WorldWideScience

Sample records for sa sc se

  1. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  2. Two anionically derivatized scandium oxoselenates(IV): ScF[SeO3] and Sc2O2[SeO3

    Science.gov (United States)

    Greiner, Stefan; Chou, Sheng-Chun; Schleid, Thomas

    2017-02-01

    Scandium fluoride oxoselenate(IV) ScF[SeO3] and scandium oxide oxoselenate(IV) Sc2O2[SeO3] could be synthesized through solid-state reactions. ScF[SeO3] was obtained phase-pure, by reacting mixtures of Sc2O3, ScF3 and SeO2 (molar ratio: 1:1:3) together with CsBr as fluxing agent in corundum crucibles embedded into evacuated glassy silica ampoules after firing at 700 °C for seven days. Sc2O2[SeO3] first emerged as by-product during the attempts to synthesize ScCl[SeO3] following aforementioned synthesis route and could later be reproduced from appropriate Sc2O3/SeO3 mixtures. ScF[SeO3] crystallizes monoclinically in space group P21/m with a=406.43(2), b =661.09(4), c=632.35(4) pm, β=93.298(3)° and Z=2. Sc2O2[SeO3] also crystallizes in the monoclinic system, but in space group P21/n with a=786.02(6), b=527.98(4), c=1086.11(8) pm, β=108.672(3)° for Z=4. The crystal structures of both compounds are strongly influenced by the stereochemically active lone pairs of the ψ1-tetrahedral [SeO3]2- anions. They also show partial structures, where the derivatizing F- or O2- anions play an important role. For ScF[SeO3] chains of the composition 2+ ∞ 1[FSc2/2] form from connected [FSc2]5+ dumbbells, while [OSc3]7+ pyramids and [OSc4]10+ tetrahedra units are condensed to layers according to 2+ ∞ 2[O2Sc2 ] in Sc2O2[SeO3].

  3. Bien communiquer sur sa thèse, suite.

    Directory of Open Access Journals (Sweden)

    Philippe Heller

    2005-07-01

    Full Text Available Après une brève présentation sur lui-même, Edouard Paulino du Craft (Centre de recherche et d’appui pour la formation et ses technologies, qui travaille à l’ Epfl lance le débat : que signifie communiquer sur sa thèse ? Parmi le petit auditoire de doctorants présents, les questions-réponses fusent : à qui s’adresse-t-on ? Pourquoi ? Comment s’adapter à son auditoire ? Mais en fait qu’est-ce que communiquer ? Doit-on suivre forcément son plan de thèse ou ...

  4. Launching of a new product on the market and marketing management at SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available A product is deemed to be new when it is new for the host country but not for the international market.Among the reasons for launching a new product, the following could be mentioned: serving an ignored market share, meeting an unsatisfied need, adapting a domestic product for a better supervision of the product / market ratio, adapting to the short product lifecycle and challenging the competition. This paper presents the sources used for launching new products on the market, the stages of development of new products and the policy of promotion specific to SC ELECTRECORD S.A.

  5. Masculinidades e práticas de saúde: retratos da experiência de pesquisa em Florianópolis/SC Masculinities and health practices: portraits of a research experience in Florianopolis (SC, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Juracy Filgueiras Toneli

    2010-01-01

    Full Text Available Este artigo tem o objetivo de apresentar parte dos resultados da pesquisa multicêntrica "Masculinidades e Práticas de Saúde", em que foram investigados, junto à população masculina de Florianópolis (SC, os significados sobre saúde/doença e práticas de cuidados com a saúde por ela desenvolvidas. Para tal, foram realizados sete grupos focais com homens usuários dos serviços de saúde, entrevistas com os profissionais que compõem a equipe técnica de saúde sexual e reprodutiva do Hospital Universitário (HU da Universidade Federal de Santa Catarina (UFSC, bem como 260 entrevistas com homens. Investigou também, junto à equipe de profissionais do serviço (médicos, enfermeiros, psicólogos, assistentes sociais, gestores em saúde, as discursividades de gênero em relação aos cuidados com a saúde e promoção do acesso de homens aos serviços. A proposta filosófico-metodológica de Judith Butler sobre gênero inteligível, performatividade e suas implicações na constituição de sujeitos em saúde foi o vetor de análise do material empírico da pesquisa, sem perder de vista o projeto biopolítico em que estes enunciados são possíveis de serem formulados, principalmente no que se refere ao SUS e a seus princípios de universalidade, integralidade e equidade. A categoria gênero é elemento de grande importância no padrão dos riscos de saúde nos homens e na forma como estes percebem, usam e cuidam de seus corpos, tanto como possibilidade de transformação de valores como na reiteração dos vigentes.This paper aims to present partial results of the multicentered research "Masculinities and Health Practices". This research explored the meanings of health and illness among the male population in Florianopolis and the healthcare adopted by them. The research methodology was based on seven focal groups with male patients of the local health services, interviews with the professionals who take part of the sexual health and

  6. Rapid Selection of Phage Se-scFv with GPX Activity via Combination of Phage Display Antibody Library with Chemical Modification

