Beijing em 1995. Conseqüentemente, a adoção do PAISM representou, sem dúvida, um passo significativo em direção ao reconhecimento dos direitos reprodutivos das mulheres, mesmo antes que essa expressão ganhasse os diversos foros internacionais de luta.

  2. Pagsusuri sa mga Balyung Nakapaloob sa mga Salawikain ng mga Tiruray Sa South Upi, Maguindanao, Philippines

    Directory of Open Access Journals (Sweden)

    Maria Luz D. Calibayan

    2015-12-01

    Full Text Available This study sought to collect, record, translate, and analyze the Tiruray proverbs. Specifically the study aimed to find out the following: (1 What are the existing proverbs of Tiruray in South Upi, Maguindanao? (2What are the values found as expressed in the proverbs of Tiruraythat have been successfully preserved from their ancestors? The scope of this study was confined to the collected proverbs of Tiruray in South Upi, Maguindanao. The gatheredproverbs were transcribed from Tiruray to Filipino languageand the analysis of values from the translated proverbs was in accordance with the ideas of Andres (1985 and Timbreza (2003. The research design adopted in the study is descriptive content analysis because the main objective of the study was to analyse the values found in Tiruray proverbs. Findings revealed that the Tiruray have rich in oral literary piecessuch as proverbs which are transmitted by word of mouth from generation to generation. The Tiruray proverbs contain differenthuman values that teach or remind people how to live godly lives. Further, Tiruray proverbs conveyed message on how they value peace and harmony in the community for they are peace-loving people. The study of Tiruray proverbs could increase the body of knowledge about the cultural traits of Tiruray who are unique people and have rich cultural heritage.

  3. Saúde Masculina: representação e experiência de homens trabalhadores com o corpo, saúde e doença.

    Directory of Open Access Journals (Sweden)

    Marco Antonio Alves SEPARAVICH

    2015-10-01

    Full Text Available Este estudo analisou as experiências e representações de homens trabalhadores com o corpo, saúde, doença e cuidado, e os problemas principais de saúde por eles percebidos, quais sejam, a hipertensão arterial e as lombalgias crônicas. Analisou-se como explicam as suas causas; a forma como enfrentam e buscam a resolução ou mitigação desses problemas de saúde, as terapêuticas utilizadas, a interferência que elas acarretam em suas rotinas de vida e identidades. A revisão da literatura da Saúde Coletiva sobre a saúde do homem e masculinidades mostrou que as demandas masculinas na busca por tratamentos nos serviços públicos de saúde e a percepção de que são portadores de necessidades específicas de saúde são minoritárias. Constatou-se também que as abordagens socioantropológicas de como eles convivem e lidam com as enfermidades que os acometem também são raras. Justifica-se, portanto, o interesse e as razões que motivaram este trabalho. As demandas minoritárias masculinas aos serviços de saúde, concebidas a partir da masculinidade tradicional socialmente vigente, e os dados epidemiológicos das altas taxas de morbimortalidade masculina, embasaram a formulação da Política Nacional de Atenção Integral à Saúde do Homem (PNAISH, cujos objetivos buscam promover a melhora da saúde da população masculina na faixa etária dos 20 aos 59, facilitando o seu acesso aos serviços de atendimento integral à saúde na atenção primária. Campinas abriga projeto piloto de tal política. Analisou-se o processo de implementação da PNAISH em um dos centros de saúde da cidade elegido como piloto, cujos serviços estruturam-se na Estratégia Saúde da Família. Entrevistou-se 9 profissionais que nele atuam, especificamente na saúde do adulto, considerando o conhecimento que têm de tal política, as atividades que realizam para o seu atendimento, e os obstáculos observados que dificultam a sua implementação. Para o

  4. 77 FR 41353 - GENECTIVE SA; Availability of Petition for Determination of Nonregulated Status of Maize...

    Science.gov (United States)

    2012-07-13

    ... concerning the introduction of certain genetically engineered organisms and products. We are making the... Analysis Programs, Biotechnology Regulatory Services, APHIS, 4700 River Road Unit 147, Riverdale, MD 20737....), the regulations in 7 CFR part 340, ``Introduction of Organisms and Products Altered or Produced...

  5. 78 FR 45169 - GENECTIVE SA; Availability of Plant Pest Risk Assessment, Environmental Assessment, Preliminary...

    Science.gov (United States)

    2013-07-26

    ..., seeking a determination of nonregulated status of maize designated as VCO-01981-5, which has been....) designated as event VCO-01981-5, which has been genetically engineered for resistance to the herbicide... prepared a PPRA and has concluded that maize event VCO- 01981-5 is unlikely to pose a plant pest risk....

  6. Percepções sobre necessidades de saúde na Atenção Básica segundo usuários de um serviço de saúde

    Directory of Open Access Journals (Sweden)

    Paulo Alexandre de Moraes

    2011-03-01

    Full Text Available Trata-se de pesquisa qualitativa de caráter exploratório, com o objetivo de conhecer o conceito de necessidades de saúde, segundo a percepção de usuários de um serviço de saúde do interior paulista. Realizou-se 15 entrevistas, por meio de roteiro semi-estruturado, em janeiro de 2009. A leitura exaustiva das entrevistas permitiu a apreensão de elementos constitutivos das categorias, definidas a priori, segundo a Taxonomia das Necessidades de Saúde. Identificou-se que os usuários perceberam-se como detentores de necessidades; o contexto social pode apresentar forte influência na sua saúde, verificando-se que a autonomia na tomada de decisões é uma necessidade. Quanto ao vínculo, percebe-se que está intimamente ligado às necessidades de autonomia/autocuidado, pois de certo modo é reforçando a relação de confiança que será possível fortalecer os potenciais para o enfrentamento do processo saúde-doença. Conclui-se que existe a necessidade de instrumentos que auxiliem o profissional da área da Saúde Coletiva a identificar as necessidades de saúde dos usuários.

  7. O contrato organizativo da ação pública da saúde (COAP: as regiões de saúde no Rio Grande do Sul sob o eixo dos recursos financeiros

    Directory of Open Access Journals (Sweden)

    Luís Fernando Kranz

    2015-12-01

    Full Text Available O financiamento e a regionalização são pontos críticos para a implantação dos Contratos Organizativos da Ação Pública da Saúde (COAP’s. Para operacionalizá-los, os 496 municípios do RS foram divididos em 30 Regiões de Saúde (RS. Objetiva-se quantificar o volume total de Recursos Transferidos para a Saúde (RTS e de Recursos Próprios Aplicados em Saúde (RPAS e estimar o gasto público em saúde por habitante segundo RS. Os dados municipais do SIOPS e do IBGE foram agregados por RS para o período 2008-2011. Os RTS atingiram aproximadamente R$ 1,6 bilhão/ano (86,4% transferidos da União. Os RPAS somaram R$ 2,1 bilhões/ano (57,8% do total aplicado em saúde. Porto Alegre foi a RS que mais aplicou por habitante/ano (R$ 427,36 e Alegrete/Uruguaiana a que menos aplicou (R$ 226,33. As RS apresentam características financeiras bastante distintas quando comparadas entre si e variações expressivas no gasto público em saúde per capita.

  8. DAYA SAING PRODUK TURUNAN SUSU INDONESIA DI PASAR DUNIA

    Directory of Open Access Journals (Sweden)

    Lina Yanti

    2012-06-01

    Full Text Available ABSTRACTThis research purposes were (1 to measures the competitiveness of Indonesian milk derivative product in international market based on its comparative advantage, (2 to analyze the dynamics of Indonesian milk and also to analyze the commodity’s competitive position in the international market through its dynamic export product performance, (3 to analyze dominant factors that influencing Indonesian dairy export growth based on constant market share analysis. The analysis methods used to measure the competitiveness of Indonesian milk in this research are based on revealed comparative advantage analysis, Export product dynamic analysis (EPD, and constant market share analysis. The result from RCA showed that the Indonesian milk derivative products which are Milk not concentrated nor sweetened 1–6% fat (HS 040120, Milk and cream, concentrated or sweetened (HS 0402 and Buttermilk, curdled milk, cream, kephir, etc (HS 040390 do not have comparative advantage but for Milk and cream powder unsweetened > 1,5%  fat (HS 040221, Milk and cream nes sweetened or concentrated (HS 040299 and Cereal, flour, starch, milk preparations and products (HS19 have comparative advantage. The EPD found that all Indonesian milk derivative products are included in the Rising Star position. The result test using CMS analysis concluded that the most significant factor which affect the export growth for Indonesian HS 040390 and HS 0402 derivative products are the import growth effect, HS 19 is mainly dominated by commodity composition effect, and the export growth for the rest derivative products are dominated with the competitiveness effect. Therefore, it needs to be implemented efforts to enhance the competitiveness of dairy derived products IndonesiaKeywords: milk, competitiveness, revealed comparative advantage (RCA, export product dynamic (EPD, constant market share analysis (CMSAABSTRAKPenelitian ini bertujuan (1 menganalisis daya saing komoditas susu

  9. Review: Louis Lebel, John Dore, Rajesh Daniel, and Yang Saing Koma (eds.: Democratizing Water Governance in the Mekong Region (2007 Buchbesprechung: Louis Lebel, John Dore, Rajesh Daniel, and Yang Saing Koma (eds.: Democratizing Water Governance in the Mekong Region (2007

    Directory of Open Access Journals (Sweden)

    Henriette Litta

    2009-04-01

    Full Text Available Review of the edited volume: Louis Lebel, John Dore, Rajesh Daniel, and Yang Saing Koma (eds.: Democratizing Water Governance in the Mekong Region Chiang Mai, Thailand: Mekong Press, 2007, ISBN 978-974-9511-25-1, 304 pages Besprechung des Sammelbandes: Louis Lebel, John Dore, Rajesh Daniel, and Yang Saing Koma (Hrsg.: Democratizing Water Governance in the Mekong Region Chiang Mai, Thailand: Mekong Press, 2007, ISBN 978-974-9511-25-1, 304 Seiten.

  10. Total synthesis and evaluation of iso-duocarmycin SA and iso-yatakemycin.

    Science.gov (United States)

    MacMillan, Karen S; Nguyen, Trinh; Nguyen, Trihn; Hwang, Inkyu; Boger, Dale L

    2009-01-28

    The total synthesis and evaluation of iso-duocarmycin SA (5) and iso-yatakemycin (6), representing key analogues of the corresponding natural products incorporating an isomeric alkylation subunit, are detailed. This pyrrole isomer of the natural alkylation subunit displayed an enhanced reaction regioselectivity and a 2-fold diminished stability. Although still exceptionally potent, the iso-duocarmycin SA derivatives and natural product analogues exhibited a corresponding approximate 3-5-fold reduction in cytotoxic activity [L1210 IC(50) for (+)-iso-duocarmycin SA = 50 pM and for (+)-iso-yatakemycin = 15 pM] consistent with their placement on a parabolic relationship correlating activity with reactivity. The DNA alkylation selectivity of the resulting key natural product analogues was unaltered by the structure modification in spite of the minor-groove presentation of a potential H-bond donor. Additionally, a unique ortho-spirocyclization with such derivatives was explored via the preparation, characterization, and evaluation of 34 that is incapable of the more conventional para-spirocyclization. Although 34 proved sufficiently stable for isolation and characterization, it displayed little stability in protic solvents (t(1/2) = 0.19 h at pH 3, t(1/2) = 0.20 h at pH 7), a pH-independent (H(+) independent) solvolysis rate profile at pH 3/4-7, and a much reduced cytotoxic potency, but a DNA alkylation selectivity and efficiency comparable to those of duocarmycin SA and iso-duocarmycin SA. The implications of these observations on the source of the DNA alkylation selectivity and catalysis for this class of natural products are discussed.

  11. Places disponibles/Places available

    CERN Multimedia

    2004-01-01

    Etant donné le délai d'impression du Bulletin, ces places peuvent ne plus être disponibles au moment de sa parution. Veuillez consulter notre site Web pour avoir la dernière mise à jour. The number of places available may vary. Please check our Web site to find out the current availability. Des places sont disponibles dans les cours suivants : / Places are available in the following courses : Introduction à Outlook : 19.8.2004 (1 journée) Outlook (short course I) : E-mail : 31.8.2004 (2 hours, morning) Outlook (short course II) : Calendar, Tasks and Notes : 31.8.2004 (2 hours, afternoon) Instructor-led WBTechT Study or Follow-up for Microsoft Applications : 7.9.2004 (morning) Outlook (short course III) : Meetings and Delegation : 7.9.2004 (2 hours, afternoon) Introduction au VHDL et utilisation du simulateur NCVHDL de CADENCE : 7 & 8.9.2004 (2 jours) Joint PVSS JCOP Framework : 13 - 17.9.2004 (5 days) AutoCAD 2002 - niveau 1 : 13, 14, 23, 24.9.2004 (4 jours) Programmation S...

  12. El libro, instrumento de cultura y objeto económico. Pere sa Sala, escribano real (siglo XV

    Directory of Open Access Journals (Sweden)

    Hernando, Josep

    1999-12-01

    Full Text Available Pere sa Sala (✝1480, royal scrivener and citizen of Barcelona, notes in a memorandum in his will, which books (held by other people belong to him and which books (that he holds belong to others. This allows us to see a sample of his excellent library. Besides, Pere sa Sala copied books, lent books, accepted books as a guarantee for loans, and exchanged books. A book was for him both a cultural tool and an economic object.[fr] Pere sa Sala (✝1480, écrivain du roi et citoyen de Barcelone, rappelle dans un mémorial inséré dans son testament, quels livres, que ont des autres, sont de sa propriété, et quels livres, qui sont dans sa bibliothèque, appartiennent à des autres. Ceci nous permet voir quelque chose de l’excellente bibliothèque de l'écrivain Pere sa Sala. En outre, Pere sa Sala copia des livres, accepta des livres en gage, changea des livres. Le livre était pour lui un instrument de culture et un objet économique.

  13. A dimensão ética na educação para a saúde

    Directory of Open Access Journals (Sweden)

    Patrick Paul

    2005-04-01

    Full Text Available A ética, como julgamento de apreciação das condutas positivas e negativas, tanto no que diz respeito ao usuário como ao profissional, coloca de início a problemática do desejo e do conhecimento. A educação para a saúde, através dos três modelos classicamente referidos da saúde positiva, da saúde negativa e da saúde global, vai interrogar de variadas maneiras o posicionamento ético em função dos pontos de vista diferentes fortemente ligados às representações sociais. Além disso, o questionamento ético da saúde inscreve-se também naquele, mais largo, da filosofia da educação entre praxis e poïesis. Mas ele impõe também a aceitação do acidente como imperativo que valoriza o erro, com a introdução da complexidade vindo quebrar o dogma das certezas. Reunir as diferentes facetas da saúde e de sua educação sugere então, finalmente, que tomar cuidado é viver o mais autenticamente possível, com o educar para a saúde significando formar e formar-se para a autenticidade.

  14. SA-Mot: a web server for the identification of motifs of interest extracted from protein loops.

    Science.gov (United States)

    Regad, Leslie; Saladin, Adrien; Maupetit, Julien; Geneix, Colette; Camproux, Anne-Claude

    2011-07-01

    The detection of functional motifs is an important step for the determination of protein functions. We present here a new web server SA-Mot (Structural Alphabet Motif) for the extraction and location of structural motifs of interest from protein loops. Contrary to other methods, SA-Mot does not focus only on functional motifs, but it extracts recurrent and conserved structural motifs involved in structural redundancy of loops. SA-Mot uses the structural word notion to extract all structural motifs from uni-dimensional sequences corresponding to loop structures. Then, SA-Mot provides a description of these structural motifs using statistics computed in the loop data set and in SCOP superfamily, sequence and structural parameters. SA-Mot results correspond to an interactive table listing all structural motifs extracted from a target structure and their associated descriptors. Using this information, the users can easily locate loop regions that are important for the protein folding and function. The SA-Mot web server is available at http://sa-mot.mti.univ-paris-diderot.fr.

  15. Saúde na Agenda de Desenvolvimento pós-2015 das Nações Unidas

    Directory of Open Access Journals (Sweden)

    Paulo Marchiori Buss

    2014-12-01

    Full Text Available O artigo examina a presença da saúde como Ob-jetivo do Desenvolvimento Sustentável (ODS na Agenda do Desenvolvimento pós-2015, no processo transcorrido entre 2012 e 2014. Presente desde a Cúpula do Milênio e os ODM (2000, a saúde também aparece nos documentos que tratam da Agenda pós-2015, da Rio+20 ao documento do Grupo de Trabalho Aberto das Nações Unidas (OWG, submetido à Assembleia Geral das Nações Unidas (AGNU 2014-2015, passando pela Con-sulta Global sobre Saúde e o Painel de Alto Nível de Pessoas Eminentes. Os autores concluem pela uniformidade com que a saúde aparece nestes documentos. Identificam a amplitude do enunciado do ODS Saúde, mas alertam para o fracionamento e redução conceitual de suas metas. Propõem mudanças nas mesmas, acrescentando a questão dos determinantes sociais da saúde e metas em saúde pública, ausentes na proposta do OWG. Alertam para a necessidade de reformas na governança global e nacional, bem como para a participação da sociedade civil e da influência que pode exercer sobre a diplomacia, responsável pelo pacto que será firmado na AGNU de 2015.

  16. Algumas características do setor privado de saúde de Salvador, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Silva Ligia Maria Vieira da

    1997-01-01

    Full Text Available Com o objetivo de descrever algumas características dos serviços de saúde privados do Município de Salvador, foi realizado inquérito envolvendo 174 estabelecimentos cadastrados no IBGE. Foram investigados a natureza jurídica, a capacidade instalada ambulatorial e hospitalar, a produção e o custo das consultas médicas segundo modalidades de financiamento público e privado. As diferentes formas de assistência médica supletiva são a principal fonte de financiamento da assistência ambulatorial, e 51,1% das unidades investigadas são independentes dos recursos públicos oriundos do Sistema Único de Saúde (SUS. Os convênios-empresa e o seguro saúde stricto sensu participaram de forma moderada e elevada do financiamento das consultas médicas, em 54% e 41,9% dos serviços respectivamente. Os autores discutem o significado das modificações verificadas no segmento privado da atenção à saúde de Salvador, bem como as implicações desses achados no que diz respeito ao redimensionamento das estratégias de reorganização das práticas e serviços de saúde no País e de relacionamento entre o público e o privado.

  17. Uma experiência em comunicação e saúde

    Directory of Open Access Journals (Sweden)

    Marina Ruiz de Matos

    2009-12-01

    Full Text Available Este trabalho refere-se à experiência desenvolvida no município de Guarulhos, sob o patrocínio do Ministério da Saúde, com o objetivo de envolver radiocomunicadores no processo educativo em saúde. Organizaram-se oficinas de trabalho com a participação de funcionários dos serviços municipais de saúde e de radialistas das rádios comunitárias das mesmas áreas de abrangência, para reflexão, discussão e elaboração de ações conjuntas sobre temas de saúde. Desenvolveu-se metodologia que articulou, além de textos acadêmicos, outros tipos de linguagem como pintura, música, radionovela, poesia etc., na abordagem dos assuntos. A avaliação final constou de um questionário preenchido pelos participantes e a análise das respostas indicou tratar-se de uma metodologia compatível com os objetivos de alcançar envolvimento e desenvolver parcerias entre comunicadores, serviços de saúde e comunidade.

  18. A diversidade cultural presente nos vídeos em saúde

    Directory of Open Access Journals (Sweden)

    Alice Ferry de Moraes

    2008-12-01

    Full Text Available Os vídeos, cada vez mais, são utilizados como suportes informacionais nas ações de intervenção social na área da saúde. Conhecer os elementos culturais existentes nos vídeos em saúde foi o objetivo deste trabalho, pois eles são facilitadores da transferência da informação. Estudos sobre o uso da informação em saúde no país, a força das imagens no processo cognitivo dos indivíduos e a necessidade de contextualização das informações repassadas serviram de base para a análise dos vídeos finalistas da III Mostra de Vídeos em Saúde, promovida pela Fundação Oswaldo Cruz (Fiocruz e realizada no Rio de Janeiro, em 1998. Com base na observação de alguns dados das fichas técnicas desses vídeos, foi possível identificar o meio cultural no qual eles foram produzidos. A diversidade cultural presente nas ações comunicacionais em todos os âmbitos, inclusive na promoção da saúde e na prevenção de doenças, é um elemento essencial para o progresso social.

  19. A segunda crítica social da Saúde de Ivan Illich

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2003-02-01

    Full Text Available Na Nêmesis da Medicina, Ivan Illich expôs os elementos essenciais da sua primeira crítica da saúde, afirmando que a ampla industrialização da saúde e medicalização da vida na sociedade moderna faz aparecer diversas formas de iatrogênese ou danos à saúde, como resultado da perda da capacidade de ação autônoma das pessoas perante a enfermidade, a dor e o envelhecimento. Na segunda crítica social da saúde, Illich trata do surgimento de uma nova iatrogênese social, a iatrogênese do corpo, que resulta de uma espécie de obsessão com a saúde corporal e com sua produção através de atividades físicas, dietas etc. em aparente condição de autonomia. Trata-se de um consumismo do corpo saudável, que responde menos à ação dos médicos e mais às informações difundidas pelos meios de comunicação e pelos agentes terapêuticos não-oficiais.

  20. Para uma análise existencial da saúde

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2006-12-01

    Full Text Available A ontologia fundamental de Heidegger de Ser e Tempo tem servido de fonte de inspiração para investigadores que realizam seus trabalhos nas áreas de saúde mental e saúde coletiva, a despeito das dificuldades de interpretação dessa obra. O entendimento equivocado por Binswanger, na tentativa de transpô-la para a psicanálise, serve de exemplo e é brevemente exposto com base na análise detalhada feita por Loparic. Neste artigo, parte-se do pressuposto de que a linguagem antimetafísica de Heidegger pode ajudar a fechar o que denomina de fenda ontológica entre saúde mental e saúde do corpo. Na primeira parte, recapitulam-se alguns equívocos que podem ser cometidos na interpretação da ontologia heideggeriana e delineiam-se os critérios de não-objetivação e não-determinismo. Na segunda, o autor aporta sua contribuição pessoal, ao explicitar sua própria interpretação da analítica existencial da saúde, articulada em torno de termos, tais como: padecimento, socorro e reatamento.