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Glutathione peroxidase (GPX) plays an important role in scavenging reactive oxygen species. A series of catalytic antibodies with GPX activity have been generated by the authors of this study. To obtain humanized catalytic antibodies, the phage-displayed human antibody library was used to select novel antibodies by repetitive screening. Phage antibodies, scFv-B8 and scFv-H6 with the GSH-binding site, were obtained from the library by enzyme-linked immunosorbent assay(ELISA) analysis with 4 rounds of selection against their respective haptens, S-2,4-dinitriphenyl t-butyl ester(GSH-s-DNP-Bu) and S-2,4-dinitriphenyl t-hexyl ester(GSH-s-DNP-He). Nevertheless, several studies need to be conducted to determine whether scFv-B8 and scFv-H6 possess GPX activity. To enhance the speed of the selection, selenocysteine(Sec, the catalytic group of GPX) was incorporated directly into the phages, scFv-B8 and scFv-H6, by chemical mutation to form the phages Se-scFv-B8 and Se-scFv-H6. The GPX activities were found to be 3012 units/μmol and 2102 units/μmol, respectively. To improve the GPX activity of the phage Se-scFv-B8, DNA shuffling was used to construct a secondary library and another positive phage antibody scFv-B9 was screened out by another panning against GSH-s-DNP-Bu. When Sec was incorporated via chemical mutation into the phage antibody scFv-B9, its GPX activity reached 3560 units/μmol, which is 1.17-fold higher than the phage antibody Se-scFv-B8and almost approached the order of magnitude of native GPX. The rapid selection is the prerequisite for generating humanized Se-scFv with GPX activity.

  7. Crystal structure of Sc1.91In1.39Mo15Se19, containing Mo6 and Mo9 clusters

    Directory of Open Access Journals (Sweden)

    Patrick Gougeon

    2015-07-01

    Full Text Available The structure of scandium indium pentadecamolybdenum nonadecaselenide, Sc1.91In1.39Mo15Se19, is isotypic with In2.9Mo15Se19 [Grüttner et al. (1979. Acta Cryst. B35, 285–292]. It is characterized by two cluster units Mo6Sei8Sea6 and Mo9Sei11Sea6 (where i represents inner and a apical atoms that are present in a 1:1 ratio. The cluster units are centered at Wyckoff positions 2b and 2c and have point-group symmetry -3 and -6, respectively. The clusters are interconnected through additional Mo—Se bonds. Sc—Se and In—Se bonds complete the structural set-up. In the title compound, the Sc3+ cations replace the trivalent indium atoms present in In2.9Mo15Se19, and a deficiency is observed at the monovalent indium site. One Mo, one Se and the Sc atom are situated on mirror planes, whereas two other Se atoms and the In atom are situated on threefold rotation axes.

  8. O enfermeiro de unidade básica de saúde e o usuário de drogas: um estudo em Biguaçú-SC El enfermeros de unidades de salud del primer nivel y el usuario de droga: un estudio en Biguaçú-SC The nurse from health unit and the drug user: one analysis in Biguaçu/SC

    Directory of Open Access Journals (Sweden)

    Jonas Salomão Spricigo

    2004-04-01

    Full Text Available O presente estudo buscou conhecer a opinião do enfermeiro sobre usuários de drogas, identificar de qual abordagem a opinião dos enfermeiros se aproxima e levantar que conhecimentos consideram essenciais para o cuidado de enfermagem. As informações foram obtidas através de entrevista semi-estruturada com sete enfermeiros lotados em Unidades Básicas de Saúde (UBS do município de Biguaçú-SC, e submetidas à técnica de análise de conteúdo de Bardin. A análise mostra que as opiniões concentram-se na abordagem médica e sócio-cultural. No entanto, alguns extratos das falas podem estar indicando a compreensão de que o processo de globalização possa estar contribuindo para a "desregulamentação" do uso de drogas, aproximando-se da abordagem Crítico-Holístico de Saúde Internacional.El presente estudo buscó conocer la opinión de los enfermeros acerca de los usuarios de drogas: identificar a cual abordaje la opinión de los enfermeros se acerca y conocer que conocimentos consideran esenciales para el cuidado de enfermería. Las informaciones fueron obtenidas por medio de una entrevista semi-estructurada con siete enfermeros de Unidades de Salud del primer nivel, del Município de Biguaçú-SC, y los resultados fueran analisados atraves del metodo de análisis de contenido de Bardin. Los resultados demuestran que las opiniones se concetran en la abordaje médica y socio-cultural. Todavia, algunos discursos pueden estar indicando una compreensión de que el proceso de globalización tiene contribuido para la "desregulamentación" del uso de drogas, en una aproximación de la abordaje crítico-holístico de la salud internacional.The present study investigates the opinion of healthcare professionals (nurses toward drug users; to identify individual approaches and to know what knowledge they consider essential to the nursing care. The information was collected by interviewing 7 nurses from health units in the city of Biguacu -SC

  9. Tornar-se obeso na adolescência pode trazer consequências à saúde mental?

    Directory of Open Access Journals (Sweden)

    Maria Cecília Formoso Assunção

    2013-09-01

    Full Text Available O estudo avaliou a associação entre trajetória de obesidade e dificuldades emocionais e comportamentais em adolescentes. Foram estudados 4.325 jovens, aos 11 e 15 anos de idade, pertencentes à coorte de nascimentos de 1993 de Pelo-tas, Rio Grande do Sul, Brasil. Informações sobre índice de massa corporal (IMC, avaliação materna da saúde emocional e comportamental do adolescente (Strengths and Difficulties Questionnaire - SDQ e características sociodemográficas e comportamentais foram utilizadas. As análises, estratificadas por sexo, foram conduzidas por meio de regressão linear simples e múltipla. A trajetória de obesidade mostrou associação com o escore total do SDQ, nas análises ajustadas, apenas entre os meninos. Entre esses, tornar-se obeso no período esteve relacionado com maior escore na subescala de problemas de relacionamento com os colegas. Diante do conhecimento atual sobre as implicações futuras da obesidade na saúde mental e em se tratando de adolescentes, sugere-se que estudos que avaliem as diferenças de gênero na adolescência possam contribuir para o entendimento da associação encontrada.

  10. Custos na prestação de serviço público de saúde do município de São João do Oeste - SC: um estudo empírico

    Directory of Open Access Journals (Sweden)

    Marino Luiz Eyerkaufer

    2008-03-01

    Full Text Available Objetiva-se identificar o custo da prestação de serviço público do transporte depacientes para fora do Município da Secretaria da Saúde de São João do Oeste – SC visando concluir pela sua manutenção sob responsabilidade direta do município, ou então, pela sua terceirização. Trata-se de um estudo teórico e empírico, que se caracteriza como descritivo e quantitativo. Por meio de coleta documental, chegou-se aos dados numéricos municipais, como viagens realizadas, pacientes transportados, veículos utilizados neste transporte e mão-de-obra direta e indireta, envolvidas neste tipo de prestação de serviço nos meses de abril, maio, junho e julho de 2006. Aplicou-se questionário às empresas do setor, interessadas em prestar o serviço de forma terceirizada. Para atender ao objetivo proposto e dar sustentação ao tema, buscou-se na literatura conceitos de: contabilidade, contabilidade de custo, análise de custos, prestação de serviços, sistemas de custo, métodos de custeio, contabilidade pública, serviços públicos, terceirização, terceirização no setor público e saúde pública. Conclui-se, por meio da pesquisa, que o custo da prestação do serviço público de transporte de pacientes da Secretaria Municipal de Saúde de São João do Oeste - SC é elevado, porém, está abaixo do custo orçado para a terceirização, devendo a municipalidade optar pela manutenção do serviço.

  11. Promoção de saúde e qualidade de vida entre mães de pré-adolescentes: um estudo etnográfico enfocado em Timbó/SC-Brasil Promoción de salud y calidad de vida entre madres de preadolescentes: un estudio etnografico enfocado en Timbó/SC-Brasil Health promotion and quality of life among mothers of preadolescents: a focused ethnography study in Timbó/SC-Brazil

    Directory of Open Access Journals (Sweden)

    Vera Radünz

    2005-12-01

    Full Text Available Este é um estudo etnográfico enfocado, realizado com 10 mães de pré-adolescentes da OASE (Ordem Auxiliadora Senhoras Evangélicas em Timbó, Santa Catarina, Brasil. O objetivo foi descrever variações em padrões dos fenômenos promoção de saúde, qualidade de vida e comportamento de risco a partir das perspectivas das mães, explorando como influenciam seus filhos, protegendo-os de comportamento de risco tais como álcool, fumo, outras drogas e violência. Utilizamos entrevista semi-estruturada, observação participante, diário de campo, genograma e fotografias. Os dados foram analisados segundo Bardin e os resultados agrupados em 4 categorias: mães encaram sua função como desafio; ser saudável como condição de qualidade de vida; impedimentos para atingir qualidade de vida; práticas de promoção à saúde para proteger filhos de comportamento de risco. O estudo evidenciou a crença das mães como participantes na promoção de saúde, o que poderá orientar a elaboração de políticas de saúde e encorajar mudanças de comportamento.Estudio etnográfico enfocado, realizado con 10 madres de preadolescentes que participan en OASE (grupo de ayuda de mujeres evangélicas en Timbó, SC/Brasil. El objetivo fue describir las variaciones sobre los patrones de promoción de la salud, calidad de vida y comportamiento de riesgo bajo las perspectivas de las madres, explorando como estas influyen en sus hijos y los protegen de comportamientos de riesgo como alcohol, cigarro, otras drogas y violencia. Se utilizaron: entrevista semiestructurada, observación participante, diario de campo, genograma y fotografías. Los datos fueron analizados con base en Bardin y los resultados formaron cuatro categorías: madres encaran su función como un desafío; ser saludable como condición de calidad de vida; impedimentos para alcanzar calidad de vida; prácticas de promoción de salud. El estudio evidenció la creencia de las madres como participantes

  12. La mise en ouvre de la réplique d'Ekain et de sa scénographie : Mon hommage à Jesús Altuna

    Directory of Open Access Journals (Sweden)

    Renaud Sanson

    2005-01-01

    Full Text Available Réflexions à propos de la mise en oeuvre de la réplique de la Grotte d’Ekain:* Une pratique innovante du fait pariétal et l’invention d’une technologie appliquée spécifique.* Lé création d’une scénographie au service de la révélation de l’Art d’Ekain alliant émotion et connaissance. Respect de l’oeuvre originale et du visiteurs : une dimension éthique de l’art de la réplique.