  1. Refletindo sobre valores éticos da Saúde Global

    Directory of Open Access Journals (Sweden)

    Paulo Antonio de Carvalho Fortes

    2015-06-01

    Full Text Available Desde as últimas décadas do século passado vem sendo construído o campo da saúde global, enfocando questões de saúde supraterritoriais, que extrapolam as fronteiras nacionais, assim como seus determinantes e suas possíveis soluções. Este ensaio objetiva refletir sobre os valores éticos envolvidos na saúde global: justiça social, equidade e solidariedade. Procedeu-se à revisão de artigos científicos e documentos de agências multilaterais. Identificou-se a defesa da saúde global como um bem universal público, analisando os valores da justiça e da equidade com enfoque na alocação e distribuição de recursos, com tendência a priorizar os mais desfavorecidos. São apresentados conceitos de solidariedade, buscando compreender se há a responsabilidade moral de ser solidário com pessoas de outros países, o que justificaria a cooperação internacional na saúde.

  2. Conselhos locais de saúde: caminhos e (descaminhos da participação social

    Directory of Open Access Journals (Sweden)

    Edgar Andrade Lisboa

    Full Text Available Resumo Este estudo analisou a criação e a implantação dos conselhos locais de saúde no município de Anchieta, no estado do Espírito Santo. Buscou-se identificar os fatores que apoiaram ou limitaram a sua efetiva participação no contexto do Sistema Único de Saúde local. Por meio de abordagem qualitativa, realizaram-se 13 entrevistas com os conselheiros. Utilizou-se a análise de conteúdo, evidenciando três categorias trabalhadas neste texto: Ser ou não ser conselheiro de saúde? Eis a questão!; O não pertencimento e a não participação; e Conselhos locais de saúde: elos, meios e mediações. Concluiu-se que os conselheiros enfrentam grandes dificuldades que acabam por desvirtuar os caminhos desejados da participação social no âmbito do Sistema Único de Saúde. Por isso, é imprescindível que haja vontade política, apoio à participação efetiva e programas de educação para a cidadania dos atores envolvidos nesses fóruns, para que assim possam exercer de forma plena seu papel.

  3. Necessidades em saúde: questões importantes para o trabalho da enfermagem

    Directory of Open Access Journals (Sweden)

    Edir Nei Teixeira Mandu

    1999-03-01

    Full Text Available A construção de novos parâmetros e práticas em saúde e enfermagem, no sentido do efetivo exercício de direitos sociais, é um desafio posto na atualidade. Este trabalho é uma contribuição ao enfrentamento desse desafio. Olhando para o saber da enfermagem, reflete-se sobre um dado modo de interpretação das necessidades em saúde. A partir de uma discussão acerca das necessidades humanas e de sua relação com o trabalho em saúde, submete-se à crítica a interpretação das necessidades humanas/em saúde presente na teoria de Wanda de Aguiar Horta. Destaca-se na análise a importância da autonomia/autovalorização humana e a interpretação de necessidades a partir da consideração aos sujeitos que recebem-fazem saúde e ao contexto social.

  4. Enredando lutas cotidianas: dispositivos de saúde pela cidade

    Directory of Open Access Journals (Sweden)

    Arielle Rocha de Oliveira Silva

    2009-12-01

    Full Text Available A partir das experiências de intervenções em serviços públicos de saúde e em outros setores da cidade, este trabalho afirma uma prática oficineira descentralizada capaz de compor na construção de redes sociais, servindo de instrumento de análise e possibilitando a invenção de modos de vida e afirmação de singularidades. As intervenções na cidade abrem caminhos para mudanças nos processos em curso e contribuem para a produção de saúde/cidadania por meio da potência conectiva das lutas. O enlace dessas temáticas visa ampliar o campo problemático da atenção psicossocial e fortalecer a luta antimanicomial no Espírito Santo, apostando em novas formas de atuação.

  5. Altera – Technical update, presented by Sascoholz SA

    CERN Multimedia

    FI Department

    2008-01-01

    Thursday 28 August 2008 From 9h00 to 12h00 (welcome at 08h45) in Room B (Main Building 61/1-009) SascoHolz SA cordially invites you to an informative and interesting technical update on the latest Altera FPGA developments. Introducing Altera’s Stratix IV Device Family 40-nm high-performance, high-end FPGAs with 8.5-Gbps transceiver option The Stratix IV FPGA family gives you the highest density, highest system performance, and the lowest power available in an FPGA, enabling innovation without compromise. Speaker Ole Horn, FAE Sascoholz Agenda Altera Stratix IV Device FamilyIntroduction Logic Fabric Architecture DSP Blocks Tri-Matrix Memory PLL and Clock Networks Design Security I/O Connectivity High-Speed Transceiver Low Power Consumption Language: English As a member of the globally active distribution group, Arrow Electronics, SascoHolz SA does more than just following the concepts of classic broadline distributors. In fact, we offer a depth of service throughou...

  6. Saúde dos imigrantes: multidimensionalidade, desigualdades e acessibilidade em Portugal

    Directory of Open Access Journals (Sweden)

    Beatriz Padilla

    Full Text Available Este artigo descreve os aspectos multidimensionais da saúde das populações imigrantes e os seus descendentes, tomando como exemplo o caso português. Por um lado, coloca-se ênfase na importância da acessibilidade e das diferentes barreiras que a condicionam e por outro lado, salientam-se as intervenções do estado e da sociedade civil em prol da saúde dos imigrantes, num contexto actual marcado pela crise internacional.

  7. FARM-CHEMICALS S.A. PLANTA FORMULADORA Y PRODUCTORA DE AGROQUÍMICOS

    Directory of Open Access Journals (Sweden)

    Gabriel Arturo García Gómez

    2002-01-01

    Full Text Available En esta tesis se analiza el sector en el cual se encuentra la empresa Farm-Chemicals S.A. planta Formuladora y Productora de Agroquímicos genéricos, evaluando su potencial de mercado y se presenta un modelo financiero desde cuatro escenarios, con lo que obtenemos posibles panoramas futuros para la Compañía. La información ha sido preparada cuidadosamente, después de estudiar el mercado potencial existente, la situación competitiva de Farm-Chemicals S.A. y las expectativas futuras dentro del sector en que se desenvuelve.

  8. Um objeto de estudo sobre ensino de enfermagem psiquiátrica e saúde mental

    Directory of Open Access Journals (Sweden)

    Luciane Prado Kantorski

    1998-09-01

    Full Text Available O artigo aborda a construção de um objeto de estudo sobre o ensino de enfermagem psiquiátrica e saúde mental. Apóia-se no referencial teóricometodológico marxista redimensionando conceitos como o ensino - enquanto prática de reprodução e resistência - ideologia/contra-ideologia, atores/sujeitos sociais, saúde mental e reforma psiquiátrica.

  9. O relativismo cultural é válido nas ciências da saúde? Exame de suas bases filosóficas

    Directory of Open Access Journals (Sweden)

    Erna Bastian

    1971-06-01

    Full Text Available Examina-se o conceito do relativismo cultural sob bases filosóficas e sua validade nas ciências da saúde. Analisam-se os têrmos absoluto, relativo e universal, chegando-se a um modêlo operacional do relativismo cultural nas ciências da saúde.

  10. HySA infrastructure center of competence: A strategic collaboration platform for renewable hydrogen production and storage for fuel cell telecom applications

    CSIR Research Space (South Africa)

    Bessarabov, D

    2014-09-01

    Full Text Available The Department of Science and Technology of South Africa developed the National Hydrogen and Fuel Cells Technologies (HFCT) Research, Development and Innovation Strategy. The National Strategy was branded Hydrogen South Africa (HySA). HySA has been...

  11. Cuidados em saúde entre portadores de diabetes mellitus autorreferido no Brasil, Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    2015-12-01

    Full Text Available Resumo: Objetivo: Descrever medidas do cuidado assistencial destinadas ao paciente com diabetes mellitus autorreferido no Brasil. Métodos: Foram utilizados dados da Pesquisa Nacional de Saúde(2013, estudo transversal de base populacional, referentes ao cuidado em saúde com o diabetes mellitus autorreferido, quanto ao uso de serviços de saúde e acesso a medicamentos. Resultados: A prevalência de diabetes mellitus autorreferido foi de 6,2%, e 11,5% da população nunca fez uma glicemia na vida. Dos adultos que referiram diabetes mellitus , 80,2% tomaram medicamentos nas duas semanas anteriores à entrevista, 57,4% usaram o Programa Farmácia Popular, 73,2% receberam assistência médica e 47,1% realizaram o atendimento nas Unidades Básicas de Saúde. Em 65,2%, o médico que atendeu na última consulta era o mesmo das consultas anteriores, 95,3% dos pacientes conseguiram realizar os exames complementares solicitados e 83,3% conseguiram fazer as consultas com o médico especialista. A avaliação de pés e olhos foi relatada por 35,6 e 29,1% dos portadores de diabetes mellitus , respectivamente. Relataram internação hospitalar por causa do diabetes ou de alguma complicação 13,4% dos adultos, e outros 7,0% relataram limitações nas atividades diárias. Em geral, mulheres, assim como a população mais idosa, de maior escolaridade, brancos e residentes nas regiões Sul e Sudeste, tiveram maior prevalência da doença e maior acesso aos serviços, medicamentos e consultas. Discussão: Os cuidados aos portadores de diabetes foram recebidos de forma adequada, na maioria dos casos, o que é essencial para manter a qualidade de vida dos pacientes e prevenir desfechos mais graves.

  12. Educação para a saúde a grupo de obesos

    Directory of Open Access Journals (Sweden)

    Glaci de Oliveira Pinto Vargas

    1983-03-01

    Full Text Available Este trabalho foi realizado por enfermeiras que atuam a nível ambulatorial, num Programa de Adulto, no Serviço de Saúde Pública, de um hospital geral de Porto Alegre, RS. É uma contribuição original de uma pesquisa descritivo analítica, com grupos de clientes obesos, atendidos através de cursos de educação para a saúde. Pretende-se avaliar quatro aspectos sem ordem de prioridade: a interesse da clientela pela educação da saúde, em grupo; b impressão, em relação aso conteúdos desenvolvidos; c redução do peso; d mudança de algum hábito de vida.

  13. O fazer da enfermeira no sistema local de saúde: individual ou coletivo?

    Directory of Open Access Journals (Sweden)

    Marluce Maria Araújo Assis

    1996-09-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca do fazer da enfermeira no Sistema Local de Saúde (SILOS, permitindo compreender (ainda que provisoriamente se o espaço que vem sendo ocupado pela mesma, na "porta de entrada" dos serviços de saúde, tem possibilitado uma construção ideológica de sua ação social, enquanto sujeito coletivo ou individual. Assim, procuramos nos pautar teoricamente no pensamento de Testa (1995 e apontamos o SILOS, enquanto um espaço social de transformação do Sistema de Saúde. Discutimos também, as relações vivenciadas no cotidiano da organização institucional, tentando entender o processo de produção de sujeitos sociais, focalizando a enfermeira nesta construção.

  14. A construção coletiva da Biblioteca Virtual em Saúde

    Directory of Open Access Journals (Sweden)

    Abel Laerte Packer

    2005-08-01

    Full Text Available Retoma-se a origem da Biblioteca Virtual em Saúde (BVS como produto da evolução do programa de cooperação técnica em informação científica em saúde na América Latina e no Caribe. Analisa-se sua conformação tecnológica como produto da reestruturação da comunicação científica promovida pela internet, destacando o aprimoramento conceitual e operacional do modelo de gestão coletiva de informação e conhecimento no espaço virtual e os desafios de promover o acesso e uso democráticos da informação e do conhecimento atualizado nos processos que envolvem a saúde coletiva e individual.

  15. Financiamento do Sistema Único de Saúde nos governos FHC, Lula e Dilma

    Directory of Open Access Journals (Sweden)

    Adilson Soares

    Full Text Available O artigo discute questões relativas ao financiamento e à alocação de recursos no SUS, no contexto de dois projetos políticos distintos. O estudo analisa os gastos com saúde no Brasil, no período de 1995 a 2012, comparados aos gastos internacionais, ao PIB e a Receita Corrente Bruta. Na análise, buscou-se comparar os compromissos assumidos com o SUS nas gestões dos presidentes FHC, Lula e Dilma. Observou-se que, com relação ao comportamento dos gastos com saúde, no âmbito federal, os governos do Partido dos Trabalhadores não diferiram dos governos do Partido da Social Democracia Brasileira. O perfil dos gastos com saúde não deu conta de atender ao sonho da reforma sanitária dos anos 1980.

  16. Bacharel em Saúde Coletiva: um Elo que faltava na Rede

    Directory of Open Access Journals (Sweden)

    Antônio José Costa CARDOSO

    2013-11-01

    Full Text Available O desafio deste último texto é, sem outras referências, fazer “emergir” um (incerto Discurso do Sujeito Coletivo – aqui referido ao conjunto de autores que assina esse número especial da Tempus Actas em Saúde Coletiva, a partir de um diálogo que se pretende articulador das ideias dos diversos autores que trataram da criação dos bacharelados, mercado de trabalho e carreira, identidade e regulamentação da profissão, campos de prática e estágio em Saúde Coletiva, tomando o texto-base Graduação em Saúde Coletiva: conquistas e passos para além do sanitarismo, de Jairnilson Silva Paim e Isabela Cardoso Pinto, como ponto de partida.

  17. Saúde mental e vulnerabilidade social: a direção do tratamento

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Pegolo da Gama

    2014-03-01

    Full Text Available O objetivo do texto é refletir sobre as relações entre saúde mental e vulnerabilidade social a partir do encontro da Psiquiatria Biológica com a Reforma Psiquiátrica. Problematizamos o conceito de saúde mental, o conceito de vulnerabilidade social, os manuais diagnósticos, as pesquisas epidemiológicas, tendo como pano de fundo as Políticas Públicas de Saúde. Identificamos a necessidade de superação da lógica técnico-científico tradicional incorporando a singularidade e saberes ligados aos sujeitos que são afetados pelo sofrimento.

  18. Saber e fazer: a tecitura da rede em saúde

    Directory of Open Access Journals (Sweden)

    Bellini, Maria Isabel Barros

    2004-01-01

    Full Text Available A emergência das Novas Tecnologias da Informação e Comunicação (NTIC impõe respostas dos profissionais da saúde que contemplem as transformações substanciais vividas pela sociedade. Esse contexto é abordado, aqui, como um dos cenários das necessidades humanas. A pesquisa “Rede de Recursos Humanos da SES em Nível de Especialização, Mestrado e Doutorado”, coordenada pelo Serviço Social na ESP, tem como objetivo anunciar alguns aspectos dessa realidade em redes virtuais. Para tanto, resgata alguns aspectos da história da saúde no Brasil, encadeando a evolução das tecnologias do conhecimento. Ao final, salienta as perspectivas vislumbradas até o momento, com esta estratégia de ação e reflexão sobre a saúde

  19. Implicit Volatility versus Statistical Volatility: an Exercise Using Options and Telemar S.A. Stock

    Directory of Open Access Journals (Sweden)

    Marcelo Savino Portugal

    2004-06-01

    Full Text Available The main goal this article was to find the best way of making forecast about future volatility using implicit or statistic forecast. The work is based on Telemar S.A. shares data from 21/09/1998 to 21/10/2002 and Telemar S.A. shares data from 2/10/2000 to 21/10/2002. The implicit volatility was obtained using back-out procedure from the Black-Scholes model. The statistics forecasts were obtained using weighted moving average models, GARCH, EGARCH and FIGARCH models. The Wald statistic shows that EGARCH and FIGARCH models are efficient and are not biased forecasts for Telemar S.A. absolute variation between t and t + 1. The volatility evaluation during the maturity time of an option, rejects the hypothesis that implicit volatility is the best forecast to future volatility and the Wald statistic show that FIGARCH model is an efficient and not biased forecast.

  20. Atlas mundial da saúde Atlas mondial de la santé

    Directory of Open Access Journals (Sweden)

    Ligia Vizeu Barrozo

    2009-06-01

    Full Text Available O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans.O Atlas mondial de la santé faz parte da série Collection Atlas/Mon...

  1. Hydrogen Storage Activities at HySA from (Nano)materials to Systems

    CSIR Research Space (South Africa)

    Langmi, Henrietta W

    2012-11-01

    Full Text Available One of HySA’s missions is to deliver technologies for hydrogen storage infrastructure that meet the set cost targets and provide the best balance of safety, reliability, robustness, quality and functionality. HySA aims to develop storage...

  2. Data of evolutionary structure change: 3GD5D-3D7SA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3GD5D-3D7SA 3GD5 3D7S D A --TRFRPDLLSLDDLDEAQLHALLTLAHQLKRGERVANL...HGKVLGLVFLKASTRTRVSFTVAMYQLGGQVIDL------------EPVRDTARVLGRYVDGLAIRTFAQTELEEYAHYAG-IPVINALTD-HEHPCQVVADLLTIRENFGRLAGLKLAYVGD...ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGD...GSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEK----GIAWSLH.../index> 3GD5 D 3GD5D

  3. Data of evolutionary structure change: 1A7SA-2GDDC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2GDDC 1A7S 2GDD A C IVGGRKARPRQFPFLASIQNQ---GRHFCGGALIHARFV...FPRFVNVTVTPEDQC-----------------RPNNVCTGVLTRRGGICNGDGGTPLVCE----GLAHGVASFSLGPCGR--GPDFFTRVALFRDWIDGVLNNPGPGP...Y----QDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD...n14> 2GDD C 2GDDC ARG CA 404 PHE CA 422 VAL CA 380

  4. Data of evolutionary structure change: 1A7SA-2IOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2IOTA 1A7S 2IOT A A IVGGRKARPRQFPFLASIQNQ----GRHFCGGALIHARF...ain> 2IOT A 2IOTA CV...in> 1.7549999952316284 13.41100025177002 27.16900062561035 ...73 0.5460000038146973 0.7860000133514404 tion> 3.8209950923919678 2IOT A 2IOTA

  5. Advanced hydrogen technologies for FC applications and PGM beneficiation in SA: Presentation

    CSIR Research Space (South Africa)

    Langmi, Henrietta W

    2013-03-01

    Full Text Available in South Africa Thomas P. Fluri – nominal capacity for CSP in South Africa is 547.6 GW, Energy Policy, v 37, Issue 12, December 2009, 5075–5080 Slide 5 Mineral Resources in South Africa Rank in the World SA Mineral Resource 1 Gold 1 Platinum 1...

  6. Data of evolutionary structure change: 1A7SA-1HFDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-1HFDA 1A7S 1HFD A A IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTA...pdbChain>A 1HFDA HCLEDAADGKVQVL 1HFD A 1HFDA RAVPHPDS...A 1HFDA VCGNRKKPGIYT EEEE...1HFD A 1HFDA LSQPE-PSKRL

  7. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    2010-03-01

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  8. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  9. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    2011-09-01

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  10. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  11. Natural Science and Technology Terminology in the Sesotho sa Leboa Monolingual Dictionary

    Directory of Open Access Journals (Sweden)

    W.M. Mojapelo

    2011-10-01

    Full Text Available

    Abstract: The main purpose of this article is to make a comparative analysis of the structural and the lexical differences between coinage and transliteration, as methods for the acquisition of foreign natural sci-ence and technology lexical items, which are meant for inclusion in the Sesotho sa Leboa comprehensive monolingual dictionary, Pukuntšutlhaloši ya Sesotho sa Leboa. With the exception of the multilingual glossaries ('dictionaries' as they are called, which are compiled by the National Language Service of the Department of Arts and Culture, the Sesotho sa Leboa National Lexicography Unit does not at present have any monolin-gual dictionary specializing in specific subjects like natural science and technology. As a start, the Lexicogra-phy Unit decided to include this specialized terminology in the second edition of its comprehensive monolin-gual dictionary. The main purpose for lemmatizing the natural science and technology terminology is to give these lexical items comprehensive definitions in Sesotho sa Leboa, instead of 'a one word translation defini-tion' as is the case in the bilingual and multilingual dictionaries.

    Keywords: TRANSLITERATION, COINAGE, COINED LEXICAL ITEM, LOAN WORD, ADOPTIVE, FOREIGN WORD, LEXICOGRAPHY, SOTHOIZED WORD, INDIGENOUS WORD, NATURAL SCIENCE, TECHNOLOGY, COMPOUND WORD, AMBIGUITY

    Opsomming: Natuurwetenskaplike en tegnologiese terminologie in die Sesotho sa Leboa eentalige woordeboek. Die hoofdoel van hierdie artikel is om 'n ver-gelykende ontleding te maak van die strukturele en die leksikale verskille tussen nuutskepping en transliterasie as metodes vir die verwerwing van vreemde natuurwetenskaplike en tegnologiese leksikale items wat bedoel is vir insluiting in die Sesotho sa Leboa omvattende eentalige woorde-boek Pukuntšutlhaloši ya Sesotho sa Leboa. Met die uitsondering van die meertalige woordelyste ("woordeboeke" soos hulle genoem word wat deur die Nasionale Taaldiens van die

  12. Quatro tensões na saúde pública

    Directory of Open Access Journals (Sweden)

    Nicolas Lechopier

    2015-04-01

    Full Text Available Este artigo examina a interação da ética, da antropologia social e da epistemologia na saúde pública. Na primeira seção do artigo, introduzimos ao amplo espectro de abordagens existentes que consideram a saúde pública como um campo político, como uma ciência e como um projeto antropológico global que levanta inúmeras questões éticas. Na segunda seção, propomos uma apresentação mais detalhada das principais questões levantadas pela saúde pública através de uma rede de quatro tensões dialéticas fundamentais. A primeira tensão concerne principalmente às dubiedades das definições de saúde e às finalidades propostas para esse campo. A segunda tensão concerne à legitimidade dos meios utilizados para chegar aos objetivos da saúde pública. A terceira tensão diz respeito ao regime de evidência e ao referencial das abordagens empregadas na saúde pública. A quarta tensão se origina nas relações de poder construídas no interior dessas práticas da saúde pública. Sugerimos que essas quatro tensões, nas quais a polarização apresenta uma variedade de formatos, relacionam-se entre si. Isso conduz à conclusão de que na saúde pública, as considerações éticas, antropológicas e epistemológicas precisam andar juntas. Para entender criticamente as questões da saúde pública, precisamos, portanto, levar em conta as íntimas interações entre as ciências, os valores e as práticas.

  13. Caso Ouro Fino Saúde Animal Caso Ouro Fino Saúde Animal Ouro Fino Saúde Animal case

    Directory of Open Access Journals (Sweden)

    Bernardo Hauch Ribeiro de Castro

    2012-04-01

    Full Text Available O Caso Ouro Fino Saúde Animal ilustra uma tomada de decisão, pelos executivos da empresa, sobre a entrada em um novo mercado, de vacinas para bovinos. Diante da necessidade de dar um passo maior em direção ao crescimento sustentável, a empresa não poderia deixar de entrar nesse segmento, que representava mais de metade do mercado brasileiro de produtos veterinários. No entanto, era um passo arriscado. A principal questão do caso é avaliar as alternativas de comprar vacinas de terceiros ou produzir internamente suas próprias vacinas. A empresa do caso é a Ouro Fino Saúde Animal, empresa brasileira de produtos veterinários, instalada no Estado de São Paulo, com faturamento de mais de R$ 100 milhões anuais. Os dois principais personagens deste caso são os diretores financeiro e industrial da empresa. A situação passa-se em 2005. Como instrumento de ensino, o caso foi concebido para o ensino de estratégia em cursos de pós-graduação em administração, levando os alunos a avaliar vantagens e desvantagens de cada uma das alternativas. Como objetivo secundário, o caso propicia alguns elementos para uma estimativa da viabilidade financeira da opção de implantar uma nova unidade produtiva e a possibilidade de refletir sobre uma decisão já tomada, de entrada no novo mercado. Por fim, o caso traz uma série de informações sobre o mercado brasileiro e sobre o mercado mundial de produtos veterinários. É possível, com base nestes dados, trabalhar questões ligadas à segmentação e posicionamento da empresa no setor, ficando a critério do professor este tipo de uso.El Caso Ouro Fino Saúde Animal ilustra una toma de decisiones por los ejecutivos de la empresa, a la entrada en un nuevo mercado de las vacunas para el ganado. Ante la necesidad de dar un paso importante hacia el crecimiento sostenible, Ouro Fino Saúde Animal no podía dejar de entrar, ya que representaba más de la mitad del mercado de productos veterinarios

  14. Promoção de saúde nas escolas na perspectiva de professores do ensino fundamental

    Directory of Open Access Journals (Sweden)

    Gabriela Maria Cavalcanti Costa

    2013-06-01

    Full Text Available Para caracterizar atividades de Promoção da Saúde desenvolvidas pelos professores do ensino fundamental de três escolas públicas na Paraíba, realizou-se estudo descritivo, de natureza qualitativa, desenvolvido em 2010. Foram entrevistados 32 professores. Os dados foram submetidos à análise de conteúdo e agrupados em categorias temáticas. Emergiram as seguintes categorias: conhecimentos teóricos acerca da promoção da saúde e a prática da promoção da saúde nas escolas, esta segunda ainda encampou as subcategorias: o planejamento das ações de promoção da saúde nas escolas, ações escolares de promoção da saúde, avaliação escolar das ações de promoção da saúde e expectativas dos professores para a execução de ações de promoção da saúde. Dessa forma, a promoção da saúde precisa ser abordada de forma transversal, integrada e intersetorial, com diálogo entre educação e saúde, compondo redes de compromisso e co-responsabilidade para a mobilização de ações. O enfermeiro precisa participar da rede social de apoio.

  15. Acessibilidade e resolubilidade da assistência em saúde mental: a experiência do apoio matricial

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Dias Quinderé

    2013-07-01

    Full Text Available Os Centros de Atenção Psicossocial (CAPS têm também como finalidade articular ações de saúde mental no território, principalmente na Atenção Primária à Saúde (APS. O apoio matricial é uma das formas para esta articulação, pois objetiva assegurar retaguarda especializada às equipes de saúde. Diante disto, a pesquisa pretende compreender como as ações de matriciamento em saúde mental contribuem para a acessibilidade e a resolubilidade dos casos. Trata-se de uma pesquisa qualitativa realizada nas cidades de Fortaleza e Sobral, no Estado do Ceará, cujos sujeitos entrevistados foram 37 (trinta e sete trabalhadores de saúde mental e da atenção primária, 14 (quatorze usuários e 13 (treze familiares que participaram das ações do apoio matricial. Conforme os resultados demonstraram os trabalhadores da APS não se sentem instrumentalizados para intervir nos casos de saúde mental. Existe uma precipitação nos encaminhamentos dos usuários para os CAPS, dificultando a acessibilidade da assistência em saúde mental. Porém, identificou-se que as discussões em saúde mental na atenção primária possibilitam a apropriação dos casos pelos trabalhadores da APS e promovem a aproximação entre as equipes. Deste modo influenciam na resolubilidade dos casos de saúde mental.

  16. A participação do enfermeiro de saúde pública na saúde familiar

    Directory of Open Access Journals (Sweden)

    Zélia Sena Costa

    1986-09-01

    Full Text Available As autoras partem do pressuposto de que o avanço da epidemiologia tem demonstrado que muitas enfermidades estão associadas a determinadas estruturas sociais. Face a um enfoque científico, humanístico e personalizado, o Enfermeiro tem conquistado um papel de destaque junto à família, uma vez que este grupo social se constitui em uma via estratégica para utilização de parâmetros psicossocias tendo em vista a função básica de ajuda e apoio. Considerando que a contribuição do Enfermeiro de Saúde Pública é de vital importância para a melhoria do nível de saúde familiar, concluem que existe uma necessidade premente da aplicação adequada do Processo de Enfermagem a nível familiar, propondo a inserção da concepção - unidade familiar - como princípio básico da Assistência de Enfermagem.

  17. Desafios da integralidade: revisitando as concepções sobre o papel do fisioterapeuta na equipe de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Laura Maria Tomazi Neves

    2011-06-01

    Full Text Available A estratégia prioritária nacional na Saúde Coletiva é a Saúde da Família (PSF, no entanto, é incipiente a participação de outros profissionais de saúde na atenção primária, além da Medicina e Enfermagem. O objetivo deste estudo foi realizar uma revisão sistemática da visão acadêmica do papel do fisioterapeuta na equipe de saúde da família (ESF. Foi realizada pesquisa bibliográfica no portal da Biblioteca Virtual em Saúde (BVS/Bireme/OPAS/OMS, de janeiro de 1994 a julho de 2009. A estratégia adotada foi o cruzamento dos seguintes descritores: Programa Saúde da Família, Saúde da Família, Saúde Coletiva, Saúde Pública, Fisioterapia (especialidades, Fisioterapia (técnicas, modalidades de fisioterapia. Dos 51 trabalhos localizados, 14 não estavam disponíveis. O restante foi analisado e sete foram selecionados por contemplarem os critérios de inclusão. Conclui-se que, apesar dos esforços, a fisioterapia ainda não possui uma definição clara em relação a sua atuação no PSF.

  18. Desafios da integralidade: revisitando as concepções sobre o papel do fisioterapeuta na equipe de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Laura Maria Tomazi Neves

    Full Text Available A estratégia prioritária nacional na Saúde Coletiva é a Saúde da Família (PSF, no entanto, é incipiente a participação de outros profissionais de saúde na atenção primária, além da Medicina e Enfermagem. O objetivo deste estudo foi realizar uma revisão sistemática da visão acadêmica do papel do fisioterapeuta na equipe de saúde da família (ESF. Foi realizada pesquisa bibliográfica no portal da Biblioteca Virtual em Saúde (BVS/Bireme/OPAS/OMS, de janeiro de 1994 a julho de 2009. A estratégia adotada foi o cruzamento dos seguintes descritores: Programa Saúde da Família, Saúde da Família, Saúde Coletiva, Saúde Pública, Fisioterapia (especialidades, Fisioterapia (técnicas, modalidades de fisioterapia. Dos 51 trabalhos localizados, 14 não estavam disponíveis. O restante foi analisado e sete foram selecionados por contemplarem os critérios de inclusão. Conclui-se que, apesar dos esforços, a fisioterapia ainda não possui uma definição clara em relação a sua atuação no PSF.

  19. Integrated assessment of environment and health: America's children and the environment Avaliação integrada de saúde e ambiente: crianças americanas e o ambiente

    Directory of Open Access Journals (Sweden)

    Amy D. Kyle

    2006-06-01

    Full Text Available There is a need for systematic approaches to assessment of environmental factors most relevant to health, health outcomes most influenced by the environment, and relationships between them, as well as for approaches to representing results of such assessments in policy deliberations. As a step in the development of such methods, we used findings and data from environmental protection and public health sectors to develop a set of measures representing topics relevant to children's environmental health. We used a definition of the environment that emphasized contaminants and a process that involved both analytic and deliberative elements. The steps in this process were to: a develop a conceptual framework to depict relationships between environment and health with relevant types of data and information, b select topic areas of significance for children, c identify best available data sources and devise measures, d assess possible surrogate data sources and measures when needed, e design and implement metrics for computation of measures; f select graphical representations of measures, g identify related measures, and h identify data gaps. Representatives of policy and stakeholder audiences participated in this process.No momento atual do conhecimento sobre o tema, existe a necessidade de avaliações sistemáticas a respeito dos fatores que mais contribuem para a saúde, das contribuições mais relevantes do setor saúde para o ambiente e das relações entre ambos os campos, assim como de abordagens sobre resultados das deliberações políticas sobre resultados dos estudos. Neste artigo, apresentamos achados e dados a respeito da proteção ambiental e de saúde visando desenvolver propostas a favor da saúde ambiental das crianças. Usamos uma definição de ambiente que enfatiza contaminantes e processos e envolvem elementos analíticos e deliberativos. As etapas do estudo foram: a desenvolver um marco conceitual que retratasse rela

  20. Manufacturing of JT-60SA Cryostat Base

    Energy Technology Data Exchange (ETDEWEB)

    Medrano, Mercedes, E-mail: mercedes.medrano@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Botija, José; Fernández, Pilar; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira [JAEA, Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► JT-60SA Cryostat Base has been fabricated in seven structures fastened by bolts. ► The pieces are fully welded structures further machined to get required tolerances. ► The pre-assembly of the Cryostat Base will be done at the factory to check final tolerances as well as to anticipate problems which could be encountered during final assembly. -- Abstract: JT-60SA is a superconducting tokamak to be assembled and operated at the JAEA laboratories in Naka (Japan) [1]. The tokamak has been designed to prepare, support and complement the ITER experimental programme and will be manufactured and operated under the funding of the Broader Approach Agreement (between the government of Japan and the European Commission) and of the Japan Fusion National Programme. Within the European contribution to JT-60SA, Spain has to provide the cryostat. Due to functional purposes, the cryostat has been divided in two large assemblies: the Cryostat Base (CB) and the Cryostat Vessel Body the latter subdivided into Cryostat Vessel Body Cylindrical Section (CVBCS) and the Top Lid. Spain is committed to provide the design and subsequent manufacturing of the CB and CVBCS (excluding the Top Lid) through the National Laboratory of Fusion at Ciemat. The design of both components has been concluded and the CB is currently being manufactured by a Spanish company, IDESA. This paper aims to present the status of the manufacturing and pre-assembly at the factory of the CB that has to be delivered in November 2012.

  1. AGREEMENT BETWEEN CERN AND UBS SA

    CERN Multimedia

    2002-01-01

    We wish to inform you that the agreement between CERN and UBS SA has been renewed for a period of five years with effect from 1st July 2002. This represents the culmination of work carried out since 1999 by a group consisting of representatives of the Finance Division, the SPL Division, the Staff Association and the Users Office. After analysis of the results of a market survey, it emerged that OVERALL the UBS offered the best conditions and guarantees for the CERN personnel. Owing to developments in the banking market, new conditions have had to be negotiated, which will be presented to you by the UBS (see article).

  2. Saúde da família: mudando práticas? Estudo de caso no município de Natal (RN Family health: changing practices? A case study in the city of Natal (RN, Brazil

    Directory of Open Access Journals (Sweden)

    Marize Barros de Souza Araújo

    2009-10-01

    Full Text Available Este trabalho, representa um estudo de caso qualitativo, cuja unidade de análise é a equipe de Saúde do Programa Saúde da Família do município de Natal (RN. Tem como objetivos analisar as concepções dos profissionais sobre a prática do trabalho em equipe e reconhecer nessas práticas elementos que contribuam para a efetiva mudança do modelo de saúde hegemônico. Partiu-se da definição e tipologia de equipe de saúde elaborada por Peduzzi (1998, como principal fundamentação teórica. O estudo foi realizado em seis unidades de saúde da família, nos distritos sanitários Norte e Oeste. Esses serviços foram selecionados de acordo com critérios preestabelecidos. Foi utilizada como método para coleta dos dados empíricos a entrevista semi-estruturada com as equipes de saúde da família. Para análise do material empírico, utilizou-se o discurso do sujeito coletivo proposto por Lefèvre e Lefèvre (2003. Os resultados apontam para um predomínio da equipe do tipo integração. O trabalho em equipe surge como elemento essencial para o desenvolvimento da Estratégia de Saúde da Família.This article presents a qualitative case study where the unit of analysis was the Family Health Program team of Natal city, Rio Grande do Norte State, Brazil. The objectives were to analyze the conceptualizations of the professionals regarding teamwork as well as to identify in these practices the elements that contribute to an effective change in the hegemonic health model. The study was based on the Peduzzi (1998 typology and definition of health team and was conducted in six family health units in the North and East health districts selected by a pre-established criteria. Data were collected using a semi-structured interview applied in family health teams, which were analyzed using the Collective Subject Discourse proposed by Lefèvre and Lefèvre (2003. The results indicate a predominance of an integrated team type, and also that teamwork is an

  3. Segmentação de mercados da assistência à saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Farias Luís Otávio

    2003-01-01

    Full Text Available O artigo analisa a dimensão e segmentação do mercado supletivo de assistência à saúde no Brasil e o perfil dos seus segurados. Na primeira parte, destaca alguns elementos conceituais necessários à compreensão das características do mercado em saúde. Analisa brevemente a dimensão e o papel do setor privado de saúde em países membros da Organização para Cooperação e Desenvolvimento Econômico (OCDE e compara com caso brasileiro. Em seguida, realiza um breve histórico do setor supletivo de saúde no Brasil e, por fim, apresenta uma análise do perfil dos segurados, tendo por base os microdados da Pesquisa Nacional de Amostra por Domicílio de 1998 (Pnad/ IBGE.

  4. Formação em Educação Física no Brasil: outros modos de pensar e intervir no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Yara Maria de Carvalho

    2013-06-01

    Full Text Available O que apresentamos traduz um debate no campo da saúde pública/saúde coletiva no Brasil relativo à formação em saúde, especialmente no nível da atenção primária em saúde, mas também resulta de uma intervenção no serviço público de saúde que envolveu estudantes e docente vinculados ao curso de graduação em Educação Física e Esporte da Universidade de São Paulo (USP, que se viram diante do desafio de responder às necessidades de saúde da população experimentando a atuação interprofissional. O Programa de Educação pelo Trabalho para a Saúde (PET-Saúde, uma das iniciativas do governo federal que busca aproximar universidade (estudantes e docentes, serviços de saúde (profissionais da saúde e usuários a fim de problematizar o ensino em saúde, assim como qualificar a atenção e o cuidado em saúde, induziu essa formação diferenciada. Da participação dos estudantes no PET-Saúde, entre 2010 e 2012, ressaltamos o processo de ressignificação do campo e do próprio conceito saúde e a possibilidade de intervir nas necessidades de saúde da população a partir do trabalho em equipe

  5. An investigation on SA 213-Tube to SA 387-Tube plate using friction welding process

    Energy Technology Data Exchange (ETDEWEB)

    Rajan, S. Pandia; Kumaraswamidhas, L. A. [Indian Institute of Technology, Jharkhand (India); Kumaran, S. Senthil [RVS School of Engineering and Technology, Tamil Nadu (India); Muthukumaran, S. [National Institute of Technology, Tamil Nadu (India)

    2016-01-15

    Friction welding of tube to tube plate using an external tool (FWTPET) is a relatively newer solid state welding process used for joining tube to tube plate of either similar or dissimilar materials with enhanced mechanical and metallurgical properties. In the present study, FWTPET has been used to weld SA 213 (Grade T12) tube with SA 387 (Grade 22) tube plate. The welded samples are found to have satisfactory joint strength and the Energy dispersive X-ray analysis (EDX), X-ray diffraction (XRD) study showed that inter metallic compound is absent in the weld zone. The different weld joints have been identified and the phase composition is found using EDX and XRD. Microstructures have been analyzed using optical and Scanning electron microscopy (SEM). The mechanical properties such as hardness, compressive shear strength and peel test for different weld conditions are studied and the hardness survey revealed that there is increase in hardness at the weld interface due to grain refinement. The corrosion behavior for different weld conditions have been analyzed and the weld zone is found to have better corrosion resistance due to the influence of the grain refinement after FWTPET welding process. Hence, the present investigation is carried out to study the behavior of friction welded dissimilar joints of SA 213 tube and SA 387 tube plate joints and the results are presented. The present study confirms that a high quality tube to tube plate joint can be achieved using FWTPET process at 1120 rpm.

  6. A Crise do Sistema Único de Saúde e a Fuga para o Mercado

    Directory of Open Access Journals (Sweden)

    Rosângela Minardi Mitre Cotta

    1998-06-01

    Full Text Available Este trabalho discute as conseqüências paradoxais das ações em saúde, pensadas a partir do ideal universalizante igualitário, consubstanciado na Constituição de 1988; bem como os dilemas que hoje se interpõem ao setor público em saúde.Uma análise da conjuntura atual do relacionamento entre o setor público e o privado em saúde foi desenvolvida tendo como subsídio a investigação empírica, com atenção especial ao conhecimento local.A técnica amostrai utilizada foi a "amostragem por experts".Através deste método, identificam-se os atores mais relevantes para o processo de construção e implantação do Sistema Único de Saúde. Impõe-se, assim, a combinação de conhecimentos estratégicos específicos, derivados de vários atores políticos inseridos direta ou indiretamente no processo de implementação da política de saúde em curso.Quarenta e nove entrevistas participantes foram realizadas com atores relevantes para o setor saúde, escolhidos em instituições públicas e privadas da saúde. Finalmente, procedeu-se à análise documental e estatística.Os resultados mostraram que as formas perversas de interação do sistema público de saúde com o mercado, conseqüência da maneira desorganizada de o governo implementar a Reforma Sanitária, apontam para um retrocesso na forma de custeio da saúde no país. Tem-se, de um lado, a obrigatoriedade de contribuição previdenciária e, de outro, o pagamento de seguros privados de saúde, sem, ao final, ter-se a garantia de um atendimento satisfatório.Institui-se, portanto, na saúde, um jogo do "salve-se quem puder", jogo em que a fuga para o mercado não representa uma saída total do sistema público, nem garantia de atendimento.

  7. ANALISIS DAN MODEL STRATEGI PENINGKATAN DAYA SAING PRODUK EDAMAME BEKU

    Directory of Open Access Journals (Sweden)

    Sandryas Alief Kurniasanti

    2015-03-01

    Full Text Available Jember regency is a agricultural and plantation central area. The soybean plant is principal commodity that competes fiercely with production of corn. PT Mitratani Dua Tujuh (PT MT 27 try to find new technology by processing edamame to frozen edamame that focus in the export market. The primary market of frozen edamame besides domestic market is Japan. The aim of this research is to analyze competitiveness and formulated the priority of competitiveness alternative strategy on frozen edamame product in PT MT 27. The research method used is the analysis of competitiveness by using revealed comparative advantage to know the export performance of the product on the world market then analyze a factor of competition by using Diamond Porter's Theory. Alternative strategies are resulted from the SWOT analysis and priorities are determined by using analytical hierarchy process from the expert source. The research results about alternative strategy priority to increase the competitiveness of frozen edamame products in PT MT 27 are: (1 market diversification, (2 product diversification, (3 improve cooperation overseas, (4 develop a research and development division, (5 develop corporate social responsibility, (6 proper financial management, and (7 to develop an agricultural area greenhouse-based to avoid bad weather as tropical country. Managerial implications of this research are expanding existing markets, and develop type of product produced to satisfy the export market and also savings cost production. Keywords: competitiveness, frozen edamame, Mitratani Dua Tujuh, competitiveness strategiesABSTRAKKabupaten Jember merupakan sentra  daerah pertanian dan perkebunan. Tanaman kedelai merupakan komoditas utama yang bersaing ketat dengan produksi jagung. PT Mitratani Dua Tujuh (PT MT 27 mencoba untuk mencari terobosan baru yaitu dengan mengolah edamame menjadi edamame beku siap makan. Pasar utama edamame beku ini selain pasar domestik adalah Jepang. Tujuan

  8. A agência nacional de saúde suplementar - ANS: onze anos de regulação dos planos de saúde

    Directory of Open Access Journals (Sweden)

    Rachel Torres Salvatori

    2012-09-01

    Full Text Available Trata-se de um trabalho com objetivo de apresentar os principais resultados alcançados pela regulação dos planos de saúde exercida pela Agência Nacional de Saúde Suplementar, autarquia instituída para promover o equilíbrio das relações entre operadoras e consumidores, tornando o mercado de planos de saúde mais efi ciente. Como avanços mais significativos oriundos da regulação do setor podem ser citados: as barreiras à entrada e à saída das operadoras no mercado, a ampliação das coberturas assistenciais contratuais, o monitoramento e o controle dos reajustes, a indução a práticas de promoção da saúde e à qualifi cação do setor, e a possibilidade da portabilidade de carências. Como desafios a serem enfrentados, podem ser apontados: o monitoramento da qualidade da assistência prestada, a renúncia fiscal, a existência dos cartões de desconto, a operação de empresas como operadoras de planos de saúde sem o registro na ANS e a adoção de alguns mecanismos nocivos de regulação assistencial pelas operadoras de planos de saúde. ----- The National Agency of Supplementary Health – ANS: eleven years in regulating health insurance plans ----- ABSTRACT ----- This study aims to present the main results achieved in the regulation of health insurance plans through the National Agency of Supplementary Health, an agency set up to promote a balance in the relationship between health insurance plans and their consumers, making the health insurance market more efficient. As examples of the important progress achieved in regulating the sector, the authors emphasize: greater control of the infl ow and outfl ow of service operators in the market; the widening of contractual coverage; monitoring and control of readjustments; encouragement of health promotion practices and increased training in the sector; grace period flexibility. Examples of regulatory gaps however, include: problems monitoring the quality of the care provided

  9. Suporte social, promoção de saúde e saúde bucal na população idosa no Brasil

    Directory of Open Access Journals (Sweden)

    Silvânia Suely Caribé de Araújo

    2006-06-01

    Full Text Available O crescente envelhecimento da população mundial, inclusive no Brasil, ressalta a importância de medidas para se lidar com esta situação. No Brasil, a maioria dos idosos é do sexo feminino; vive em domicílios multigeracionais; é referência econômica nos mesmos; possui baixo nível socioeconômico; portadora de, pelo menos, uma doença crônica; independente para realização das atividades da vida diária; não possui dentes, e busca atenção em saúde no SUS. Os idosos brasileiros expostos a situações de vulnerabilidade social estão sujeitos à interferência direta dos determinantes sociais no processo saúde-doença. O Suporte Social inclui políticas e redes de apoio social, que atuam como agente de integração do idoso na sociedade, minimizando os riscos de exclusão social e, conseqüentemente, de danos à sua saúde por meio de medidas de Promoção de Saúde. Este artigo aborda o Suporte Social e alguns de seus aspectos, tais como: tipo e local de residência, transporte e suporte financeiro; em idosos brasileiros e sua relação com a Promoção de Saúde.