  13. Radiochemical neutron activation analysis for 36 elements in geological material: Au, Ag, Bi, Br, Cd, Cs, Ge, In, Ir, Ni, Os, Pd, Rb, Re, Sb, Se, Sn, Te, Tl, U, and Zn as well as Sc, Y, and REE

    Energy Technology Data Exchange (ETDEWEB)

    Anders, E; Wolf, R; Morgan, J W; Ebihara, M; Woodrow, A B; Janssens, M J; Hertogen, J

    1988-01-01

    In lunar and terrestrial rocks and in meteorites, the radiochemical neutron activation method decribed here enables determination of the 21 trace and ultratrace elements Ag, Au, Bi, Br, Cd, Cs, Ga, Ge, In, Ir, Ni, Os, Pd, Rb, Re, Sb, Se, Te, Tl, U, Zn, as well as 13 rare earth elements (REE), Sc and Y. Materials, techniques and procedures are discussed. 81 refs.

  14. A visita domiciliar na estratégia de saúde da família: os desafios de se mover no território

    Directory of Open Access Journals (Sweden)

    Marcela Silva da Cunha

    2013-03-01

    Full Text Available Foram analisados os processos de trabalho de três equipes da ESF no município de Nova Iguaçu, Rio de Janeiro, Brasil, bem como a gerência do cuidado, tomando as visitas domiciliares como foco da análise. Optou-se pelo estudo de caso, selecionado em um contexto complexo, com pessoas em situação de fragilidade, incerteza e sofrimento. Resultados da pesquisa destacam o improviso dos profissionais frente à precariedade das condições de trabalho e aos desafios impostos cotidianamente para a realização das visitas e para lidar com demandas que emergem no território. Embora a visita domiciliar se apresente como instrumento potente para o planejamento das ações de saúde e a reorientação das práticas, ainda encontra importantes entraves para sua consolidação, especialmente por exigir grande disponibilidade interna do profissional de saúde para lidar com o inesperado e o diverso.

  15. Folhas voláteis, papéis manuscritos: o pelotão de saúde no jornal infantil Pétalas (Colégio Coração de Jesus - Florianópolis/SC, 1945-1952 - Volatile sheets, manuscript papers: the platoon of health in petals childish journal

    Directory of Open Access Journals (Sweden)

    Maria Teresa Santos Cunha, Brasil

    2013-04-01

    Full Text Available O jornal Pétalas Infantil era uma produção manuscrita, feita em folhas avulsas, realizada pelas alunas do curso primário do Colégio Coração de Jesus, uma instituição religiosa e feminina de Florianópolis/SC e cujos exemplares, entre 1945 e 1952, foram conservados em um acervo pessoal. Considerado material ordinário, o texto deste estudo centra-se na análise dos artigos e comentários que expressavam preceitos veiculados pelo Pelotão de Saúde, uma associação complementar da escola, legitimada por lei e cujo propósito era auxiliar na criação e manutenção de princípios higiênicos como integrantes da cultura escolar do período. O artigo vincula-se ao campo de pesquisa da História da Educação e da cultura escrita entendidas, ambas, como produções discursivas e escolares de um determinado tempo e lugar que, tanto pelos suportes em que se apresentam à leitura, como pelos preceitos higienistas e cívicos que punham em circulação, permitem pensar a importância desse material na construção de uma memória para o reconhecimento de diferentes práticas, costumes, rituais, ações que integravam o ambiente escolar do período em pauta.Palavras-chave: jornal infantil, pelotão de saúde, higiene e cultura escolar. VOLATILE SHEETS, MANUSCRIPT PAPERS: THE PLATOON OF HEALTH IN PETALS CHILDISH JOURNAL (COLÉGIO CORAÇÃO DE JESUS - FLORIANÓPOLIS/SC, 1945-1952  AbstractPetals Childish journal was a handwritten production, made in single sheets of paper, held by the students of the primary school Coração de Jesus, a religious institution for girls in Florianópolis/SC and whose exemplary, between 1946 and 1952, were kept in a personal collection. Considered ordinary material this study focused on the analysis of the articles and comments that expressed precepts conveyed by the Pelotão de Saúde (Platoon of Health, a complementary association of the school, legitimized by law, and whose purpose was to assist in the

  16. O que vem se falando por aí em competências no ensino da promoção da saúde na formação do enfermeiro?

    Directory of Open Access Journals (Sweden)