  10. Saúde Mental na Atenção Básica: Sentidos Atribuídos pelos Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Raul Franklin Sarabando de Moura

    Full Text Available Em consideração a normas recentes do Ministério da Saúde, que regulamentam as relações entre a Saúde Mental e a Atenção Básica, esta pesquisa tem por objetivo estudar os sentidos atribuídos pelo ACS à Saúde Mental e suas implicações na prática cotidiana, além de suas percepções sobre as ações do Programa de Residência Multiprofissional em Atenção à Saúde (PRMAS. Trata-se de um estudo qualitativo, segundo o referencial da Hermenêutica de Profundidade,feito através de observação participante e entrevistas semidirigidas. Os resultados alcançados apontam a centralização dos cuidados em Saúde Mental nos CAPS, especialmente através de medicações. Em relação ao PRMAS, percebe-se o papel de matriciamento exercido pela residência, por meio da escuta e acompanhamento do ACS, que encontra situações de sofrimento psíquico em seu cotidiano mas se sente despreparado para lidar com elas. A residência fortalece a integralidade do cuidado, conforme qualifica a atuação do ACS e o orienta em casos difíceis, bem como pode ser um articulador do trabalho, através das iniciativas de aproximação entre os serviços que tem promovido.

  11. Concepção de enfermeiros de uma rede pública de saúde sobre Educação para a Saúde

    Directory of Open Access Journals (Sweden)

    Gisele Coscrato

    2013-06-01

    Full Text Available Estudo qualitativo que objetivou conhecer as concepções de 12 enfermeiros assistenciais, que compõem a rede pública de saúde de um município do interior paulista, sobre Educação para a Saúde, e propor ação educativa. Utilizou-se da metodologia da pesquisa-ação. A coleta dos dados ocorreu no segundo semestre de 2009, nas unidades públicas de saúde desse município. Foram usadas as técnicas de observação participante e entrevistas individuais. A análise e interpretação dos dados foi feita por categorização, fundamentada na teoria de Paulo Freire. Como resultados, revelou-se o reducionismo da Educação para a Saúde na abordagem pedagógica que envolvia a transmissão de conhecimentos, contemplando uma tendência biologicista da formação acadêmica. Porém, nos círculos de discussão, presumiu-se o despertar de uma consciência política relacionada à temática e à promoção da saúde. Concluindo, apreendeu-se a necessidade de mudanças na formação, e de viabilizar novos modos de produção de ciência, na busca pela transformação social.

  12. Saúde mental: reconstruindo saberes em enfermagem

    Directory of Open Access Journals (Sweden)

    Francisca Bezerra de Oliveira

    2003-02-01

    Full Text Available O manicômio, apesar de criticado, reformado ou mesmo negado, ainda é uma prática preponderante no cuidado às pessoas com transtornos mentais. Tal prática tem como princípio básico o isolamento do doente mental, contrariando todas as possibilidades de assistência centrada num humanismo ético. Este ensaio procura interpretar a institucionalização do asilo, da psiquiatria, da doença mental e o processo da reforma psiquiátrica, buscando contribuir para as reflexões acerca da desinstitucionalização e dos saberes e práticas de enfermagem em saúde mental.

  13. Teaching Computer System-DMT DESIGN(SA.1

    Directory of Open Access Journals (Sweden)

    A. O. Shteynberg

    2012-01-01

    Full Text Available Тhe paper introduces the training computer system of sub- agential type based on a didactic multidimensional technology. The methodology bases incorporate the systematic activity approach, some elements of artificial intelligence theory, and the instrumental didactic theory and technology developed by Scientific Experimental Laboratory at Bashkirsky State Pedagogical University. The above training system – Didactic Multidimensional Technology Design of Sub-Agential Type (DMT_DESIGN (SA.1 – has been developed for raising teachers’ technological competence and creativity regarding both the general and vocational education. Its training structure is specified by invariant socio-cultural and anthropological bases; logically semantic modeling of course materials is provided. The research data can be used by people, engaged in developing educational information technologies; practicing teachers; and post-graduates conducting research and implementing the findings. 

  14. Bien communiquer sur sa thèse, suite.

    Directory of Open Access Journals (Sweden)

    Philippe Heller

    2005-07-01

    Full Text Available Après une brève présentation sur lui-même, Edouard Paulino du Craft (Centre de recherche et d’appui pour la formation et ses technologies, qui travaille à l’ Epfl lance le débat : que signifie communiquer sur sa thèse ? Parmi le petit auditoire de doctorants présents, les questions-réponses fusent : à qui s’adresse-t-on ? Pourquoi ? Comment s’adapter à son auditoire ? Mais en fait qu’est-ce que communiquer ? Doit-on suivre forcément son plan de thèse ou ...

  15. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  16. A inserção da vigilância em saúde ambiental no sistema único de saúde

    Directory of Open Access Journals (Sweden)

    Edenilo Baltazar Barreira Filho

    2012-03-01

    Full Text Available A inserção das atividades de vigilância ambiental no SUS apresenta algumas características que se diferenciam das práticas de vigilância epidemiológica. Isto ocorre principalmente em decorrência de que muitos dados sobre a exposição aos fatores ambientais são obtidos fora do setor saúde e a adoção de ações que busquem controlar e/ou prevenir exigem, na grande maioria dos casos, uma compreensãoe articulação intra e intersetorial, pois o setor saúde não é capaz de, sozinho, dar respostas as questões de saúde ambiental.Nos últimos anos vem consolidando-se cada vez mais o campo da saúdeambiental, que compreende a área da saúde pública, afeita ao conhecimento científico, à formulação de políticas públicas e às correspondentes intervenções (ações relacionadas à interação entre a saúde humana e os fatores do meio ambiente natural e antrópico que a determinam, condicionam e influenciam, com vistas a melhorar a qualidade de vida do ser humano sob o ponto de vista dasustentabilidade(1.Conforme entendimento acordado no I Seminário da Política Nacional de Saúde Ambiental, realizado em outubro de 2005, e consolidado na primeira Conferência Nacional de Saúde Ambiental, realizada em dezembro de 2009, compreende-se como uma área de práticas intersetoriais e transdisciplinares voltadas aos reflexos, na saúde humana, das relações ecogeossociais do homem com o ambiente(1.Nesse sentido, o Ministério da Saúde vem implementando em todo o território nacional um Sistema de Vigilância em Saúde Ambiental (SINVISA, buscando o aprimoramento deste “modelo” de atuação e estabelecendo competências nas três esferas de gestão, com o objetivo de consolidar a prática da Saúde Ambiental dentro do SUS.A Instrução Normativa nº 1, de 7 de março de 2005, cria o SINVISA, estabelece a área de atuação, as competências para as três esferas de Gestão do SUS e define a Vigilância em Saúde Ambiental como sendo

  17. North America and South America (NA-SA) neuropathy project.

    Science.gov (United States)

    Pasnoor, Mamatha; Nascimento, Osvaldo J M; Trivedi, Jaya; Wolfe, Gil I; Nations, Sharon; Herbelin, Laura; de Freitas, M G; Quintanilha, Giseli; Khan, Saud; Dimachkie, Mazen; Barohn, Richard

    2013-08-01

    Peripheral neuropathy is a common neurological disorder. There may be important differences and similarities in the diagnosis of peripheral neuropathy between North America (NA) and South America (SA). Neuromuscular databases were searched for neuropathy diagnosis at two North American sites, University of Kansas Medical Center and University of Texas Southwestern Medical Center, and one South American site, Federal Fluminense University in Brazil. All patients were included into one of the six major categories: immune-mediated, diabetic, hereditary, infectious/inflammatory, systemic/metabolic/toxic (not diabetic) and cryptogenic. A comparison of the number of patients in each category was made between North America and South America databases. Total number of cases in North America was 1090 and in South America was 1034 [immune-mediated: NA 215 (19.7%), SA 191 (18%); diabetic: NA 148 (13.5%), SA 236 (23%); hereditary: NA 292 (26.7%), SA 103 (10%); infectious/inflammatory: NA 53 (4.8%), SA 141 (14%); systemic/metabolic/toxic: NA 71 (6.5%), SA 124 (12%); cryptogenic: NA 311 (28.5%), SA 239 (23%)]. Some specific neuropathy comparisons were hereditary neuropathies [Charcot-Marie-Tooth (CMT) cases] in NA 246/292 (84.2%) and SA 60/103 (58%); familial amyloid neuropathy in SA 31/103 (30%) and none in NA. Among infectious neuropathies, cases of human T-lymphotropic virus type 1 (HTLV-1) neuropathy in SA were 36/141(25%), Chagas disease in SA were 13/141(9%) and none for either in NA; cases of neuropathy due to leprosy in NA were 26/53 (49%) and in SA were 39/141(28%). South American tertiary care centers are more likely to see patients with infectious, diabetic and hereditary disorders such as familial amyloid neuropathies. North American tertiary centers are more likely to see patients with CMT. Immune neuropathies and cryptogenic neuropathies were seen equally in North America and South America.

  18. Velhice, incapacidade e cuidado na saúde pública

    Directory of Open Access Journals (Sweden)

    Karla Cristina Giacomin

    2015-12-01

    Full Text Available Resumo O envelhecimento populacional modifica profundamente o escopo de atuação da saúde coletiva, altera o perfil de morbimortalidade e aumenta a demanda por cuidados crônicos. Na população idosa, a incapacidade serve como indicador de saúde e balizador de ações e políticas. Esta pesquisa de abordagem qualitativa, fundamentada na antropologia interpretativa e na perspectiva êmica, tem por objetivo compreender a forma de pensar e agir dos idosos diante da “velhice com incapacidade” e suas relações com a saúde pública. Foram realizadas entrevistas individuais no domicílio, com roteiro semiestruturado, junto a 57 idosos residentes na cidade, inclusive participantes da coorte de Bambuí. A metodologia de Signos, Significados e Ações orientou a coleta e a análise dos dados, possibilitando a investigação antropológica das representações e comportamentos concretos associados à incapacidade na velhice na cultura local. Emergiram da análise duas categorias acerca das relações entre velhice, incapacidade e cuidado na saúde pública: experiências de cuidado na velhice com incapacidade; o medo da falta de cuidados. Os resultados revelam que a saúde pública precisa rever seus conceitos sobre incapacidade na velhice e incorporar a dimensão funcional da saúde e o cuidado à velhice com incapacidade na agenda.

  19. Trabalho escravo contemporâneo como um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Luís Henrique da Costa Leão

    Full Text Available Resumo O trabalho escravo contemporâneo (TE é uma das mais injustas e persistentes problemáticas sociais do Brasil. Frente à necessidade de implantação da política nacional de saúde do(a trabalhador(a, este artigo discute o trabalho escravo como problema de saúde pública, destacando possibilidades de ampliar as estratégias de vigilância e atenção integral a essa população específica de trabalhadores. Foi realizada uma pesquisa qualitativa, exploratória, sob o referencial teórico da construção social da realidade, conforme Lenoir, Berger e Luckmann. O estudo consistiu em uma revisão teórica sobre TE no cenário nacional e internacional no âmbito das ciências humanas, sociais e de saúde pública e uma análise das práticas de enfrentamento ao TE na região norte do estado do Rio de Janeiro. Foram efetuadas entrevistas semiestruturadas, individuais e coletivas, com trabalhadores e representantes de movimentos sociais e instituições públicas. Os resultados demonstram dimensões teóricas e práticas sobre o TE e suas relações com o campo da saúde e destacam o papel e o potencial da saúde pública no fortalecimento das práticas de vigilância e atenção à saúde dos trabalhadores submetidos a essas condições sociais crônicas.

  20. Justiça social e equidade em saúde: uma abordagem centrada nos funcionamentos

    Directory of Open Access Journals (Sweden)

    Carlos Dimas Ribeiro

    2015-12-01

    Full Text Available Trata-se de um ensaio de natureza teórica que objetiva defender uma concepção de justiça social voltada aos funcionamentos dos indivíduos, articulando a discussão da justiça com o debate sobre equidade em saúde. Na introdução, são discutidas as circunstâncias da justiça, abordando a questão da escassez dos recursos no campo da saúde. No primeiro item, analisa-se a noção da equidade em saúde, apresentando os principais enfoques abordados, em particular o conceito de equidade em saúde proposto por Margaret Whitehead, amplamente utilizado na saúde coletiva. No segundo item, apresenta-se, brevemente, a Abordagem das Capacitações desenvolvida por Amartya Sen e Martha Nussbaum, que recuperam a noção aristotélica de funcionamento. Ao final, critica-se essa abordagem e defende-se a Perspectiva dos Funcionamentos (PF, proposta por Maria Clara Dias, aplicada ao campo da saúde. Dessa forma, os concernidos da justiça são sistemas funcionais e o que se quer igualar para propósitos de justiça é a integridade funcional dos seres vivos. São apresentadas algumas vantagens dessa perspectiva, considerada aquela que melhor preenche os requisitos de uma concepção de justiça extensiva a todos no Brasil.

  1. Consumo de cafeína por grávidas usuárias de uma Unidade Básica de Saúde no município do Rio de Janeiro Caffeine consumption by pregnant women selected from a Health Care Center in the municipality of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Alice Helena de Resende Nóra Pacheco

    2008-05-01

    Full Text Available OBJETIVO: avaliar o consumo de cafeína em gestantes e sua associação com variáveis demográficas, socioeconômicas, reprodutivas e comportamentais e com o estado nutricional materno. MÉTODOS: trata-se de estudo do tipo transversal, realizado entre 2005 e 2007. A presente análise refere-se ao período entre a oitava e a 13ª semana gestacional, sendo realizada com 255 gestantes entre 18 e 40 anos, usuárias de uma Unidade Básica de Saúde no município do Rio de Janeiro, Rio de Janeiro. A variável "desfecho"foi o consumo de cafeína quantificado por meio de questionário de freqüência alimentar semiquantitativo, previamente validado, o qual continha uma lista de alimentos com 81 itens e oito opções de freqüência de consumo. A ingestão de cafeína foi quantificada a partir do consumo de: chocolate em pó/Nescau®, chocolate em barra ou bombom, refrigerante, café e mate. A análise estatística foi realizada por meio de modelo hierarquizado de regressão linear múltipla. RESULTADOS: a mediana e o consumo médio de cafeína foram, respectivamente, de 97,5 e 121,1 mg (desvio padrão, dp=128,4. Já o consumo elevado da substância (>300 mg/dia foi observado em 8,3% das gestantes. No modelo multivariado, observou-se que mulheres cuja menarca ocorreu mais cedo (β=-0,15, com maior número de pessoas vivendo na casa (β=0,17 e que não faziam uso de medicamentos (β=-0,24 apresentaram maior tendência ao consumo elevado de cafeína e esta foi estatisticamente significativa (pPURPOSE: to determine caffeine consumption in pregnant women and to evaluate its association with demographic, socioeconomic, reproductive, lifestyle and maternal nutritional status. METHODS: it is a cross-sectional study performed between 2005 and 2007. The present analysis refers to the period among the 8th and 13th gestational week and included 255 pregnant women from 18 to 40 years, clients of a municipal health center in Rio de Janeiro. The outcome variable was

  2. SaGe Framework - Mapping of SARSA to Adaptive e-Learning using Learning Styles

    Directory of Open Access Journals (Sweden)

    Balasubramanian Velusamy

    2013-04-01

    Full Text Available This paper proposes a mathematical framework – the SaGe framework, which maps the adaptive nature of the e-learning environment to the reinforcement learning approach. An adaptive elearning system works in a similar fashion to an intelligent agent that assesses the various interactions of the user with the system, learns from these interactions and uses this knowledge base to select the best possible action to earn the maximum reward. This is the same methodology of reinforcement learning. The adaptive nature of the e-learning environment is provided by the assessment of the individual differences in the learning styles of the students. In our approach we chose the learning styles provided by the dimensions of the Felder-Silverman Learning Style Model (FSLSM and the SARSA algorithm for thereinforcement learning. Mapping of the reinforcement SARSA algorithm to an adaptive e-learning system is asserted by the time-based update of the Q-values of the SARSA algorithm.

  3. Homens e saúde na pauta da Saúde Coletiva Men and health as targets of the Public Health

    Directory of Open Access Journals (Sweden)

    Lília Blima Schraiber

    2005-03-01

    Full Text Available Apresenta-se a temática "homens e saúde" como questão contemporânea da Saúde Coletiva e produto da interface entre as ciências humanas e a saúde: o caráter social do adoecimento; a perspectiva de gênero como forma particular da relação saúde-sociedade; e a promoção da saúde como conceituação positiva Elabora-se a temática em torno de três eixos de aproximação, sob a perspectiva dos exercícios das masculinidades: saúde sexual e reprodutiva; violência e gênero e morbi-mortalidade em homens. São apontadas as contribuições que estes eixos produzem como esforço empírico para realizar a categoria gênero, ao tempo em que revelam novas problemáticas para a área de saúde: a paternidade, o exercício interativo da sexualidade, a violência interpessoal no âmbito da vida privada, a hiper-masculinidade na violência entre homens, o cuidado de si e o cuidar em saúde para os homens. Estas contribuições permitirão não apenas inserir as masculinidades como questão de saúde, mas renovar as formas de tratamento de homens e mulheres no campo da saúde.It shows the thematic "men and health" as a contemporary matter of the Public Health and interface product among human sciences and health: the social view of illness; the gender perspective as a particular form of the relation health-society and the health promotion while positive means of health. It elaborates the thematic around three approach axises, conformed in the relation between men and health from the perspective of exercises of the masculinity: sexual and reproductive health; violence and gender, and morbid-mortality in men. The contributions that these axises produce are mentioned as empiric effort to accomplish the category gender, the time in which they reveal health new problems to the health's area: the paternity, the interactive exercise of the sexuality, the interpersonal violence in life closet scope, the hipper-masculinity in the violence among men, the

  4. O papel do enfermeiro de saúde publica: projeções no ensino

    Directory of Open Access Journals (Sweden)

    Bertha Cruz Enders

    1995-09-01

    Full Text Available Analisa-se o papel do enfermeiro em saúde pública no contexto do ensino, como ponto de partida para uma avaliação da prática. Objetivou-se 1 Identificar o papel do enfermeiro em saúde pública projetado nos conteúdos programáticos das disciplinas de saúde pública do Curso de Enfermagem na Universidade Federal do Rio Grande do Norte desde sua implantação em 1974 até 1990 e, 2 Avaliar as concepções projetadas no ensino frente a realidade das práticas dos egressos. Conceptualizações da teoria de papeis nortearam o entendimento do termo "papel" e do processo de internalização do conceito. Utilizou-se uma abordagem qualitativa com triangulação na coleta de dados. Dados foram obtidos em duas fontes: nos conteúdos programáticos do Curso e nas opiniões dos enfermeiros egressos do Curso. Técnicas de análise documental foram aplicadas a 70 programas de disciplinas de Saúde Pública e uma amostra aleatória estratificada de 60 enfermeiros foi entrevistada utilizando um questionário específico. Os dados foram analisados à luz da teoria de papeis para a identificação do conceito. Em seguida, se analisou o conceito com base nas políticas de saúde vigentes da época em estudo. Os resultados demonstram que o papel do enfermeiro em saúde pública projetado nos conteúdos focaliza funções múltiplas, assistenciais educativas e administrativas dentro de uma visão preventiva. O objetivo da enfermagem em saúde pública tem sido a prevenção, dentro de uma prática de assistência primária e mais recentemente, dentro de uma perspectiva de mudança e de transformação das questões sociais e das políticas de saúde. Focaliza o enfermeiro planejador, competente nas técnicas epidemiológicas. A percepção dos egressos é também preventiva e focaliza o papel educador e conscientizador do enfermeiro, embora pouco avanço se observa com relação às questões sociais da população. Existe uma incompatibilidade entre os

  5. Alguns desafios conceituais e técnico-operacionais para o desenvolvimento do Programa de Saúde da Família como uma proposta transformadora do modelo assistencial Some conceptual and technicanoperational chanenges for the development of the Family Health Program as a proposal to change the health care model in Brazil

    Directory of Open Access Journals (Sweden)

    César Augusto Orazem Favoreto

    2002-06-01

    Full Text Available Este artigo discute algumas questões teórico-conceituais e técnico-operacionais que vêm fundamentando os serviços e as práticas dos profissionais médicos do Programa de Saúde da Família (PSF no Brasil. Foram utilizados dados de três fontes distintas: a textos que configuraram o debate internacional sobre promoção de saúde e saúde da família; b documentos e propostas do Ministério da Saúde e c dados produzidos em estudos empíricos sobre a implantação do PSF em algumas localidades no Brasil. Procura-se situar, no novo arranjo organizacional proposto pelo programa, os limites e desafios postos ao desenvolvimento de saberes e práticas de saúde capazes de contribuir para a ampliação da resolutividade e da integralidade das intervenções individuais e coletivas em saúde, no âmbito da atenção básica do SUS.This article discusses key theoretical/conceptual and technical/operational issues underlying the services provided and practices performed by physicians in the Family Health Program (PSF in Brazil. Three different data sources were used: a literature from the international debate on health promotion and family health; b documents and proposals by the Brazilian Ministry of Health; and c data from empirical studies on the implementation of the PSF in selected areas of Brazil. Within the new organizational framework proposed by the Program, the article attempts to identify the limits and chanenges to the development of health-related knowledge and practice capable of helping expand the case-resolving capacity and integrality of individual and conective health interventions within the basic care provided under the Unified Health System (SUS.

  6. O PET-Saúde da Família e a formação de profissionais da saúde: a percepção de estudantes

    Directory of Open Access Journals (Sweden)

    Luciana Margarida de Santana Madruga

    2015-12-01

    Full Text Available Trata-se de estudo com abordagem qualitativa, cujo objetivo foi analisar a contribuição do Programa de Educação pelo Trabalho para a Saúde (PET– Saúde da Família para a formação dos futuros profissionais de saúde de uma universidade pública do Nordeste do Brasil. Foram utilizados dados secundários do instrumento de avaliação semestral do programa, respondido por 67 estudantes dos cursos de: Educação Física, Enfermagem, Fisioterapia, Medicina, Nutrição e Odontologia. Os resultados foram sistematizados em duas categorias de análise: o trabalho interprofissional e a integração ensino-serviço. O estudo evidenciou: a importância do trabalho interprofissional e colaborativo, a integração ensino-serviço-comunidade, e a reflexão das práticas impulsionadas pelo PET-Saúde da Família para a mudança no processo formativo em saúde. Estratégias como essa são essenciais para a formação e o aperfeiçoamento de profissionais para o Sistema Único de Saúde (SUS.