    Kênia Lara Silva

    2015-12-01

    Full Text Available O desenvolvimento de competências na formação dos profissionais de saúde tem sido discutido na literatura científica como forma de assegurar serviços de qualidade e foi tema recente de publicações importantes no cenário internacional. No entanto, o Brasil apresenta poucas experiências e produções sobre o tema. O estudo teve como objetivo analisar como são configuradas as competências para a promoção da saúde na formação do enfermeiro. Trata‑se de revisão integrativa da literatura, na qual foram incluídos oito artigos, teses e dissertações publicados a partir do ano 2000 em inglês, espanhol e português. Os descritores utilizados para a busca foram: “promoção da saúde”, “educação baseada em competências” e “competência profissional”. A análise permitiu revelar as seguintes categorias temáticas: definição de competências, competências e promoção da saúde e ensino das competências em promoção da saúde. Os achados mostram que a maior parte da literatura é de origem internacional. A maioria guarda semelhança com as competências do CompHP e Consenso de Galway e apresentam a definição de competência como a combinação de três domínios: atitude, conhecimento e habilidades. A promoção da saúde é abordada em disciplinas como saúde pública, saúde da população e políticas de saúde. Evidencia‑se que alunos vivenciam a experiência da promoção da saúde na comunidade. Ademais, a abordagem da promoção da saúde nos anos finais do curso é indicada como mais proveitosa que no início, pela maturidade (clínica e política dos estudantes.

  17. Excesso de peso e qualidade de vida relacionada à saúde em adolescentes de Florianópolis, SC Exceso de peso y calidad de vida relacionada con la salud en adolescentes de Florianópolis, Sur de Brasil Overweight and health-related quality of life in adolescents of Florianópolis, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Nádia Kunkel

    2009-04-01

    Full Text Available OBJETIVO: Avaliar a qualidade de vida relacionada à saúde de adolescentes e sua associação com o excesso de peso. MÉTODOS: Estudo transversal com 467 adolescentes de 15 a 18 anos de idade de uma escola pública de Florianópolis, SC, e de seus respectivos pais, realizado em 2007. Sobrepeso e obesidade foram definidos pelo índice de massa corporal. A combinação de sobrepeso e obesidade foi considerada como excesso de peso. A qualidade de vida relacionada à saúde foi avaliada por meio do questionário sobre qualidade de vida pediátrica PedsQL 4.0, versões adolescente e pais. Análises dos dados incluíram estatística descritiva e regressão logística com estimação de razões de chances brutas e ajustadas. RESULTADOS: A taxa de resposta entre adolescentes foi de 99,4% e entre os pais 53,4%. As prevalências de sobrepeso e obesidade foram de 12,2% e 3,6%, respectivamente. O grupo com excesso de peso obteve menores escores de qualidade de vida que o grupo sem excesso de peso, exceto para o domínio emocional nos adolescentes e na saúde psicossocial para os pais. Após o ajuste, a chance de um adolescente com excesso de peso ter baixa qualidade de vida foi 3,54 vezes (IC 95% 1,94;6,47 maior que um adolescente sem excesso de peso. Adolescentes do sexo feminino apresentaram escores mais baixos de qualidade de vida. CONCLUSÕES: A qualidade de vida relacionada à saúde foi significativamente mais baixa em adolescentes com excesso de peso. Medidas dirigidas ao controle de peso na população adolescente e instrumentos de avaliação de qualidade de vida constituem-se importantes aliados para um melhor e mais completo entendimento deste importante problema de saúde pública.OBJETIVO: Evaluar la calidad de vida relacionada con la salud de adolescentes y su asociación con exceso de peso. MÉTODOS: Estudio transversal con 467 adolescentes de 15 a 18 años de edad de una escuela pública de Florianópolis, Sur de Brasil, y de sus

  18. Water SA

    African Journals Online (AJOL)

    Journal Home > Vol 43, No 2 (2017) ... WaterSA publishes refereed, original work in all branches of water science, technology and engineering. ... Water SA is the WRC's accredited scientific journal which contains original research articles ... via linearized calibration method in the upstream of Huaihe River Basin, China ...

  19. Prevalência e fatores associados à infecção pelo Mycobacterium tuberculosis entre agentes comunitários de saúde no Brasil, usando-se a prova tuberculínica

    Directory of Open Access Journals (Sweden)

    Wesley Pereira Rogerio

    2015-10-01

    Full Text Available Resumo Este artigo tem por objetivo determinar a prevalência e os fatores associados à infecção latente pelo Mycobacterium tuberculosis entre agentes comunitários de saúde (ACS, usando dois pontos de corte da prova tuberculínica 5mm e 10mm. Trata-se de estudo transversal, com dados coletados sobre sexo, idade, cicatriz de BCG, prova tuberculínica (PT anterior, tempo que trabalha na profissão de ACS, atuar em unidade básica de saúde (UBS, ter tido contato intradomiciliar com tuberculose (TB, usar álcool, ser fumante e apresentar comorbidades. Para controle de variáveis de confusão e estimativa da medida de efeito (OR, foi empregada a regressão logística. Aplicou-se PT, com leitura após 48-72 horas. As prevalências foram de 57,88% e 37,3%, respectivamente, para 5mm e 10mm. Manteve-se associada à positividade para o ponto de corte de 10mm a condição de trabalhar em UBS com Programa de Controle de Tuberculose (PCT implementado e já ter tido contato intradomiciliar com TB. Já para o ponto de corte de 5mm, trabalhar em UBS com PCT e implementado. São necessárias ações de conscientização nos municípios e fortalecimento das ações de educação permanente sobre a temática.

  20. Isolation of eukaryotic ribosomal proteins. Purification and characterization of the 40 S ribosomal subunit proteins Sa, Sc, S3a, S3b, S5', S9, S10, S11, S12, S14, S15, S15', S16, S17, S18, S19, S20, S21, S26, S27', and S29.