  7. Sociologia das profissões e percepção de acadêmicos de Odontologia sobre o Agente Comunitário de Saúde em Saúde Bucal

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    Full Text Available A atuação profissional no Programa de Saúde da Família exige dos odontólogos uma postura que rompa com práticas clínicas tradicionais, a exemplo da articulação com o ACS neste contexto de trabalho em equipe. Estas questões remetem ao campo da sociologia das profissões de saúde. O presente artigo objetiva investigar a percepção de acadêmicos de Odontologia sobre a atuação dos ACS junto ao trabalho de Saúde Bucal. Em termos metodológicos, foram utilizadas quarenta entrevistas com acadêmicos de Odontologia de uma universidade federal, tratadas por um processo hermenêutico-dialético. Os resultados apontam para a falta de formação no trabalho em equipe multiprofissional, a existência de dificuldades para atuação em Saúde Coletiva, assim como para a deficiência no conhecimento das atribuições dos membros da equipe de Saúde da Família, em especial sobre as atribuições dos ACS junto à Saúde Bucal.

  8. Detección daño estructural empleando el vector de fuerza residual modificado y el algoritmo Simulated Annealing (SA Damage Detection Using the Modified Residual Force Vector and the Simulated Annealing Algorithm (SA

    Directory of Open Access Journals (Sweden)

    Óscar Begambre

    2010-01-01

    Full Text Available En este trabajo, el algoritmo Simulated Annealing (SA es empleado para solucionar el problema inverso de detección de daño en vigas usando información modal contaminada con ruido. La formulación de la función objetivo para el procedimiento de optimización, basado en el SA, está fundamentada en el método de la fuerza residual modificada. El desempeño del SA empleado en este estudio superó el de un algoritmo genético (AG en dos funciones de prueba reportadas en la literatura internacional. El procedimiento de evaluación de integridad aquí propuesto se confirmó y validó numéricamente empleando la teoría de vigas de Euler-Bernoulli y un Modelo de Elementos Finitos (MEF de vigas en voladizo y apoyadas libremente.In this research, the Simulated Annealing Algorithm (SA is employed to solve damage detection problems in beam type structures using noisy polluted modal data. The formulation of the objective function for the SA optimization procedure is based on the modified residual force method. The SA used in this research performs better than the Genetic Algorithm (GA in two difficult benchmark functions. The proposed structural damage-identification scheme is confirmed and assessed using a Finite Element Model (FEM of cantilever and a free-free Euler-Bernoulli beam model

  9. Uma análise crítica da abordagem dos Determinantes Sociais da Saúde a partir da medicina social e saúde coletiva latino-americana

    Directory of Open Access Journals (Sweden)

    Elis Borde

    Full Text Available O enfoque dos Determinantes Sociais da Saúde tem tido ampla difusão e foi aparentemente bem acolhido globalmente. Este artigo assume uma visão crítica desse enfoque, buscando sistematizar as críticas principalmente provenientes de debates no interior da medicina social e saúde coletiva latino-americana, que se articularam ao redor da diferenciação entre Determinantes Sociais da Saúde e a determinação social dos processos saúde-doença. Pretendemos examinar estas diferenças para problematizar a aparente unanimidade retórica em prol da equidade. Ainda que a abordagem dos Determinantes Sociais da Saúde marque um enorme avanço na mobilização pela equidade em saúde, em nossa avaliação ela não consegue ser mais do que um avanço incompleto.

  10. A transição paradigmática da saúde como um dever do cidadão: um olhar da bioética em Saúde Pública

    Directory of Open Access Journals (Sweden)

    Paula Gaudenzi

    Full Text Available Uma das preocupações atuais da saúde pública é qual seria o tipo de responsabilização que poderia legitimamente ser exigida dos indivíduos pela sua saúde e, em particular, perguntar-se se é moralmente justificada alguma forma de penalização contra os comportamentos considerados não saudáveis. A bioética aplicada à moralidade das ações em saúde pública pretende garantir tanto um padrão de acesso a um sistema de saúde com cobertura universal quanto o desenvolvimento das capacidades humanas, devendo, portanto, enfrentar o conflito entre os princípios da justiça social e da autonomia individual, ponderando a proteção da saúde dos necessitados e as liberdades fundamentais de todos e de cada um. Para isso, bioética e saúde pública deverão interrogar-se sobre os efeitos biopolíticos inscritos nas políticas sanitárias, situando-se na encruzilhada entre a Era dos Direitos e o Estado de Exceção.

  11. A transição paradigmática da saúde como um dever do cidadão: um olhar da bioética em Saúde Pública

    Directory of Open Access Journals (Sweden)

    Paula Gaudenzi

    2010-06-01

    Full Text Available Uma das preocupações atuais da saúde pública é qual seria o tipo de responsabilização que poderia legitimamente ser exigida dos indivíduos pela sua saúde e, em particular, perguntar-se se é moralmente justificada alguma forma de penalização contra os comportamentos considerados não saudáveis. A bioética aplicada à moralidade das ações em saúde pública pretende garantir tanto um padrão de acesso a um sistema de saúde com cobertura universal quanto o desenvolvimento das capacidades humanas, devendo, portanto, enfrentar o conflito entre os princípios da justiça social e da autonomia individual, ponderando a proteção da saúde dos necessitados e as liberdades fundamentais de todos e de cada um. Para isso, bioética e saúde pública deverão interrogar-se sobre os efeitos biopolíticos inscritos nas políticas sanitárias, situando-se na encruzilhada entre a Era dos Direitos e o Estado de Exceção.

  12. É como uma família: significados atribuídos a grupos de educação em saúde sobre diabetes por profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Lucas Pereira de Melo

    Full Text Available Resumo O artigo analisa os significados que os profissionais de saúde atribuem aos grupos de educação em saúde para pessoas com diabetes tipo 2. Este estudo etnográfico foi desenvolvido com cinco profissionais de uma Equipe de Saúde da Família Ampliada que atuavam em cinco grupos de educação em saúde sobre diabetes. Para coligir as informações, utilizaram-se observação participante e entrevistas semiestruturadas. Os dados foram analisados por meio da técnica de codificação temática. Emergiram três categorias: (1 é uma forma de educá-los: os grupos como espaço educativo e de acompanhamento clínico; (2 eles sabem que eu vou estar lá: os grupos como recurso para acessar o sistema de saúde; e (3 serve como um grupo de autoajuda: afinal, é um grupo para o quê? Concluiu-se que os grupos estudados eram um híbrido de terapia e apoio que, no devir de seus arranjos, possibilitavam aos informantes (quiçá, para os pacientes construírem outros significados para as normatizações da política de saúde e o dilema da cronicidade. Tal hibridização permitia a criação de saídas próprias às particularidades do trabalho em saúde num contexto de “vida total”.

  13. A integralidade das ações em saúde e a intersetorialidade municipal

    Directory of Open Access Journals (Sweden)

    Liane Teresinha Schuh Pauli

    2013-12-01

    Full Text Available Com a inclusão dos contextos biopsicosocial, econômico e cultural nos conceitos do processo saúde/doença aumentaram as exigências de atuação no âmbito municipal, levando à necessidade de novos contornos no planejamento e na política. Sob a justificativa de avançar no cumprimento das normas legislativas e direcionar esforços intersetoriais capazes de garantir a integralidade das ações em saúde, objetivamos com esta investigação analisar a percepção relativa ao conceito de saúde/doença nos vários níveis da gestão pública e o relacionamento do setor de trabalho com a área da saúde, verificando a viabilidade da intersetorialidade e a percepção sobre a importância desta como estratégia para a promoção da integralidade das ações em saúde. A pesquisa realizou-se em duas etapas, com a utilização do método qualitativo de análise em ambas, por meio de entrevista individual gravada no local de trabalho (Técnica do Discurso do Sujeito Coletivo, o que possibilitou a análise dos depoimentos verbais através das ideias centrais e suas correspondentes expressões-chave. Constituíram-se como sujeitos da pesquisa todos os elementos envolvidos na gestão municipal da cidade de Vera Cruz,RS, mais dois assessores diretos de cada um destes. Observou-se que existe a concepção do conceito de saúde ampliado e positivo, há o reconhecimento da responsabilidade dos vários setores sobre o processo saúde/doença da população e a intenção do trabalho intersetorial. Concluiu-se que, com mudanças político-organizacionais, capacitação de recursos humanos e planejamento, pode-se alcançar melhoria nas ações de promoção da integralidade das ações em saúde.

  14. Educação em saúde e cidadania: revisão integrativa

    Directory of Open Access Journals (Sweden)

    Viviane Ferraz Ferreira

    Full Text Available Este artigo apresenta os resultados de uma revisão integrativa de literatura sobre educação em saúde e cidadania, que buscou conhecer e analisar as diferentes contribuições científicas disponíveis. A educação em saúde reflete uma estratégia que almeja um cidadão coautor do processo de construção do cuidado à sua saúde. Utilizouse para a coleta de dados a base Lilacs (Literatura LatinoAmericana do Caribe em Ciências da Saúde no período de 2000 a 2011, totalizando 79 produções. Após a aplicação dos critérios de inclusão e exclusão, a amostra final incluiu dez publicações. A pesquisa trouxe a prevalência de estudos da natureza artigo, apresentando mais de três autores, com predominância de docentes e produção do tipo revisão teórica. As categorias que emergiram do estudo foram: educação em saúde - historicidade e bases conceituais; e educação popular como geradora de cidadania. As evidências mostraram o processo histórico das políticas de saúde e o surgimento dos movimentos sociais voltados para as necessidades da população. Destacaram também que a educação permanente em saúde proporciona a construção de novos saberes, mediante a junção de conhecimentos científicos e de saberes populares. Manifestaramse na literatura contribuições relevantes sobre a educação em saúde, por ser uma prática emancipadora do sujeito, atuando como espaço gerador de cidadania.

  15. O conceito de saúde The health's concept

    Directory of Open Access Journals (Sweden)

    Marco Segre

    1997-10-01

    Full Text Available Questiona-se a atual definição de saúde da Organização Mundial da Saúde: "situação de perfeito bem-estar físico, mental e social" da pessoa, considerada ultrapassada, primeiramente, por visar a uma perfeição inatingível, atentando-se as próprias características da personalidade. Menciona-se como principal sustentação dessa idéia, a renúncia necessária a parte da liberdade pulsional do homem, em troca da menor insegurança propiciada pelo convívio social. Discute-se a validade da distincão entre soma, psique e sociedade, esposando o conceito de homem "integrado", e registrando situações em que a interação entre os três aspectos citados é absolutamente cristalina. É revista a noção de qualidade de vida sob um vértice antipositivista. Essa priorização e proposta de resgate do subjetivismo, reverte a um questionamento da atual definição de saúde, toda ela embasada em avaliações externas, "objetivas", dessa situação.Objections to the present WHO (World Health Organization definition of HEALTH, as "the state of perfect physical, mental and social well-being", are expressed. It is considered to be anachronistic, first because it aims at perfection which is unaltainelle because of distict personality characteristics. As the main support for this idea, the necessary renunciation of part of man's drive to liberty in exchange for the lesser insecurity provided by social life (Freud, Castoriadis and Mc Dougall, is groted. The validity of distinguishing between "soma", "psyche" and "society" is questioned and the concept of the "integrated man", alluding to Pierre Marty and to Freud himself is adapted, and situations are recalled in which the interaction of the three aspects mentioned above is actually evident. Finally, the notion of the quality of life, in accordance with an antipositivistic taken from Bion, point of view, is discussed, and the concept that reality is that of each human being, is adapted. This

  16. Envelope Protein Mutations L107F and E138K Are Important for Neurovirulence Attenuation for Japanese Encephalitis Virus SA14-14-2 Strain

    Directory of Open Access Journals (Sweden)

    Jian Yang

    2017-01-01

    Full Text Available The attenuated Japanese encephalitis virus (JEV strain SA14-14-2 has been successfully utilized to prevent JEV infection; however, the attenuation determinants have not been fully elucidated. The envelope (E protein of the attenuated JEV SA14-14-2 strain differs from that of the virulent parental SA14 strain at eight amino acid positions (E107, E138, E176, E177, E264, E279, E315, and E439. Here, we investigated the SA14-14-2-attenuation determinants by mutating E107, E138, E176, E177, and E279 in SA14-14-2 to their status in the parental virulent strain and tested the replication capacity, neurovirulence, neuroinvasiveness, and mortality associated with the mutated viruses in mice, as compared with those of JEV SA14-14-2 and SA14. Our findings indicated that revertant mutations at the E138 or E107 position significantly increased SA14-14-2 virulence, whereas other revertant mutations exhibited significant increases in neurovirulence only when combined with E138, E107, and other mutations. Revertant mutations at all eight positions in the E protein resulted in the highest degree of SA14-14-2 virulence, although this was still lower than that observed in SA14. These results demonstrated the critical role of the viral E protein in controlling JEV virulence and identified the amino acids at the E107 and E138 positions as the key determinants of SA14-14-2 neurovirulence.

  17. As práticas educativas em saúde e a Estratégia Saúde da Família Health education practices and Family Health Strategy

    Directory of Open Access Journals (Sweden)

    Gehysa Guimarães Alves

    2011-01-01

    Full Text Available Este trabalho tem por objetivo refletir sobre a educação em saúde, enfatizando a educação popular em saúde (EPS como proposta metodológica e sua utilização na rede básica de saúde, em especial na Estratégia Saúde da Família. Para tanto, foi realizada revisão bibliográfica sobre educação em saúde, prática educativa nos serviços de saúde e educação popular em saúde. Observou-se que, ainda hoje, as práticas educativas nos serviços de saúde obedecem a metodologias tradicionais, não privilegiando a criação de vínculo entre trabalhadores e população. Para que a educação popular em saúde possa se consolidar como uma prática educativa, deve ser incorporada no cotidiano do trabalho em saúde. Nesse sentido, a formação profissional deve valorizar as ações coletivas promotoras da saúde e desencadear um processo de reflexão crítica nos sujeitos envolvidos nas relações de ensino-aprendizagemThis study evaluated health education, and particularly popular health education, as a methodological approach used in the Brazilian basic healthcare network and in the Family Health Strategy, a family health program of the Brazilian government. The literature on health education, educational practices in healthcare services, and popular health education was reviewed. We found that educational practices in healthcare services follow traditional methods and do not prioritize the establishment of links between healthcare workers and the population. To be consolidated as an educational practice, popular health education should be incorporated into the routine of health-care services. For this purpose, the preparation of healthcare workers should focus on actions to promote collective health and critical reflections on healthcare teaching and learning by all the individuals involved in these processes

  18. A inserção do psicólogo na estratégia de saúde da família e a transição de paradigma em saúde = The insertion of the psychologist in the esf and the health paradigm transition

    Directory of Open Access Journals (Sweden)

    Giacomozzi, Andréia Isabel

    2012-01-01

    Full Text Available Este trabalho discute alguns dos modelos de compreensão do binômio saúde-doença e suas aplicações no Sistema Único de Saúde brasileiro. Para tanto, faz-se uma revisão de estudos sobre a situação da Estratégia de Saúde da Família com relação à sua atuação, destacando-se a predominância de práticas fragmentadas e uma visão de saúde como ausência de doença somente, apesar do preceito de integralidade preconizado pelo SUS. Argumenta-se a favor da inserção do psicólogo na saúde pública como participante das equipes de saúde da família pelo entendimento de que este profissional pode dar uma contribuição importante para a superação do modelo hegemônico em saúde (biomédico por um modelo mais abrangente e integrado, que reconhece a saúde como um fenômeno multidimensional, no qual interagem aspectos biológicos, psicológicos e sociais e caminha para uma compreensão mais holística do processo saúde-doença

  19. Novas Tecnologias e Saúde

    OpenAIRE

    2013-01-01

    Introdução Comecemos por algo simples: lidar e combater doenças sempre pressupõe alguma forma de domínio técnico, mesmo quando as práticas para obtenção da saúde estão culturalmente associadas a meios mágicos. Um aspecto importante da magia, seu sentido ritualístico estrito, a observância de fórmulas rigorosas, constitui uma forma de racionalização da experiência empírica, que resulta em conhecimento sobre propriedades alucinógenas ou curativas de certos vegetais, por exemplo. A esse resp...

  20. Conhecimento e fonte de informações de pessoas surdas sobre saúde e doença

    Directory of Open Access Journals (Sweden)

    Yanik Carla Araújo de Oliveira

    2015-09-01

    Full Text Available Objetivou-se compreender o conhecimento de pessoas surdas em saúde e doença e suas fontes de informações em um estudo descritivo, com abordagem qualitativa, realizado em uma instituição pública de referência, no estado da Paraíba, em atendimento a pessoas com deficiência. Foram realizadas entrevistas individualmente, em língua de sinais, com 11 pessoas surdas escolhidas pelo método de saturação do conteúdo das falas. Os dados foram analisados segundo a análise de conteúdo. Das falas, emergiram as categorias: processo saúde-doença e fontes de informações de saúde. Os surdos entrevistados nesse estudo apresentaram um conhecimento limitado sobre o processo saúde-doença. Os sujeitos valorizam o médico como imprescindível para o processo saúde-doença. Alguns surdos expuseram não conhecer sobre saúde, devido a fontes precárias e pouco eficientes, disponibilizando informações primárias, sem profundidade de conteúdos, e, por isso, reivindicam mais oportunidades.

  1. Sala de espera para gestantes: uma estratégia de educação em saúde

    Directory of Open Access Journals (Sweden)

    Débora Souza Santos

    Full Text Available O objetivo do presente estudo foi descrever as experiências das acadêmicas de enfermagem monitoras do PET-Saúde Enfermagem da Ufal, em 2009/2010, na realização de ações de educação em saúde para gestantes em sala de espera. As ações foram realizadas regularmente na Unidade de Saúde, enquanto as gestantes aguardavam atendimento médico e de enfermagem do pré-natal. Vários temas de interesse para a gestante foram abordados, sempre utilizando métodos criativos e participativos de educação em saúde. Com essas ações, as estudantes aprenderam sobre a dura realidade dessas mulheres e sobre o papel da enfermagem na saúde coletiva, efetivando o cuidar através da educação participativa, em que usuários, familiares e profissionais trabalham juntos para proteger, promover e recuperar a saúde.

  2. Atenção básica à saúde masculina: possibilidades e limites no atendimento noturno

    Directory of Open Access Journals (Sweden)

    Sharllene Vanessa Lima Cordeiro

    2014-12-01

    Full Text Available Objetivo: Analisar as contribuições advindas com a ampliação do horário de funcionamento das Unidades Básicas de Saúde, para o horário noturno, no que concerne ao atendimento às necessidades de saúde da clientela masculina. Métodos: Estudo exploratório, com abordagem qualitativa, realizado com oito enfermeiros atuantes em Unidades Básicas de Saúde que possuem atendimento noturno no Município de João Pessoa/PB. A coleta de dados foi realizada por meio de entrevista semiestruturada e as falas submetidas à análise de conteúdo. Resultados: Emergiram quatro categorias: Estratégias adotadas para ampliar o atendimento nas Unidades Básicas de Saúde; Quantitativo de atendimento noturno da população masculina; Campos de atendimento as demandas de saúde masculina; Dificuldades vivenciadas no atendimento noturno. Conclusão: Os achados revelam eficácia desta estratégia de atendimento à saúde da clientela masculina, sobretudo aos usuários trabalhadores.

  3. The Characterization of SaPIN2b, a Plant Trichome-Localized Proteinase Inhibitor from Solanum americanum

    Directory of Open Access Journals (Sweden)

    Zeng-Fu Xu

    2012-11-01

    Full Text Available Proteinase inhibitors play an important role in plant resistance of insects and pathogens. In this study, we characterized the serine proteinase inhibitor SaPIN2b, which is constitutively expressed in Solanum americanum trichomes and contains two conserved motifs of the proteinase inhibitor II (PIN2 family. The recombinant SaPIN2b (rSaPIN2b, which was expressed in Escherichia coli, was demonstrated to be a potent proteinase inhibitor against a panel of serine proteinases, including subtilisin A, chymotrypsin and trypsin. Moreover, rSaPIN2b also effectively inhibited the proteinase activities of midgut trypsin-like proteinases that were extracted from the devastating pest Helicoverpa armigera. Furthermore, the overexpression of SaPIN2b in transgenic tobacco plants resulted in enhanced resistance against H. armigera. Taken together, our results demonstrated that SaPIN2b is a potent serine proteinase inhibitor that may act as a protective protein in plant defense against insect attacks.

  4. Redes de atenção à saúde sob a luz da teoria da complexidade

    Directory of Open Access Journals (Sweden)

    Cecilia Arruda

    2015-03-01

    Full Text Available Objetivo: Refletir acerca dos princípios que norteiam as Redes de Atenção em Saúde sob a luz dos princípios da Teoria da Complexidade de Edgar Morin. Métodos: Trata-se de uma reflexão teórica. Resultados: Esta reflexão foi organizada em três atos: primeiro, apresenta-se uma contextualização histórica das Redes de Atenção em Saúde no Brasil; segundo, a conexão entre as Redes de Atenção em Saúde e os princípios da teoria da complexidade de Edgar Morin; terceiro, expõe-se alguns desafios para construção das Redes de Atenção em Saúde na perspectiva da complexidade. Conclusão: A conexão existente entre os pressupostos das RAS e os princípios da Teoria da Complexidade sugere a possibilidade de se aprofundar o entendimento, tanto das dificuldades, como das possibilidades de transformação da realidade do serviço de saúde público brasileiro, em busca da implementação da prática da integralidade da atenção à saúde.