    Science.gov (United States)

    Collatz, E; Ulbrich, N; Tsurugi, K; Lightfoot, H N; MacKinlay, W; Lin, A; Wool, I G

    1977-12-25

    The proteins of the small subunit of rat liver ribosomes were separated into five main groups by stepwise elution from carboxymethylcellulose with LiCl at pH 6.5. Twenty-one proteins (Sa, Sc, S3a, S3b, S5', S9, S10, S11, S12, S14, S15, S15', S16, S17, S18, S19, S20, S21, S26, S27', and S29) were isolated from three groups (A40, C40, and D40) by ion exchange chromatography on DEAE-cellulose, carboxymethylcellulose, and phosphocellulose and by filtration through Sephadex. The amount of protein obtained varied from 0.1 to 11 mg. Six of the proteins (S5', S10, S11, S18, S19, and S27') had no detectable contamination; the impurities in the others were no greater than 9%. The molecular weight of the proteins was estimated by polyacrylamide gel electrophoresis in sodium dodecyl sulfate; the amino acid composition was determined.

  1. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  2. Lingon sa Iskolarsyip sa Dulaan (1948-2007 Looking Back on Theater Scholarship (1948-2007

    Directory of Open Access Journals (Sweden)

    Apolonio B. Chua

    2012-12-01

    Full Text Available From 1948 to 2007, the academic community produced about a hundred titles of theses and dissertations on drama and theater, or made use of data from drama and theater for larger spheres of studies. The current article looked into identifying trends and points of emphasis, as the researches and studies progressed through roughly half a century of research production in the academic setting. Inductive in approach and tentative and exploratory in its analysis, the study identified four trends and points of emphasis in research production. In the fifties and sixties, the emphasis was more on studying the play text or drama; studies veered towards a literary reading and orientation. Eventually, this trend gave way to studying the larger phenomenon of mounting, and the mise en scéne and the spectator became additional units of concern for research. Studies began to have sections on props, costumes, and staging techniques. In the eighties, a larger concern for looking at theater as social production followed. Participant observation, field work and ethnography gave equal emphasis on the social context of theater. Marxism and other perspectives from the social sciences framed theater studies then; correlations between theater and society became useful. Towards the last decade of the century, theater studies aimed at a more conceptual approach, emphasizing core concepts like panata and other related or equivalent terms, elevating and defining the study of theater as a study of culture itself. Gamit ang mahigit sa sandaang tesis at disertasyon hinggil sa dula at dulaan o sinasangkot ang mga ito na lumabas sa akademya mula 1948 hanggang 2007, kapwa sa Unibersidad ng Pilipinas at sa iba pa, nilayon ng “Lingon sa Iskolarsyip sa Dulaan (1948-2007” na pulsuhan ang pangkalahatang daloy, tutok, tunguhin o kalakaran sa pagdadala ng mga pag-aaral. Panimula at exploratory sa inductive nitong lapat, nakatukoy ang pag-aaral ng apat na sapit o tutok sa daloy ng

  3. Spectral response of CuIn{sub 1-x}Ga{sub x}Se{sub 2} heterodiodes operated at constant V{sub OC} and constant I{sub SC} compared with traditionally recorded spectral quantum yield

    Energy Technology Data Exchange (ETDEWEB)

    Burdorf, Sven; Brueggemann, Rudolf; Bauer, Gottfried Heinrich [Institute of Physics, Carl von Ossietzky University Oldenburg (Germany)

    2009-07-01

    Traditional spectral response experiments in solar cells, such as quantum yields show the dependence of the excess carrier contribution and respective recombination on the depth of the device in terms of the profile of the optical generation. However, this depth information is masked by the condition of current continuity that is met by contributions of minority as well as majority carriers across the entire depth of the device and commonly the information on local properties is not reflected straightforwardly. In our approach - analogously to the concept of the constant photocurrent method (CPM) - we have adjusted either constant V{sub OC} (c-V{sub oc}) or I{sub SC} (c-I{sub sc}) by recording the spectral photon fluxes necessary for these conditions. In particular in V{sub oc} operation excess carriers recombine exclusively within the device and thus the signal is more sensitive against recombination. Our results of the c-V{sub oc} and c-I{sub sc} experiments for CIGSe-heterodiodes show significant differences particularly in the short-wavelength regimes. The comparison of experimental results with numerical modeling shows that this difference is growing larger with increasing interface recombination.

  4. Aspectos ultrassonográficos associados à morbidade de formas clínicas crônicas de esquistossomose mansônica, utilizando-se protocolo proposto pela Organização Mundial da Saúde

    Directory of Open Access Journals (Sweden)

    Daniel Alvarenga Fernandes

    2013-02-01

    Full Text Available OBJETIVO: Avaliar aspectos ultrassonográficos associados à morbidade em pacientes com formas clínicas crônicas de esquistossomose mansônica, utilizando-se protocolo proposto pela Organização Mundial da Saúde (OMS. MATERIAIS E MÉTODOS: Foram avaliadas duas populações distintas: a área endêmica e b institucional terciária, com histopatológico confirmando fibrose. Critérios de inclusão: diagnóstico confirmado por parasitológico de fezes para Schistosoma mansoni (método Kato-Katz. Critérios de exclusão: sorologia positiva para HIV, HTLV-1, VHB ou VHC. Foi utilizado protocolo ultrassonográfico de Niamey, proposto pela OMS. RESULTADOS: Avaliando-se isoladamente as medidas dos espaços periportais, estas se mostraram sem alterações em 21% dos indivíduos com doença avançada da instituição terciária. Utilizando-se todos os parâmetros do protocolo, 100% dos indivíduos da instituição terciária, com forma grave da doença, apresentaram fibrose periportal avançada. Em pacientes hepatoesplênicos da área endêmica não se identificou fibrose à ultrassonografia. CONCLUSÃO: O protocolo ultrassonográfico proposto pela OMS detecta fibrose periportal avançada nos pacientes com forma grave da doença, com maior sensibilidade do que a medida do espaço periportal isoladamente. A complexidade de identificação das fases iniciais da fibrose periportal, em áreas endêmicas, pela ultrassonografia, pode suscitar o campo da complementação diagnóstica e a continuidade do aprimoramento dos protocolos ultrassonográficos nestas áreas.

  5. Propuesta de implementación de un plan de retribución variable para la Empresa Buenavista Constructora y Promotora S.A

    OpenAIRE

    Mejía Pineda, Diana Lucía

    2013-01-01

    En el presente proyecto se presenta una propuesta de remuneración variable para la compañía Buenavista Constructora y Promotora S.A. que pretende incrementar el compromiso de los trabajadores para una mayor eficiencia operativa y alcanzar los objetivos trazados y el máximo desempeño. De esta manera, con base en la implementación que se hizo en el 2012 del Balance Score Card se lleva a cabo una matriz que cruza todos los cargos de la empresa con los indicadores establecidos en dicho Balance Sc...

  6. Infestação pelo mosquito Aedes aegypti (Diptera: Culicidae) na cidade de Chapecó – SC

    OpenAIRE

    Lutinski, Junir Antonio

    2013-01-01

    http://dx.doi.org/10.5007/2175-7925.2013v26n2p143 A dengue se tornou um problema de saúde pública e vem causando preocupação aos profissionais de saúde. Este estudo visou a avaliar os fatores condicionantes para a ocorrência de dengue na cidade de Chapecó – SC. Foram analisadas as informações disponíveis no Sistema de Informações de Febre Amarela e Dengue (SISFAD) e foi realizada uma pesquisa a partir de um questionário semiestruturado aplicado à população. As análises indicam a associação da...

  7. Construction of multiform scFv antibodies using linker peptide

    Institute of Scientific and Technical Information of China (English)

    Shihua Wang; Cengjie Zheng; Ying Liu; Huirong Zheng; Zonghua Wang

    2008-01-01

    Multiform single chain variable fragments (acFvs) including different length linker scFvs and bispecific seFv were constructed. The linker lengths of 0, 3, 5, 8, 12, and 15 amino acids between VH and VL of antideoxynivalenol (anti-DON) scFv were used to analyze the affinities of scFvs. The affinity constants of these scFvs increased when the linker was lower than 12 amino acids. The affinity constant would not change when the linker was longer than 12 amino acids. Fusion gene of anti-DON seFv and antizearalenone (anti-ZEN) scFv was also constructed through eormection by a short peptide tinker DNA to express a bispecific scFv. The affinity constants assay showed that the two scFvs of fusion bispecific scFv remained their own affinity compared to their parental scFvs. Competitive direct enzyme linked immunosorbent assay was used to detect DON and ZEN in contaminated wheat (Triticum aestivum L.) samples, and the results indicated that this bispecifie acFv was applicable in DON and ZEN detection. This work confirmed that bispecific scFv could be successfully obtained, and might also have an application in diagnosing fungal infection, and breeding transgertic plants.

  8. Planejamento em Saúde

    Directory of Open Access Journals (Sweden)

    Antonio José Costa CARDOSO

    2014-03-01

    Full Text Available Esse texto pretendeu subsidiar aula sobre Planejamento e Avaliação em Saúde para os Analistas Técnicos de Políticas Sociais lotados no Ministério da Saúde (MS, na perspectiva de promover uma maior compreensão dos antecedentes históricos do planejamento em saúde no Brasil e na América Latina, do referencial teórico metodológico do planejamento estratégico e participativo, e refletir sobre os avanços e desafios que se apresentam no atual contexto de construção do Sistema Único de Saúde (SUS. Neste sentido, foi estruturado na perspectiva de responder a três questões orientadoras: 1 Como tem se dado esse processo de coordenação do Planejamento Estratégico Nacional no âmbito do SUS, em cooperação técnica com os Estados, Municípios e Distrito Federal? 2 Quais são as tecnologias de gestão e planejamento em saúde adotadas pelo MS para conduzir esses processos de forma integrada? 3 Como se dá o gerenciamento das ações no MS? Como os planos, projetos e programas são monitorados pelas equipes responsáveis?