  5. Ensino da saúde coletiva na Faculdade de Medicina do ABC: alguns apontamentos sobre os desafios da Saúde Coletiva na formação médica

    Directory of Open Access Journals (Sweden)

    Nivaldo Carneiro Junior

    2015-12-01

    Full Text Available Introdução: A saúde coletiva, campo de saberes e práticas sobre o processo saúde‑doença‑cuidado, leva às graduações em saúde questões teórico‑metodológicas e tecnologias de intervenções ao exercício profissional. Historicamente, posiciona‑se à margem do projeto político‑pedagógico da formação em saúde, particularmente médica, de modelo biologizante e hospitalocêntrico. De acordo com a Constituição de 1988, Saúde é um Direito Social e o Sistema de Saúde, público e universal. Surgem formulações às políticas educacionais e saúde. É competência do Sistema Único de Saúde (SUS ordenar a formação de recursos humanos. As Diretrizes Curriculares Nacionais para as graduações em saúde apontam perfis profissionais voltados às necessidades de saúde da população, exigindo novas metodologias de ensino‑aprendizagem e cenários de práticas pedagógicas. Nessa perspectiva, o ensino da saúde coletiva emerge com importância singular. Relato de Experiência: A saúde coletiva na Medicina da Faculdade de Medicina do ABC era grade de disciplinas básicas do 2º ano. Um novo currículo modifica essa inserção. Até 2013, disciplina anual, em 3 módulos: epidemiologia, bioestatística e políticas e organização de serviços de saúde. Temas de ciências sociais e humanas desenvolviam‑se no 1º ano, módulo interdisciplinar Bases do Exercício Profissional. A grande concentração, nesse período, das disciplinas de morfologia e fisiologia, aproximações incipientes nos serviços de saúde e baixa exposição aos problemas de adoecimento e cuidado da população desafiavam o ensino‑aprendizagem da saúde coletiva. Conclusão: Desenvolveram‑se estratégias pedagógicas que superassem esse contexto, propiciando experiências cognitivas e habilidades psicomotoras favoráveis à apreensão dos conteúdos da saúde coletiva. Resultados positivos do exame recente do Conselho

  6. Comparative expression analysis of isolated human adipocytes and the human adipose cell lines LiSa-2 and PAZ6

    NARCIS (Netherlands)

    Beek, van E.A.; Bakker, A.H.; Kruyt, P.M.; Vink, C.; Saris, W.H.; Keijer, J.

    2008-01-01

    Objective: To obtain insight in the extent to which the human cell lines LiSa-2 and PAZ6 resemble isolated primary human adipocytes. Design: A combination of cDNA subtraction (representative difference analysis; RDA) and cDNA microarray analysis was used to select adipose specific genes to compare i

  7. Atuação da fonoaudiologia no Programa Saúde na Escola em Sete Lagoas, Minas gerais

    Directory of Open Access Journals (Sweden)

    Ana Maria dos Santos

    2016-12-01

    Full Text Available  A atuação fonoaudiológica na promoção da saúde da criança objetiva facilitar a criação de condições favoráveis e eficazes para melhor emprego das capacidades comunicativas de cada um, seja na escola, junto à família ou em outras atividades exercidas pela criança na comunidade. Na perspectiva de ampliar as ações específicas de saúde aos alunos da rede pública de ensino no ano de 2007 foi criado o Programa Saúde na Escola. Objetivo: descrever as ações realizadas pela equipe de Fonoaudiologia do Programa Saúde na Escola do município de Sete Lagoas a partir de práticas de educação, prevenção e promoção da saúde no aspecto fonoaudiológico em programas de saúde coletiva.  Metodologia: O presente estudo trata de um relato de experiência da Fonoaudiologia do Programa Saúde na Escola.   Resultados: A ação fonoaudiológica possibilitou que um grande número de crianças, avaliadas e triadas, fossem encaminhadas aos serviços especializados de saúde auditiva do município. Conclusão: A interface entre o trabalho das equipes de Fonoaudiologia e do corpo docente das escolas resulta em desenvolvimento global dos alunos, na medida em que a troca de experiências e saberes promove subsídios para detecção de problemas auditivos e de linguagem oral.

  8. Saúde da Família: o desafio de uma atenção coletiva

    Directory of Open Access Journals (Sweden)

    Suzely Adas Saliba Moimaz

    Full Text Available A estratégia de Saúde da Família, incorporada pelo Ministério da Saúde, em 1994, veio consolidar a política nacional de atenção à saúde que tem como seu principal foco de atuação a família. Nesse modelo, esta instituição passa a ser objeto primário de atenção, compreendida a partir do ambiente onde vive e de sua interação com o mesmo. Nas últimas décadas, a estrutura familiar brasileira vem sofrendo profundas alterações, que influenciam diretamente nas práticas de atenção à saúde. Esse estudo buscou resgatar os conceitos e concepções de família, bem como de suas representações sociais, e ainda revelar e apresentar a importância e a necessidade do uso de instrumentos amplos de abordagem coletiva em saúde como o APGAR, o genograma e o ecomapa, que utilizam a observação do ambiente e do histórico familiar, fatores fundamentais para o diagnóstico da realidade do núcleo familiar, para posterior planejamento das estratégias de ações em saúde. Conclui-se que as atuais estruturas familiares exigem uma capacitação das equipes de saúde, em relação aos aspectos físicos, culturais, biológicos e sociais do âmbito familiar, para a correta utilização dos instrumentos citados, importantes ferramentas para as abordagens coletivas no campo da saúde pública.

  9. The activated SA and JA signaling pathways have an influence on flg22-triggered oxidative burst and callose deposition.

    Directory of Open Access Journals (Sweden)

    So Young Yi

    Full Text Available The first line of defense in plants against pathogens is induced by the recognition of microbe-associated molecular patterns (MAMP. Perception of bacterial flagellin (flg22 by the pattern recognition receptor flagellin-sensing 2 (FLS2 is the best characterized MAMP response, although the underlying molecular mechanisms are not fully understood. Here we studied the relationship between salicylic acid (SA or jasmonic acid (JA signaling and FLS2-mediated signaling by monitoring flg22-triggered responses in known SA or JA related mutants of Arabidopsis thaliana (L. Heynh. The sid2 mutant, impaired in SA biosynthesis, had less basal FLS2 mRNA accumulation than the wild type, which correlated with suppression of early flg22 responses such as ROS production and induction of marker genes, WRKY29 and FRK1. The JA-signaling mutants, jar1 and coi1, exhibited an enhanced flg22-triggered oxidative burst and more callose accumulation than the wild type, and pretreatment with SA or coronatine (COR, a structural mimic of JA-isoleucine, altered these flg22-induced responses. Nonexpressor of pathogenesis-related genes 1 (NPR1 acted downstream of SID2 and required SA-dependent priming for the enhanced flg22-triggered oxidative burst and callose deposition. Activation of JA signaling by COR pretreatment suppressed the flg22-triggered oxidative burst and callose accumulation in a coronatine insensitive 1 (COI1 dependent manner. COR had a negative effect on flg22 responses but only the flg22-triggered oxidative burst depended on SA-JA/COR signaling antagonism. Thus the activated SA and JA signaling pathways have an influence on flg22-triggered oxidative burst and callose deposition. These results may explain how SA and JA signaling are cross talked for regulation of flg22-triggered responses.

  10. The endophytic bacterium, Sphingomonas SaMR12, improves the potential for zinc phytoremediation by its host, Sedum alfredii.

    Directory of Open Access Journals (Sweden)

    Bao Chen

    Full Text Available The endophytic bacterium, Sphingomonas SaMR12, isolated from Sedum alfredii Hance, appears to increase plant biomass and zinc-extraction from contaminated soil; however, the mechanism by which this occurs is not clear. Here, the ability of SaMR12 to promote zinc extraction and its effects on root morphology and exudation were examined in hydroponics. Zinc treatment increased shoot biomass by 30 to 45%, and by a further 10 to 19% when combined with SaMR12 inoculation. Zinc treatment also increased zinc accumulation modestly and this too was enhanced with SaMR12. Both biomass and zinc levels increased in a dose-dependent manner with significant effects seen at 50 µM zinc and apparent saturation at 500 µM. Zinc and the endophyte also increased levels of auxin but not at 50 µM and zinc increased levels of superoxide and hydrogen peroxide but mainly at 500 µM. As for root morphology, SaMR12 increased root branching, the number of root tips, and surface area. Zinc and SaMR12 also increased the exudation of oxalic acid. For most assays the effects of the endophyte and zinc were additive, with the notable exception of SaMR12 strongly reducing the production of reactive oxygen species at 500 µM zinc. Taken together, these results suggest that the promotion of growth and zinc uptake by exposure to zinc and to SaMR12 are independent of reactive oxygen and do not involve increases in auxin.

  11. Conceitos de saúde em discursos contemporâneos de referência científica

    Directory of Open Access Journals (Sweden)

    Coelho Maria Thereza Ávila Dantas

    2002-01-01

    Full Text Available Este trabalho investiga o conceito de saúde em alguns discursos de referência científica, como a sociologia funcionalista, a antropologia e a epistemologia, a partir de autores representativos desses discursos, bem como focalizando suas relações com a noção de doença e com a prática clínica. No campo da sociologia, destacam-se os conceitos de normalidade, rotulação e desvio no referencial da teoria do rótulo. Apresentam-se em seguida os principais modelos de saúde na antropologia médica norte-americana, avaliando-se criticamente as proposições de uma nova perspectiva supostamente capaz de superar a dualidade entre cultura e sociedade: a teoria dos sistemas de signos, significados e práticas. Analisa-se a distinção canguilhemiana entre normalidade e saúde, ressaltando sua originalidade, juntamente com a proposição de saúde como capacidade normativa. Por fim, propõe-se uma distinção entre os conceitos de saúde primária, saúde secundária e saúde terciária como etapa inicial para um processo de construção teórica capaz de subsidiar políticas e práticas sociais baseadas em uma concepção positiva de saúde.

  12. A saúde na escola: um breve resgate histórico Health at school: a brief history

    Directory of Open Access Journals (Sweden)

    Túlio Alberto Martins de Figueiredo

    2010-03-01

    Full Text Available Discute o nascimento histórico da saúde escolar no mundo e no Brasil. Apresenta a Iniciativa Regional Escolas Promotoras de Saúde - um discurso de múltiplos olhares e trabalho articulado entre a educação, saúde e sociedade -, como modelo alternativo de atenção à saúde na escola recomendado, pela Organização Pan-Americana de Saúde, para os países do Caribe e da América Latina. Considera que o olhar atento aos Parâmetros Curriculares Nacionais é condição fundamental para que os profissionais de saúde sensíveis à questão da educação em saúde na escola contribuam para que a mesma compareça na educação fundamental com um enfoque crítico, interdisciplinar e transversal e, finalmente, apresenta as diretrizes da nova política nacional de saúde na escola pública.It involves the historical birth of school health in the world and Brazil. It shows a regional initiative of Health Promoting Schools - a discourse of multiple viewings and joint work among education, health and society -, as an alternative model of attention to school health, recommended by Pan American Health Organization, to the Caribbean and Latin American Countries. Finally, it takes into account that a detailed observation of the National Curriculum Parameters is an essential condition so that health professionals, who are sensitive to the school health education issue, can contribute to its inclusion in the fundamental education with a critical, interdisciplinary and transversal approach, presenting the guidelines of a new national health polices at public schools.

  13. Informe sobre a cooperação Brasil-Canadá em promoção da saúde Report on the cooperation Brazil-Canada in health promotion

    Directory of Open Access Journals (Sweden)

    Lenira Zancan

    2004-09-01

    Full Text Available O trabalho relata a experiência de cooperação no campo da Promoção da Saúde, estabelecida entre a Escola Nacional de Saúde Pública (ENSP, a Associação Brasileira de Saúde Coletiva (Abrasco e a Associação Canadense de Saúde Pública (CPHA nos últimos quatro anos. Tal experiência tem evidenciado que a promoção da saúde e o desenvolvimento local são guiados por valores comuns e estratégias de ação similares, fundamentados em participação social, empowerment e colaboração intersetorial. No Brasil, as estratégias para promoção da saúde e desenvolvimento local ainda são insipientes e, por sua complexidade, necessitam ser sistematicamente analisadas. Nesse contexto, os parceiros canadenses e brasileiros se propõem, através de um novo Projeto de Cooperação, apoiar municípios selecionados nas várias regiões do país, na implementação e avaliação de intervenções em promoção da saúde e na construção de capacidades para o desenvolvimento local e ação intersetorial para a saúde. Essa agenda colaborativa toma por base as teorias da avaliação participativa, contribuindo para a construção de modelos e ferramentas de reflexive practices em desenvolvimento local e promoção da saúde, criando processos sustentáveis de melhoria dos ambientes físicos e sociais com impacto na saúde.This report presents the Project Development Phase of a Cooperation on Health Promotion involving the National School of Public Health (ENSP, the Brazilian Association of Collective Health (ABRASCO, and the Canadian Association of Public Health (CPHA. That experience evidenced that health promotion and local development are guided by common values and similar strategies for action, which are based on public participation, empowerment, and intersectoral collaboration. In Brazil the strategies for health promotion and local development are still undergoing and, for theirs complexity, need to be systematically analyzed. Within this

  14. Produção científica das ciências sociais e humanas em saúde e alguns significados Scientific production of the social and human sciences in health and some meanings

    Directory of Open Access Journals (Sweden)

    Ana Maria Canesqui

    2012-03-01

    Full Text Available Este artigo aborda, primeiramente, a produção científica das ciências sociais e humanas em saúde publicada em periódicos de sete revistas da área de Saúde Coletiva/Saúde Pública no Brasil, no período de 1997 a 2007, registrada na base eletrônica de dados SciElo e identificada mediante uma extensa lista de palavras-chave. Dos 1926 artigos e resenhas de livros identificados, 489 foram selecionados por autorreferir à pesquisa qualitativa. Da leitura dos resumos, selecionaram-se os temas pesquisados e suas proporções foram as seguintes: políticas e instituições de saúde (32,5%, saúde e doença (18,5%, gênero e saúde (16,5%, violência e saúde (9,0%, velhice e envelhecimento (7,0%, recursos humanos, profissões e formação (7,5%, estudos sociais das ciências e das técnicas (5,0% e educação e comunicação em saúde (4,0%. A leitura dos conteúdos dos textos completos permitiu identificar as abordagens teórico-metodológicas utilizadas e alguns significados típicos dessa prática científica. Concluiu-se que a produção acadêmica expandiu-se, concentrando-se 50% nos dois primeiros temas, com baixo grau de interdisciplinaridade; usou de teorias de médio alcance, combinando metodologias e teorias, abordagens disciplinares, participação nesta produção intelectual de cientistas sociais e profissionais de saúde com distintos graus de adesão às teorias das ciências sociais e humanas em saúde e diferentes sentidos da prática da pesquisa. A análise comparativa de diferentes pesquisas similares em diversos momentos mostrou manutenção, exclusão e inclusão de assuntos.The paper approaches the academic production of the Social and Human Sciences in Health, published in seven journals of the Public Health area in Brazil in the period 1997 to 2007, registered in the SciElo electronic database, and identified by an extensive list of key words. Of the 1926 papers and book reviews that were identified, 498 were selected

  15. Sentidos da Saúde numa Perspectiva de Gênero: um Estudo com Homens da Cidade de Natal/RN

    Directory of Open Access Journals (Sweden)

    Jáder Ferreira Leite

    Full Text Available Resumo O presente trabalho objetivou investigar os sentidos atribuídos à saúde por homens da cidade de Natal/RN, em dois contextos: uma Unidade Básica de Saúde (UBS de um bairro de classe média e uma Unidade de Saúde da Família (USF de um bairro popular. Metodologicamente, realizamos entrevistas semiestruturadas junto a 24 homens, sendo 12 de cada serviço, com faixa etária de 25 a 59 anos, abordados nas unidades de saúde de cada bairro. A análise dos dados deu-se a partir da perspectiva de Spink (2000, e Spink e Frezza (2000 e Spink e Medrado (2000, no tocante às práticas discursivas e os estudos de gênero. Os dados encontrados acompanham a tendência de estudos já realizados no campo, especialmente ao identificar como as posições sociais de gênero conformam os sentidos que os homens investigados construíram em relação à saúde, atribuindo a esta a importância de proporcionar as condições de exercício de uma masculinidade voltada para o provimento do lar e da família. Houve diferença acerca dos sentidos sobre a resolução de problemas de saúde no tocante aos serviços investigados: a maioria do grupo da UBS apontou para pouca resolutividade, gerando sentidos de ineficácia do serviço. Na USF, os sentidos apresentaram uma positividade em relação ao serviço, que julgamos ter relação com a natureza da Estratégia de Saúde da Família. Finalmente, identificamos como a busca pelos serviços de saúde no nível de atenção básica é limitada, fato que segue os estudos de que os homens buscam os serviços de saúde quando esta se encontra demandando atenção especializada. Concluímos que a PNAISH pode ter uma importante contribuição na medida em que se efetive como política de saúde, sensibilizando a toda a rede de atores e serviços envolvidos na busca por novos sentidos e práticas em torno da relação gênero-saúde.

  16. Proceso de internacionalización de las empresas Compañía Licorera de Nicaragua, S.A. y Kraft Foods Nicaragua, S.A

    Directory of Open Access Journals (Sweden)

    Aurora Margarita Saravia

    2006-08-01

    Full Text Available AUNQUE NICARAGUA ES UN PAÍS SUBDESARROLLADO Y POBRE, fundamenta sus expectativas de crecimiento y desarrollo en la exportación, especialmente desde la firma de diferentes Tratados de Libre Comercio. Sin embargo, son pocas las empresas nacionales que han logrado competir con éxito en los mercados internacionales. Entre ellas, se encuentran la Compañía Licorera de Nicaragua, S.A. y Kraft Foods de Nicaragua, S.A. El éxito del proceso de internacionalización depende de muchos factores, incluyendo la decisión de aventurarse en el extranjero. El punto clave está en aprovechar las ventajas competitivas de cada empresa y enfocarlas para obtener productos y servicios de calidad que son los pilares del éxito. El éxito internacional de estas tres empresas se analiza en este trabajo para dar a conocer su experiencia

  17. Atenção Primária à Saúde: elementos de continuidade e mudanças na saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helder Kiyoshi Kashiwakura

    Full Text Available RESUMO A Atenção Primária à Saúde (APS ocupa lugar de destaque na agenda governamental. Os objetos do estudo são o sistema de saúde do Distrito Federal e as iniciativas para reorganização da APS, com objetivo de analisar o comportamento dos gastos em busca de elementos de continuidade e mudanças nessa política, no período de 2005 a 2014. Adotou-se a pesquisa documental com foco em dados do Sistema de Informações sobre Orçamentos Públicos. Partindo do neoinstitucionalismo histórico, os resultados apontam contradição entre o discurso em defesa da APS e a manutenção das elevadas despesas com assistência hospitalar, testemunhando a característica de path dependence.

  18. Rheumatoid arthritis specific anti-Sa antibodies target citrullinated vimentin

    NARCIS (Netherlands)

    Vossenaar, E.R.; Despres, N.; Lapointe, E.; Heijden, A.G. van der; Lora, M.; Senshu, T.; Venrooij, W.J.W. van; Menard, H.A.

    2004-01-01

    Antibodies directed to the Sa antigen are highly specific for rheumatoid arthritis ( RA) and can be detected in approximately 40% of RA sera. The antigen, a doublet of protein bands of about 50 kDa, is present in placenta and in RA synovial tissue. Although it has been stated that the Sa antigen is

  19. Espaço público na Atenção Básica de Saúde: Educação Popular e promoção da saúde nos Centros de Saúde-Escola do Brasil

    Directory of Open Access Journals (Sweden)

    Inês Nascimento de Carvalho Reis

    2014-12-01

    Full Text Available Os marcos conceituais do trabalho são a promoção da saúde e educação em saúde, priorizando suas semelhanças, dentre as quais se destaca a importância do diálogo como estratégia de abordagem operacional. Buscou-se identificar a evolução dos conceitos, das práticas e da institucionalização da Promoção da Saúde, na perspectiva da educação na Atenção Básica de Saúde no Sistema Único de Saúde. O tema foi pesquisado nos 17 Centros de Saúde Escola (CSE do Brasil, onde se apresentam práticas educativas não convencionais em sala de espera (SE. Na ocasião, foram entrevistados 91 sujeitos (24 gestores, 35 profissionais e 32 usuários. Demonstra-se que a visibilidade das SE como espaço público poderia ser ampliada pela valorização do saber popular e do agir em conjunto, incentivando a cidadania ao trabalhar de forma criativa e otimizando os recursos disponíveis.

  20. Uso da avaliação de tecnologias em saúde em processos de análise para incorporação de tecnologias no Sistema Único de Saúde no Ministério da Saúde

    Directory of Open Access Journals (Sweden)

    Hillegonda Maria Dutilh Novaes

    2013-01-01

    Full Text Available As políticas científicas com objetivos de produção de conhecimentos em saúde foram ampliadas nas últimas décadas. No Brasil, o incentivo à pesquisa, desenvolvimento e inovação em saúde constou na Lei Orgânica da Saúde desde 1990, e políticas científicas e tecnológicas para a área da saúde foram propostas a partir de 1994, incluindo políticas de desenvolvimento da avaliação de tecnologias em saúde (ATS, como em outros países. Coloca-se agora a avaliação dos impactos da ATS sobre a gestão e incorporação de tecnologias nos sistemas de saúde. Como estudo de caso para o uso da ATS em processos de incorporação de tecnologias no Brasil foi analisada a participação do Departamento de Ciência e Tecnologia (DECIT do, Ministério da Saúde, na Comissão de Incorporação de Tecnologias do Ministério da Saúde (CITEC, no período 2008-2010. Foram utilizados 103 estudos na CITEC, 80% produzidos pelo DECIT, a maioria sínteses com base na literatura existente, e 80% das tecnologias tinham propósito terapêutico, com tendência de crescimento da produção no período. Está em curso um processo de aprendizado tanto metodológico quanto político para o uso da ATS, mas há necessidade de aprofundar a análise do seu impacto sobre o SUS.

  1. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    2012-06-01

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  2. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  3. Across the City, Toward the Nation: Philippine Poetry, Metropolitan Trains, and the Tulaan sa Tren Project

    Directory of Open Access Journals (Sweden)

    Oscar Tantoco Serquiña, Jr.

    2014-06-01

    Full Text Available In 2008 and 2010, the Philippine government’s National Book Development Board (NBDB and Light Railway Transit Authority (LRTA launched Tulaan sa Tren, a project “designed to provide train passengers with an appreciation for Philippine Literature as they listen to their favorite celebrities reading poems about Manila over the public announcement system of LRT Line 2 stations” (goodnewspilipinas.com. This project also initiated a poetry writing contest and produced poetry anthologies that predominantly depicted views of the city and city life. Part appreciation, part revaluation, part critique, this paper initiates a sensing of: (1 the train as a figure of modern life; (2 NBDB and LRTA’s enterprise as a state measure to bridge the disparity between the public’s reception to Philippine literature and the intelligentsia’s academic way of life; and (3 literary representations of the city in the poetry anthologies this project produced, namely Train of Thought: Poems from Tulaan sa Tren and Off the Beaten Track: Poems from Tulaan sa Tren 2. This paper argues that the institutional intervention of popularizing travel, literature, and the city may be seen as a way of generating a socio-political and literary consciousness among train commuters who are linked to and implicated in the issues and anxieties of their lives in the urban environment. By analyzing the poems in the anthologies, this essay ultimately critiques Tulaan sa Tren’s attempt at nation building, identity making, and city mapping.

  4. A categoria racionalidade médica e uma nova epistemologia em saúde

    Directory of Open Access Journals (Sweden)

    Marilene Cabral do Nascimento

    2013-12-01

    Full Text Available O artigo é um relato analítico da trajetória de 20 anos da categoria racionalidade médica, que emergiu no Campo da Saúde Coletiva, área das Ciências Sociais e Humanas em Saúde, no início da década de 1990, com o objetivo de estudar sistemas médicos complexos e terapêuticas tradicionais, complementares e alternativas. Com base em revisão crítica da literatura, apresentam-se aspectos do contexto cultural, político-institucional e social de seu surgimento, como também suas principais contribuições e desdobramentos nos planos teórico e das políticas e práticas sociais em saúde. Utiliza-se o conceito de epistemologia do sul de Boaventura de Sousa Santos, para a reflexão sobre a contribuição da categoria racionalidade médica à crítica da racionalidade científica pós-moderna e à construção de uma nova epistemologia em saúde.

  5. Do real ao ideal - o (descuidar da saúde dos idosos longevos

    Directory of Open Access Journals (Sweden)

    Tatiane Michel

    2015-06-01

    Full Text Available RESUMOObjetivo:analisar semelhanças e dessemelhanças nos significados do cuidado à saúde de idosos longevos atribuídos por eles e pelos profi ssionais de enfermagem no cenário de uma unidade básica de saúde.Método:pesquisa qualitativa etnográfica, alicerçada no método de Spradley e McCurdy e na antropologia interpretativa de Geertz e Kleinman. Participaram 20 informantes-chaves, as informações foram coletadas por meio da observação participante e entrevista etnográfica no período de março a outubro de 2013 e analisadas em domínios, taxonomias e tema cultural.Resultados:emergiram seis domínios e taxonomias culturais que mostraram razões, atributos e recursos para cuidar, na perspectiva dos idosos e dos profissionais de enfermagem e, por fim, o tema cultural: do real ao ideal - o (descuidar da saúde dos idosos longevos.Conclusão:o estudo mostrou o distanciamento entre o cuidado almejado e o realizado à saúde das pessoas com idade mais avançada no cenário estudado.

  6. Sentimentos e percepções da equipe de saúde frente ao paciente terminal

    Directory of Open Access Journals (Sweden)

    Alberto Manuel Quintana

    2006-12-01

    Full Text Available O atendimento a pacientes terminais pelas equipes de saúde, comprovadamente apontado por evidências na literatura, mostra a grande dificuldade que esses profissionais têm em lidar com o tema "morte". O presente estudo objetivou compreender como as equipes de saúde definem e vivenciam o paciente terminal. Para tanto, utilizou-se uma abordagem qualitativa que empregou a pesquisa etnográfica através de observação não-participativa, além de entrevistas semi-estruturadas nas unidades de hemato-oncologia e de infectologia de um hospital público. Os resultados certificaram as dificuldades por parte da equipe em lidar com pacientes terminais, bem como em defini-los como tais e comunicar aos mesmos a sua condição. Dessa forma, percebeu-se a intensa necessidade da realização de um trabalho direto com as equipes de saúde com o intuito de lhes proporcionar um espaço de reflexão e de entendimento, propiciando a continência das emoções suscitadas na equipe de saúde perante a situação da morte.

  7. Grupo Tutorial e a Saúde Mental no Ensino Médico

    Directory of Open Access Journals (Sweden)

    Marcia Braga Cliquet

    Full Text Available RESUMO Esta pesquisa objetivou investigar a presença de conteúdos de saúde mental no currículo real do ensino médico nos quatro primeiros anos da Faculdade de Ciências Médicas e da Saúde da Pontifícia Universidade Católica de São Paulo. Trata-se de um estudo quantitativo e documental de caráter descritivo que avaliou esses conteúdos nos objetivos de aprendizagem dos problemas utilizados na estratégia de ensino-aprendizagem denominada tutoria nos quatro primeiros anos do curso. Como resultado, menos de 15% dos problemas estudados apresentou conteúdos de saúde mental em seus objetivos de aprendizagem no primeiro, segundo e quarto anos do curso. No terceiro ano, 36% dos problemas apresentaram tais conteúdos. A pesquisa não permite concluir o nível de exploração desses temas, bem como o aprendizado sobre eles, porém diagnostica o empobrecimento da exploração dos temas de saúde mental que permeiam o ensino médico das doenças clínicas e cirúrgicas.

  8. Adolescência e trabalho: significados, dificuldades e repercussões na saúde

    Directory of Open Access Journals (Sweden)

    Cibele Almeida Torres

    2010-12-01

    Full Text Available Foram investigadas experiências de trabalho de adolescentes trabalhadores e as repercussões na saúde. A pesquisa foi desenvolvida em uma escola de Fortaleza, Ceará, em 2008, com dez adolescentes trabalhadores. O estudo foi exploratório, com abordagem qualitativa, tendo o grupo focal e o diário de campo como instrumentos de coleta de dados. A análise dos dados seguiu a análise de conteúdo. Foram respeitados os aspectos legais e éticos. Com o desenvolvimento do estudo, surgiram quatro categorias: características dos sujeitos participantes do estudo; significados das experiências de trabalho para os adolescentes; adolescentes trabalhadores e dificuldades enfrentadas nas situações de trabalho; repercussões da situação de trabalho no campo da saúde dos adolescentes. Percebeu-se que há toda uma conjuntura que leva os adolescentes a serem cercados por vulnerabilidades, sendo fundamental a preparação dos profissionais de saúde para atender tal público, proporcionando uma atenção integral e promovendo a saúde desses adolescentes.

  9. Direito à saúde: demanda por suplementos no Tribunal de Justiça

    Directory of Open Access Journals (Sweden)

    Leandro Felipe Mufato

    2012-03-01

    Full Text Available Buscou-se compreender como o Tribunal de Justiça de Mato Grosso contribui na efetivação do direito à saúde, ao atuar como mediador na demanda de pessoas e/ou famílias por suplementos. Objetivou conhecer a origem, o motivo, o objeto, o sujeito demandante e a resolutividade das decisões judiciais. Trata-se de estudo qualitativo baseado em pesquisa documental. Das 28 decisões analisadas, 92,8% (26 demandaram compostos alimentares e 7,1% (2, fitas de controle glicêmico. O magistrado acolheu o pedido em 96,5% (27 das decisões, recorrendo estritamente à Constituição Federal, em seu discurso sobre o direito à saúde, e à prescrição médica como prova jurídica. Tais prescrições impõem marcas comerciais em 100% (28 dos casos, e a alergia alimentar pediátrica constitui principal motivo da demanda, 17,8% (5. A maioria dos adoecimentos, considerados condições crônicas de saúde, demanda cuidados continuados e prolongados, frente aos quais o caráter pontual das decisões judiciais pouco contribui para efetivação da equidade e integralidade em saúde.

  10. Programa Saúde da Família no Brasil: uma agenda incompleta?

    Directory of Open Access Journals (Sweden)

    Maria Fátima de Sousa

    Full Text Available Este artigo trata de uma análise longitudinal da experiência brasileira com o Programa Saúde da Família (PSF, ao longo dos doze anos da sua implantação e implementação. Toma como ponto de partida o propósito fundamental desta estratégia, que é a reorganização da atenção básica de saúde, contextualizando à luz da experiência que é única e peculiar ao Sistema Único de Saúde (SUS. Evidencia os avanços e desafios do PSF, apontando nesse sentido as necessidades mais urgentes em termos de incorporação tecnológica, formação da força de trabalho, estabelecimento de novos mecanismos e pactos em torno do financiamento da atenção básica e encaminhamento de novas estratégias e tecnologias nos processos de monitoramento e avaliação. Finaliza apontando elementos para subsidiar um debate sobre as questões em pauta, o qual deve ser permanente e lúcido na perspectiva da construção do SUS e do direito à saúde.

  11. Processo comunicativo e humanização em saúde

    Directory of Open Access Journals (Sweden)

    Suely Ferreira Deslandes

    2009-01-01

    Full Text Available O artigo aborda o processo comunicacional como um dos desafios enfrentados na humanização em saúde. Reflete sobre potencialidades e requisitos para a produção do agir comunicativo e aponta alguns obstáculos, baseando-se em estudos antropológicos sobre a cultura biomédica. Com base no conceito de entendimento, discute sobre os encontros em saúde e a relevância da validação e do reconhecimento do discurso dos diferentes atores. Aponta para a importância de se relativizarem marcas identitárias associadas à cultura biomédica, desconstruírem-se alguns conceitos, criticarem seus contextos de aplicabilidade e até mesmo se propor novas marcas por meio da humanização. Discute-se a relação entre as tecnologias biomédicas e o processo comunicacional. O desafio colocado é o de aprender, reconhecer e negociar com o outro, que detém direitos, autonomia e estoque cultural peculiares. Finalmente, discute os esforços teóricos para que a humanização das práticas em saúde venha a fazer parte do ethos ou visão do mundo dos profissionais de saúde.

  12. Novel Castellaniella denitrificans SA13P as a Potent Malachite Green Decolorizing Strain

    Directory of Open Access Journals (Sweden)

    Ankita Chawla

    2014-01-01

    Full Text Available Triphenylmethane dyes represent a major group of dyes causing serious environmental hazards. Malachite Green is one of the commonly and extensively used triphenylmethane dyes although it is carcinogenic and mutagenic in nature. Various physicochemical methods have been employed for its elimination but are highly expensive, coupled with the formation of huge amount of sludge. Hence, biological methods being ecofriendly are good alternatives. In the present study, the novel bacterial isolate SA13P was isolated from UASB tank of tannery effluent treatment plant. Phylogenetic characterization of 1470 bp fragment of SA13P has revealed its similarity with Castellaniella denitrificans. This strain has been found to decolorize the dye (malachite green at a concentration of 100 mg L−1 (80.29%. Decolorization was done by living bacterial cells rather than adsorption. Growth conditions have also been optimized for the decolorization. Maximum decolorization was observed at a temperature of 37°C and pH 8.0. Also, it has been found that bacterization of seeds of Vigna radiata with Castellaniella denitrificans SA13P increases germination rate. We have reported for the first time that Castellaniella denitrificans SA13P may be used as a novel strain for dye decolorization (malachite green and biological treatment of tannery effluent.

  13. Fenomenologia heideggeriana como referencial para estudos sobre formação em saúde

    Directory of Open Access Journals (Sweden)

    Alberto Durán González

    2012-09-01

    Full Text Available Reflete-se sobre as possibilidades da fenomenologia heideggeriana como referência na análise da educação na saúde. Heidegger propõe, em "Ser e tempo", a investigação sobre o sentido do ser, fundamental para o conhecimento que o homem possa ter de si mesmo como ser finito. Suas ideias provocaram transformações na concepção humanista moderna e na prática em educação. O indivíduo é sempre ator, sendo na medida em que existe, experimentando a si próprio na existência. O modo de ser privativo da saúde, o padecimento, é acompanhado sempre de uma limitação da possibilidade de viver. Assim, a fenomenologia heideggeriana nos ajuda a questionar a educação em saúde. Compreende-se que o homem se encontra sempre em copresença, entre a preocupação substitutiva e a libertadora. Este caminho se mostra possível quando contemplados os diversos modos de ser-professor e de ser-estudante. Possibilita-se, assim, aprofundar o ensinar-aprender na formação em saúde.

  14. Marcadores de saúde do homem em um município de pequeno porte

    Directory of Open Access Journals (Sweden)

    Maria Cristina Pinto de Jesus

    2014-12-01

    Full Text Available Objetivo: Identificar marcadores de saúde do homem. Métodos: Pesquisa descritiva, exploratória com abordagem quantitativa realizada em um município de pequeno porte de Minas Gerais. A coleta de dados ocorreu de outubro a dezembro de 2013, utilizando-se 217 formulários estruturados com informações de homens. Resultados: 134 (62% formulários foram preenchidos durante o atendimento na Unidade de Atenção Primária à Saúde e o restante no dia da chamada nutricional realizada pelo município; 58% dos homens apresentaram sobrepeso e obesidade e a prevalência de hipertensão arterial sistêmica e diabetes mellitus foi de 17,5% e 4,6%, respectivamente. As doenças cardiovasculares mostraram-se mais presentes entre os homens, e sua alimentação inclui um grande percentual de alimentos processados. Conclusão: Os marcadores de saúde identificados no homem apontam a necessidade de operacionalização de estratégias que fortaleçam a participação do público masculino nas ações de promoção da saúde.

  15. Mulher, direito e saúde: repensando o nexo coesivo Women, rights and health

    Directory of Open Access Journals (Sweden)

    Rosa Maria Godoy Serpa da Fonseca

    1999-12-01

    Full Text Available Esse artigo é construído a partir de três elementos básicos: mulher, direito e saúde, articulados entre si a partir de: 1 considerações acerca das condições objetivas de constituição das mulheres enquanto sujeitos sociais na sociedade contemporânea; 2 direitos das mulheres como direitos humanos e 3 direito das mulheres à saúde no contexto da implementação do PAISM (Programa de Atenção Integral à Saúde da Mulher, como focalização do SUS (Sistema Único de Saúde.That article is built from three basic elements: women, rights and health, articulated to each other starting from: 1 considerations concerning the objective conditions of the women's constitution as social subjects in contemporary society; 2 women's rights as human rights and 3 women's rights to health in the context of PAISM (Program of Integral Attention to the Woman's Health, as part of SUS (Unified System of Health.

  16. Estresse, coping e estado de saúde entre enfermeiros hospitalares

    Directory of Open Access Journals (Sweden)

    Laura de Azevedo Guido

    2011-12-01

    Full Text Available Estudo quantitativo com o objetivo de identificar estressores, nível de estresse dos enfermeiros, estado geral de saúde e formas de enfrentamento utilizadas pelos enfermeiros no ambiente de trabalho. Os dados foram coletados utilizando-se três instrumentos: formulário para levantamento de atividades diárias; inventário de estratégias de coping; inventário sobre o estado geral de saúde. A população deste estudo foi composta de 143 enfermeiros e a maioria encontra-se com baixo nível de estresse (55,25% e com estado regular de saúde (50,35%. Em relação às formas de enfrentamento, identificou-se resolução de problemas como o fator de maior média. Concluindo, ações educativas devem ser incentivadas, a fim de disponibilizar ferramentas para que o profissional desenvolva estratégias de coping resolutivas em seu dia a dia, minimizando o efeito do estresse no seu estado de saúde e no seu trabalho.

  17. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    2012-12-01

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.

  18. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.

  19. Promoção de Saúde e a Funcionalidade Humana

    Directory of Open Access Journals (Sweden)

    Ana Cristhina de Oliveira Brasil

    2013-03-01

    Full Text Available Para a elaboração de políticas públicas de saúde no Brasil, dois aspectos devem ser levados em consideração, a saber, a transição demográfica e a transição epidemiológica. Cada vez mais, observa-se um aumento no número de pessoas idosas convivendo com inúmeras incapacidades e, ainda, um perfil epidemiológico. A Pesquisa Nacional por Amostra de Domicílios (PNAD 1998-2003 indica uma distribuição de doenças crônicas que, consequentemente, tem gerado um número expressivo de incapacidades. Essas pessoas com incapacidades necessitam dos serviços de saúde, e os utilizam quando conseguem ter acesso a eles. Contudo, os modelos vigentes de atenção à saúde do idoso ou à saúde das pessoas com deficiência são de alto custo e, em alguns aspectos, não se apresentam eficientes, demandando estratégias de prevenção e equipamentos de saúde destinados à manutenção ou recuperação da saúde de uma população mais envelhecida. Desse modo, a agenda de política pública do Brasil deveria priorizar a manutenção da funcionalidade dos idosos, com monitoramento das condições de saúde, ações preventivas específicas de saúde e educação, e cuidados buscando uma atenção multidimensional e integral, não necessariamente centrada na doença(1.A necessidade de se elaborar políticas e estratégias, em especial de promoção de saúde, com um olhar descentralizado da doença se justifica porque os problemas de saúde advêm não somente de doenças, mas de qualquer outra condição ou circunstância de saúde, tais como agravos, gravidez, envelhecimento, estresse, predisposição genética – todas classificadas pela CID-10, contudo, sem poder mensurar as mudanças de estado relativas à condição de saúde, e muito menos classificar para descrever o contexto em que esses problemas acontecem, o que dificulta e compromete o planejamento e a resolubilidade das ações e dos serviços em saúde, diferentemente dos dados por

  20. STRATEGI PENINGKATAN DAYA SAING RUMAH POTONG AYAM PT XYZ

    Directory of Open Access Journals (Sweden)

    Arli Arli

    2012-07-01

    Full Text Available ABSTRACTThe objectives of this study were (1 analyzing the role of parties in the value chain that affect PT XYZ competitiveness, (2 identifying the RPA PT XYZ  stakeholders’ key players, (3 analyzing internal and external (IE factors that affects the competitiveness of RPA PT XYZ , (4 formulating strategic long term objectives and goals to increase the competitiveness of RPA PT XYZ , (5 analyzing strategies’ priorities and alternatives to improve the competitiveness of RPA PT XYZ . The method used in this study was descriptive analysis. The analysis tools used in this study were global value chain, stakeholders’ analysis, internal factor evaluation, external factor evaluation, IE Matrix, SWOT, and quantitative strategic planning matrix. Based on the results of global value chain analysis, stakeholders analysis, internal and external analysis, and the company’s visions and missions, the long term objectives are (a to provide value added for customers, (b to maximize business operation’s profit, (c to increase stakeholders’ welfare, (d to operate a sustainable business operation. Results on the IE Matrix and the SWOT analysis, the strategies that can be used to achieve the strategic long term objectives and goals are (a to increase the effectiveness and the efficiencies of the supply chain management; (b to implement performance evaluation on employees and business partners; (c to strengthen the company’s image as a high quality domestic chicken-based food producer in Indonesia; (d to enhance researches and developments; (e to build strategic alliances with external live chicken suppliers; (f promote the importance of animal protein consumption to Indonesian society. Three priority strategies resulted from QSPM analysis are create enhancing the effectiveness and efficiency of the supply chain, implementing performance evaluation on employees and business partners, and strengthen the company’s image as a high quality domestic

  1. Promoção da saúde e as escolas: como avançar

    Directory of Open Access Journals (Sweden)

    Daniela Gardano Bucharles Mont'Alverne

    2014-05-01

    Full Text Available Nos campos de ação da promoção da saúde, descritos pela Carta de Ottawa em 1986, destaca-se a criação de ambientes favoráveis à saúde(1. Nesta linha de pensamento várias estratégias têm sido utilizadas para se implantar políticas de promoção da saúde, dentre elas, a Escola Promotora da Saúde.No ano de 1995, a Organização Pan-Americana da Saúde, Oficina Regional da Organização Mundial da Saúde (Opas/OMS lançou oficialmente a Iniciativa Regional de Escolas Promotoras de Saúde. Desde então, todos os países da América Latina e do Caribe têm fortalecido suas ações de promoção da saúde na escola revendo as atividades desenvolvidas no campo da saúde escolar(2. Para a escola ser denominada Escola Promotora da Saúde ela deve ter uma visão integral do ser humano, em especial as crianças e os adolescentes, dentro do seu ambiente familiar, comunitário e social. Ela deve desenvolver um ambiente saudável buscando relações construtivas e harmônicas, sendo capaz desta forma de despertar nos participantes aptidões e atitudes para a saúde, promovendo a autonomia, a criatividade e a participação dos alunos, bem como de toda a comunidade escolar(3. Em nenhum outro momento histórico, falou-se tanto em saúde e promoção da saúde como no atual, ou seja, verifica-se a atribuição de promover saúde no ambiente escolar como elemento transformador da realidade. A escola tem papel político fundamental neste contexto, pois é ali que se constrói, destrói ou se perpetua uma ideologia através da transmissão de valores e crenças, além de ser este, um ambiente propício para o desenvolvimento de ações educativas em saúde. É a infância o momento decisivo para a construção e solidificação dos hábitos e atitudes e, em vista disso, a importância do papel da escola como o ambiente potencializador para o desenvolvimento de um trabalho direcionado, sistematizado e permanente. “Através da estratégia de Escola

  2. Qualidade de vida relacionada à saúde de filhos de profissionais da área de saúde

    Directory of Open Access Journals (Sweden)

    Silvia Maria Moussi Gamallo

    2012-12-01

    Full Text Available Neste estudo mensuramos a qualidade de vida relacionada à saúde (QVRS e a fadiga de filhos de profissionais da área da saúde, com idades entre 2 e 11 anos, e avaliamos os hábitos diários e o sono dessas crianças e dos respectivos pais. Foram incluídas no estudo crianças de uma escola pública. Dados demográficos e dados de hábitos diários foram colhidos. A QVRS, o sono e a fadiga foram mensurados por questionários. Participaram 249 pais - 63,5% referiram sono adequado e 47,4% acordavam cansados. A média da idade das crianças foi 5,6 anos - 62,2% assistiam televisão no quarto, 50% usavam computador (> 4 horas/dia e 27,8% faziam atividades físicas extracurriculares. O escore do sono foi de 45,8 ± 12,2. Os escores de QVRS foram mais elevados no aspecto físico e mais baixos no emocional. Detectamos que o sono de pior qualidade dos filhos e dos pais pode estar relacionado à pior QVRS dos filhos. Concluímos que os hábitos inadequados dos pais, bem como das crianças, estão relacionados a uma diminuição da QVRS dos filhos, especialmente no aspecto emocional.

  3. Higienização de unidade móvel de saúde | Hygiene mobile health unit

    Directory of Open Access Journals (Sweden)

    Evelise Pires Cogo Simão

    2016-07-01

    Full Text Available Introdução: Considerando a disseminação de micro-organismos no transporte e locomoção de pessoas por unidades móveis de saúde, não podemos deixar de prover a limpeza e desinfecção de todas as áreas destinadas à acomodação dos usuários e equipamentos. Objetivo: Identificar na literatura científica sobre higienização de Unidade Móvel de Saúde. Método: Trata-se de uma revisão integrativa da literatura nas bases de dados LILACS, SciELO, MEDLINE, PubMED, CINAHL, Embase, WoS, Scopus. A coleta de dados deu-se em março de 2015, incluindo artigos do período compreendido entre 2005 a 2015. Resultados: Foram selecionados 769 artigos. Destes, apenas seis artigos preencheram os critérios de inclusão. Ao caracterizar estes estudos percebe-se que todos descrevem estudos internacionais, dos quais três são da base de dados CINAHL, dois da Pubmed e um da LILACS. Conclusão: É necessária a realização de maiores investigações que subsidiem a higienização de unidades móveis de saúde, a partir da escolha do desinfetante adequado, frente à carga microbiana desses veículos, com o intuito de proporcionarem estratégias para prevenção da infecção relacionada à assistência à saúde, aumentando a adesão das boas práticas e inclusive elaboração de Protocolos Assistenciais ou Procedimentos Operacional Padrão (POP, no controle de infecção cruzada em unidades móveis de saúde. -------------------------------------------------------------------------------------------- Introduction: Considering the spread of microorganisms in the transport and mobility of people in mobile health units, the cleaning and disinfec tion of all areas for accommodation of users and equipment is crucial. Objective: To identify scientific literature related to the hygiene of mobile health units. Method: This is an integrative literature review in the databases LILACS, SciELO, MEDLINE, PubMed, CINAHL, Embase, WoS, and Scopus. The data collection

  4. Representações sociais da educação em saúde pelos profissionais da equipe de saúde da família

    Directory of Open Access Journals (Sweden)

    Maria Flávia Carvalho Gazzinelli

    Full Text Available Este estudo discute a forma como os profissionais da equipe de saúde da família pensam e representam a educação em saúde e a prática educativa que realizam. Os sujeitos da pesquisa (n=248 - médico, enfermeiro, auxiliar de enfermagem e agente comunitário de saúde de 20 unidades básicas de saúde de Belo Horizonte - foram entrevistados mediante a utilização da técnica de evocação livre e da teoria das representações sociais. Solicitou-se aos sujeitos que verbalizassem cinco palavras que lhes ocorressem imediatamente em relação à educação em saúde, classificando-as em positiva ou negativa. Utilizou-se o software Evoc e calculou-se a frequência simples de ocorrência, a média ponderada de ocorrência em função da ordem de evocação e a média das ordens ponderadas do conjunto dos termos evocados. Construiu-se o quadro de quatro casas composto do núcleo central, elementos de contraste e periféricos da representação. Médicos e enfermeiros compartilham conteúdos representacionais entre si, expressando representações sociais similares, ao apresentarem nos possíveis núcleos centrais 'capacitação' e 'prevenção'. Auxiliares de enfermagem e agentes comunitários de saúde se assemelham por meio dos possíveis elementos centrais 'educação' e 'prevenção'. O foco recai na transmissão de orientações com o objetivo de persuadir os indivíduos à adoção de modos de vida saudáveis.

  5. Intervenções Psicossociais para Promoção da Saúde do Homem em Unidade de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Silva Souza

    Full Text Available Este relato de experiência profissional busca contribuir a responder a questão: Como promover a saúde do homem na Atenção Primária à Saúde? São descritas duas estratégias implantadas em uma Unidade de Saúde da Família de Vitória, ES, as "Ações de Sábado" e o "Grupo de Homens". Cada "Ação de Sábado" é realizada trimestralmente, em um sábado pela manhã, com duração de quatro horas, contando com atividades recreativas e de educação em saúde (discussões sobre doenças sexualmente transmissíveis, por exemplo. O "Grupo de Homens" é realizado semanalmente, com duração de 1h15min, com exposições dialogadas (sobre problemas com o álcool, por exemplo e com oficinas terapêuticas. No período de setembro de 2011 a julho de 2013, as intervenções envolveram cerca de 230 homens de classe popular. Os conceitos de clínica ampliada e atitude psicoterapêutica são utilizados para promover a expressão dos usuários e a corresponsabilização com o processo saúde-doença. Dentre os resultados, destacam-se: o aumento da presença masculina na USF, a melhoria do cuidado dirigido a condições crônicas (especialmente hipertensão, diabetes e problemas com o álcool/alcoolismo e o fortalecimento de comportamentos de redução de danos. Conclui-se que as intervenções são proveitosas para abordar desafios relativos à Saúde do Homem.

  6. O Estado de Saúde da Ilha de Moçambique: Uma análise comparativa dos indicadores de saúde da população

    Directory of Open Access Journals (Sweden)

    Ana Luísa Patrão

    2011-10-01

    Full Text Available De acordo com o PNUD (2010, num universo de 169 países, Moçambique ocupa o 165º lugar relativamente aos índices de desenvolvimento humano. Entre 2004/2005 desenvolveu-se uma investigação, com uma amostra de 500 indivíduos, cujo objectivo passou por analisar alguns indicadores de saúde da população da Ilha de Moçambique e compará-los com os valores nacionais. Os resultados demonstraram que, em alguns aspectos, os valores da Ilha são mais desfavoráveis do que os nacionais, enquanto que noutros são mais elevados. Assim, no geral, considera-se que a Ilha não possui um nível de desenvolvimento humano alto, tal como era esperado. Ao nível da saúde, a população não acede às oportunidades nem aos instrumentos que a ajudariam a melhorar a sua qualidade de vida.The United Nations Development Program (PNUD refers to Mozambique as occupying the 165th place in terms of human development, within a range of 169 countries (2010. A study was conducted between 2004/2005, based on a sample of 500 persons. The goal was to analyse selected health indicators within the Island of Mozambique’s population, in order to compare them with the national rates. The results show that, in some aspects, the Island’s rates are lower than the national ones. However, it was also observed that certain variables revealed a more favourable situation within the Island of Mozambique. Generally speaking, then, we may conclude that human development is a serious problem in the Island. Healthwise, the population lacks the opportunities, as well as the means to improve this situation.

  7. Produção e citação em Saúde Coletiva: um olhar a partir dos periódicos Cadernos de Saúde Pública e Revista de Saúde Pública Output and citation in Public Health: a perspective based on the journals Cadernos de Saúde Pública and Revista de Saúde Pública

    Directory of Open Access Journals (Sweden)

    Leandro Carvalho

    2007-12-01

    Full Text Available O presente trabalho é um estudo bibliométrico comparativo entre as duas principais revistas científicas da área da Saúde Coletiva publicadas no Brasil: Cadernos de Saúde Pública (CSP e Revista de Saúde Pública (RSP. Foram analisados 24 fascículos de cada periódico, publicados entre 1996 e 2003, construindo uma amostra de 819 artigos (496 de CSP e 323 de RSP. Os seguintes elementos dos artigos foram identificados e analisados: área temática do artigo e padrão de citações de publicações (artigos em periódicos, livros e/ou capítulos de livro, teses/dissertações, documentos de Internet, "literatura cinzenta" e outros tipos de publicações. Os dados encontrados mostram que a maioria dos artigos publicados é da subárea "epidemiologia". O padrão de citação identificado nas revistas foi de citações a artigos em periódico em maior número, seguidas das citações a livros e/ou capítulos de livro. Artigos na subárea "ciências sociais em saúde" publicados em CSP apresentam características distintas, com maior número de citações a livros e capítulos. Os autores argumentam que as informações são relevantes na caracterização da produção da área, com desdobramentos importantes no plano da avaliação acadêmico-científica da Saúde Coletiva no país.This is a comparative bibliometric study of the two main scientific journals in the Public Health field in Brazil: Cadernos de Saúde Pública (CSP and Revista de Saúde Pública (RSP. Twenty-four issues of each periodical were analyzed, published from 1996 to 2003, comprising a sample of 819 articles (496 from CSP and 323 from RSP. The following elements in the articles were identified and analyzed: thematic area of the article and citation pattern of publications (articles in periodicals, books and/or book chapters, theses/dissertations, Internet documents, "gray" literature, and other types of publications. The resulting data showed that the majority of the

  8. Assignment of simian rotavirus SA11 temperature-sensitive mutant groups B and E to genome segments

    Energy Technology Data Exchange (ETDEWEB)

    Gombold, J.L.; Estes, M.K.; Ramig, R.F.

    1985-05-01

    Recombinant (reassortant) viruses were selected from crosses between temperature-sensitive (ts) mutants of simian rotavirus SA11 and wild-type human rotavirus Wa. The double-stranded genome RNAs of the reassortants were examined by electrophoresis in Tris-glycine-buffered polyacrylamide gels and by dot hybridization with a cloned DNA probe for genome segment 2. Analysis of replacements of genome segments in the reassortants allowed construction of a map correlating genome segments providing functions interchangeable between SA11 and Wa. The reassortants revealed a functional correspondence in order of increasing electrophoretic mobility of genome segments. Analysis of the parental origin of genome segments in ts+ SA11/Wa reassortants derived from the crosses SA11 tsB(339) X Wa and SA11 tsE(1400) X Wa revealed that the group B lesion of tsB(339) was located on genome segment 3 and the group E lesion of tsE(1400) was on segment 8.

  9. Organização tecnológica do trabalho em saúde bucal no SUS: uma arqueologia da política nacional de saúde bucal

    Directory of Open Access Journals (Sweden)

    Fabiana Schneider Pires

    2015-03-01

    Full Text Available Este artigo discute a organização tecnológica dos modelos de atenção à saúde bucal à luz da Política Nacional de Saúde Bucal - PNSB. O referencial teórico-metodológico para este estudo estruturou-se em um histórico das políticas de saúde bucal no Brasil, buscando apreender o saber operante que norteou a prática neste campo. A abordagem das políticas de saúde procedeu-se sob teoria de M. Foucault na obra Arqueologia do Saber. Utilizou-se de revisão de documentos normativos do SUS e de publicações do período de 2000 a 2012. Procurou-se desvelar, a partir da organização tecnológica (categoria de análise como tais políticas abordam as necessidades de saúde da população e quais ferramentas, instrumentos e tecnologias são oferecidas para o cuidado em saúde bucal. O SUS busca substituir modelos de organização do trabalho que transformem a prática de assistência odontológica (ineficaz, baixa cobertura, monopolista, baixa resolubilidade, mal distribuída geográfica e socialmente, por modelos voltados à promoção da saúde. O levantamento de artigos sobre a atual PNSB destacou nos serviços um modus operandi calcado na pragmática prática odontológica, plena de conflitos e contradições. Para que as diretrizes da PNSB transformem a prática em saúde bucal com novos arranjos tecnológicos no processo de trabalho, outras formas de vínculo e comprometimento devem ser almejadas. É necessário repensar a tecnologia do cuidado em saúde bucal como possibilidade da atenção com integralidade e de sua legitimação como um dos componentes da saúde em uma expressão ampliada: a da qualidade de vida.

  10. Desenvolvimento, complexo industrial da saúde e política industrial

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2006-08-01

    Full Text Available O artigo situa a questão da saúde no contexto do desenvolvimento nacional e da política industrial. Tomou-se a idéia de corte estruturalista, marxista e schumpeteriano, onde a indústria e as inovações constituem os elementos determinantes do dinamismo das economias capitalistas e de sua posição relativa na economia mundial. Todos os países que se desenvolveram e passaram a competir em melhores condições com os países avançados associaram uma indústria forte com uma base endógena de conhecimento, de aprendizado e de inovação. Todavia, na área da saúde essa visão é problemática, uma vez que os interesses empresariais se movem pela lógica econômica do lucro e não para o atendimento das necessidades da saúde. A noção de complexo industrial da saúde constitui uma tentativa e fornecer um referencial teórico que permita articular duas lógicas distintas: a sanitária e a do desenvolvimento econômico. O trabalho procurou mostrar, com base em dados de comércio exterior, como a desconsideração da lógica do desenvolvimento nas políticas de saúde levou a uma situação de vulnerabilidade econômica do setor que pode limitar os objetivos de universalidade, eqüidade e integralidade. Nesse contexto, propõe-se uma ruptura cognitiva e política com as visões antagônicas que colocam, de um lado, as necessidades da saúde e, de outro, da indústria. Um país que pretende chegar a uma condição de desenvolvimento e de independência requer, ao mesmo tempo, indústrias fortes e inovadoras, e um sistema de saúde inclusivo e universal.

  11. Perilaku Wirausaha Industri Keramik Berskala Kecil untuk Meningkatkan Daya Saing Produk di Malang

    Directory of Open Access Journals (Sweden)

    Sri Hadiati

    2008-01-01

    Full Text Available The purposes of the study was to find out the explanation of ceramic entrepreneurs’ respond to the environment factors affecting competitiveness of small scale ceramic industries (SSCIs. The environment factors are internal and external then form a strategy. The research was carried out in Malang using a survey and case study. Data were collected using questionnaire and in-depth interview from 107 SSCIs that was chosen randomly chosen from 180 registered SSCIs. Structural Equation Modeling (SEM with AMOS software was used to analyze data. The research results showed that environment factors were both directly and indirectly affecting SSCI’s competitiveness through strategy. In order to increase competitiveness then SSCIs need to empower the existing producers’ association in some aspects such as provision of raw material, pricing the products, and marketing. Training, education, and research need to be developed and improved by local government and higher education institutions. Abstract in Bahasa Indonesia: Penelitian ini bertujuan mencari penjelasan tentang perilaku wirausaha keramik terhadap faktor-faktor lingkungan yang mempengaruhi daya saing industri keramik berskala kecil di Malang. Secara spesifik penelitian ini bertujuan mempelajari pengaruh faktor internal dan eksternal terhadap strategi dan daya saing serta pengaruh strategi terhadap daya saing industri keramik berskala kecil di Malang. Faktor-faktor lingkungan tersebut dapat dikelompokkan kedalam faktor internal dan eksternal perusahaan. Penelitian diambil dari 107 industri keramik berskala kecil yang dipilih secara acak sederhana dari 180 unit usaha yang ada di Malang. Data dikumpulkan menggunakan kuesioner dan wawancara mendalam. Variabel dalam penelitian dibagi menjadi 4 kelompok yaitu, faktor lingkungan internal dan eksternal dari usaha kecil, strategi dan daya saing industri keramik berskala kecil. Data yang diperoleh selanjutnya dianalisis menggunakan Structural Equation

  12. Ações de saúde mental na Estratégia Saúde da Família: Expectativas de familiares

    Directory of Open Access Journals (Sweden)

    Marcio Wagner Camatta

    2016-06-01

    Full Text Available RESUMO Objetivo: Compreender as expectativas de familiares de usuários com transtorno mental da Estratégia Saúde da Família (ESF, em relação às ações de saúde mental. Métodos: Trata-se de uma pesquisa qualitativa, com utilização do referencial da Sociologia fenomenológica. Foram realizadas entrevistas semiestruturadas com 12 familiares de duas unidades de ESF de Porto Alegre, Rio Grande do Sul, em 2010. Utilizou-se a análise compreensiva para a interpretação das categorias concretas: ter apoio da equipe da ESF; e ter atenção da equipe da ESF. Resultados: Em essência, os familiares têm por expectativas ter um relacionamento social genuíno com a equipe da ESF para compartilharem suas vivências, servindo de suporte para superarem angústias, ansiedades e sentimentos de impotência frente às adversidades de conviver com uma pessoa com transtorno mental. Conclusão: A relação intersubjetiva é um aspecto relevante para o cuidado em saúde mental na ESF, necessitando de maiores investimentos da equipe.

  13. Ambiente, saúde e trabalho: temas geradores para ensino em saúde e segurança do trabalho no Acre, Brasil

    Directory of Open Access Journals (Sweden)

    Josina Maria Pontes Ribeiro

    Full Text Available O artigo apresenta ambiente, saúde e trabalho como temas geradores necessários à construção de uma tecnologia social para educação profissional, considerando a ergologia como perspectiva de análise, e, o diálogo, como estratégia de ensino em Saúde e Segurança no Trabalho para Agentes de Combate a Endemias em Rio Branco, Acre, Brasil. A definição dos temas geradores é resultado do diálogo entre pesquisadores de diferentes áreas, trabalhadores que atuam ou atuaram no combate às endemias, bem como de discentes e docentes do Curso Técnico em Segurança do Trabalho no Instituto Federal do Acre (IFAC, mediante exercício de atividades de ensino, pesquisa e extensão. As pesquisas histórica e documental permitiram que se estabelecessem os nexos entre os projetos de desenvolvimento que impactaram significativamente o ambiente e as relações de trabalho na saúde daí resultantes.

  14. A Motivação dos Profissionais de Saúde das Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Antônio Alves Filho

    Full Text Available Relata-se pesquisa que objetivou estudar a motivação para o trabalho dos profissionais de saúde vinculados às Unidades Básicas de Saúde do município de Natal. Compreendeu-se a motivação como um processo e aplicou-se a Teoria das Expectativas que a considera como um fenômeno processual e envolve cinco componentes: resultados do trabalho, expectativa, valên-cia, instrumentalidade e força motivacional. Entendeu-se também a motivação como um fenômeno relacionado com o contexto de trabalho e adotou-se a perspectiva psicossociológica. Aplicou-se o Inventário da Motivação e Significado do Trabalho, identificando-se os fatores que mais contribuem, bem como os que enfraquecem a força motivacional dos profissionais de saúde. Conclui-se que a maioria dos profissionais apresentou força motivacional moderada e em queda, por vivenciarem e perceberem um contexto deteriorado com condições de trabalho desfavoráveis.

  15. O olhar das representações indigenas sobre a sua saúde e a interface com o subsistema de saúde indigena

    Directory of Open Access Journals (Sweden)

    Maria Elvira TOLEDO

    2013-12-01

    Full Text Available O movimento indígena acreano tem uma trajetória de mais de 20 anos, atuando em debates locais, regionais e nacionais sobre a política de saúde indígena; em mobilizações políticas para reivindicar direitos; participando das instâncias de controle social na saúde e atuando também na gestão de projetos com financiamento não governamental ou em parceira com o governo federal, através da administração terceirizada dos Distritos Sanitários Especiais Indígena (DSEIs. Apesar disso, na primeira década da implantação do Subsistema de Saúde Indígena, muitos obstáculos tiveram que ser enfrentados pelas associações indígenas para se apropriar dos meandros da política de participação e controle social e esforços foram investidos para melhorar sua participação neste setor.

  16. Saúde Mental Positiva Ocupacional: proposta de modelo teórico para abordagem positiva da saúde mental no trabalho

    Directory of Open Access Journals (Sweden)

    Julio César Vázquez-Colunga

    Full Text Available Resumo Propõe-se um modelo teórico para a abordagem da saúde mental positiva ocupacional baseado na psicologia positiva, a psicologia ecológica, a salutogênese e o humanismo. O modelo compreende uma estrutura de seis fatores: bem-estar pessoal no trabalho, relações interpessoais positivas no trabalho, filosofia da vida laboral, empoderamento no trabalho, fortalezas pessoais no trabalho, e imersão no serviço; que é traduzido em quatro dimensões: cognitiva, socioafetiva, de comportamento e espiritual. Para fundamentar essa proposta, foi realizada uma análise dos dois principais posicionamentos referentes a saúde mental: o tradicional, predominantemente negativo, centrado na supressão ou ausência de doença, e o positivo, focado na promoção da saúde e desenvolvimento de círculos virtuosos. Derivado da análise, encontramos uma postura mista e vazios teóricos que justificam a proposta de um modelo autenticamente positivo. Finalizamos com algumas conclusões e implicações práticas de relevância para esse tema.

  17. Narrativas na formação comum de profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Angela Aparecida Capozzolo

    Full Text Available Este texto relata a experiência de formação comum que ocorre desde 2007 no campus Baixada Santista da Universidade Federal de São Paulo, no terceiro semestre de graduação, do eixo curricular trabalho em saúde. A experiência articula estudantes e docentes de diferentes áreas profissionais: educação física, fisioterapia, nutrição, psicologia e terapia ocupacional. São apresentadas as diretrizes e estratégias de organização do módulo 'Prática clínica integrada: análise de demandas e necessidades de saúde', que adota a produção de narrativas de histórias de vida e de questões de saúde de pessoas selecionadas por docentes em conjunto com as equipes da rede de serviços do município de Santos, São Paulo. As narrativas foram produzidas em encontros quinzenais dos estudantes com as pessoas acompanhadas em suas residências e de supervisões com os docentes. Realizouse análise de conteúdo de 120 relatórios de conclusão do módulo elaborados pelos estudantes nos anos de 2007 e 2008 visando identificar efeitos dessa proposta de formação. A elaboração de narrativas favoreceu aos estudantes ampliar a capacidade de escuta e a percepção da complexidade do processo saúdedoençacuidado, bem como de outros aspectos do que se tem denominado de 'clínica comum' às diversas profissões em saúde.

  18. Gestão da ergonomia para a saúde ocupacional dos gerentes hoteleiros

    Directory of Open Access Journals (Sweden)

    Cyntia Maria de Gois Leite

    2011-09-01

    Full Text Available Os estudos em saúde e segurança do trabalho estão relacionados predominantemente com trabalhadores operacionais assalariados. Há poucos estudos abordando a saúde e a segurança de gerentes de organizações, embora pareça haver um consenso de que esta categoria profissional, a quem normalmente se atribui o protagonismo pelas constantes mudanças organizacionais e pelas pressões e sobrecargas de trabalho decorrentes, sofra também com elas. Este artigo apresenta uma abordagem da Ergonomia como vertente de análise da atividade dos gerentes, especialmente de hotéis, e dos impactos na sua segurança e saúde ocupacional. Nos hotéis de grande porte são os gerentes os responsáveis pelas tomadas de decisões em favor de uma maior eficiência do sistema. Muitas vezes suas decisões entram em conflito com as decisões globais da organização, trazendo implicações e contradições nas ações de sua competência, vindo a repercutir em sua saúde, provocando doenças e sofrimento. Eles também buscam mobilizar as pessoas que trabalham na organização para mantê-las permanentemente produtivas, eficientes e eficazes, mas nem sempre esta mobilização é adequada e, portanto, provoca impactos na eficiência produtiva e na saúde, tanto dos trabalhadores quanto dos próprios gerentes.

  19. Partial activation of SA- and JA-defensive pathways in strawberry upon Colletotrichum acutatum interaction

    Directory of Open Access Journals (Sweden)

    FRANCISCO AMIL-RUIZ

    2016-07-01

    Full Text Available Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5 and FaPR10 were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen.

  20. Gestão do conhecimento em instituições de saúde portuguesas

    Directory of Open Access Journals (Sweden)

    Sofia Gaspar Cruz

    2016-06-01

    Full Text Available RESUMO A gestão do conhecimento impõe-se como uma necessidade premente para as organizações de vários setores da economia, inclusive do setor da saúde. Objetivo: avaliar a perceção dos colaboradores de instituições de saúde relativamente à gestão do conhecimento na instituição onde atuam e analisar a existência de diferenças nessa perceção, em função do modelo de gestão da instituição. Método: estudo realizado numa amostra de 671 colaboradores de dez instituições de saúde portuguesas, com diferentes modelos de gestão. Para avaliar a perceção de gestão do conhecimento, utilizamos uma escala construída a partir de itens de escalas disponíveis na literatura. Resultados: evidenciam perceção de moderada gestão do conhecimento nas instituições de saúde e diferenças estatisticamente significativas na perceção de gestão do conhecimento, em cada modelo de gestão. Conclusão: a gestão do conhecimento ocorre nas instituições de saúde, e o modelo de gestão vigente influencia a forma como elas gerenciam o seu conhecimento.