  9. Reformas da gestão na saúde: desafios que se colocam aos enfermeiros Reformas en la gestión de la salud: retos para los enfermeros Health management reforms: challenges faced by nurses

    Directory of Open Access Journals (Sweden)

    Manuela Frederico-Ferreira

    2012-12-01

    Full Text Available Com o intuito de tornar a Administração Pública mais eficiente emergiu um novo modelo de gestão que se refletiu nos serviços de saúde e, consequentemente, nos enfermeiros. Assim, pretendeu-se conhecer quais os desafios, considerados pelos enfermeiros, que se colocam à profissão de Enfermagem perante estas mudanças. Este estudo é do tipo descritivo, com o recurso a técnicas de análise qualitativa, realizado a partir de um questionário auto preenchido. As respostas à questão em estudo foram analisadas através do programa NVivo. Da análise emergiram três categorias centrais designadas de: valorização da profissão; carreira de enfermagem; e formação e investigação. Os Enfermeiros consideram que a profissão não é valorizada ou reconhecida, além disso, referem que as alterações na carreira de enfermagem, advindas da Nova Gestão Pública, não se adequam à prática e impossibilitam a progressão e a remuneração justa. Os participantes realçam que é caminhando para a autonomia e construção do seu próprio corpo de conhecimentos que a Enfermagem poderá enfrentar estes desafios. Considera-se relevante a continuação da realização de estudos que abordem o impacto das reformas nos enfermeiros, incluindo diferentes variáveis. É igualmente relevante que estes resultados sejam tidos em conta pelos gestores e responsáveis.Con el fin de hacer que la administración pública sea más eficiente ha surgido un nuevo modelo de gestión que se refleja en los servicios de salud y por tanto lo en los enfermeros. En este marco, nos proponemos saber cuáles son los desafíos a los que los enfermeros consideran que se va a enfrentar la enfermería, delante de estos cambios. Se trata de un estudio descriptivo, que cuenta con el uso de técnicas de análisis cualitativo, realizado a partir de un cuestionario rellenado por los encuestados. Las respuestas a la cuestión objeto de estudio fueron analizadas con el programa de NVivo

  10. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  11. SC2 dee

    CERN Multimedia

    1974-01-01

    Checking the positioning of the dee before its introduction into the vacuum chamber of SC2. The dee is mounted on a large cover plate which also carries the dee liner and the pump manifold. The dummy dee is fixed to the pole faces within the vacuum chamber.

  12. Saúde mental na atenção básica: como se configura a produção do conhecimento no Brasil Salud mental en la atención primaria: cómo se configura la producción del conocimiento en Brasil Mental health in primary care: how to set up knowledge production in Brazil

    Directory of Open Access Journals (Sweden)

    Lisnéia Fabiani Bock

    2011-12-01

    Full Text Available Este trabalho busca, através da revisão integrativa da literatura, identificar a produção científica brasileira em saúde mental na atenção básica, divulgada nas bases de dados Latino-Americanas. O levantamento bibliográfico abrangeu as publicações nacionais de 2001 a 2008, por meio da busca na BVS (Biblioteca Virtual de Saúde, nas bases de dados LILACS (Literatura Latino-Americana e do Caribe em Ciências da Saúde e BDENF (Base de Dados Bibliográficos Especializada na Área de Enfermagem do Brasil, consideradas como as principais bases de dados das ciências da saúde em geral e enfermagem brasileira. A amostra foi composta por 42 artigos, submetidos a análise descritiva. Os resultados apontam a região Sudeste com maior ocorrência de produção em contraste com a região Norte, na qual não foi registado nenhum estudo divulgado nas bases investigadas. As revistas de saúde em geral e saúde pública em particular, divulgaram maior número de estudos em saúde mental na atenção básica, seguidas das revistas especializadas. Dos estudos, 48% eram pesquisas originais, apresentando resultados de teses e dissertações. Refletimos sobre a necessidade de que as produções apresentem, de forma mais explícita e detalhada, o delineamento dos estudos, principalmente, na descrição dos objetivos e etapas metodológicas.Este trabajo procura, a través de la revisión integrativa de la literatura, identificar la producción científica brasileña en salud mental en la atención primaria, divulgada en las bases de datos Latinoamericanas. El levantamiento bibliográfico incluyó las publicaciones nacionales de 2001 a 2008, por medio de la búsqueda en la BVS (Biblioteca Virtual de Salud, en las bases de datos de LILACS (Literatura Latinoamericana y del Caribe en Ciencias de la Salud y BDENF (Base de Datos Bibliográficos Especializada en el Área de la Enfermería en Brasil, consideradas como siendo las principales bases de datos de las

  13. Cerditos Company S.A.

    OpenAIRE

    2010-01-01

    Esta idea de negocio consiste en la adecuación de una granja, en la cual se desarrollará el proceso de levante y comercialización de carne de cerdo en pie o en canal. Cerditos Company S.A. es una empresa que busca la calidad y el buen servicio, brindando al consumidor garantías de la carne que está consumiendo. En Colombia el mercado ha sido poco explotado comparado con otros países como Chile o Europa, donde el consumo es muy significativo, Cerditos Company S.A. busca aumentar el cons...

  14. Homens não se cuidam. Isso procede?: práticas discursivas sobre o cuidado com a saúde por homens de três gerações no contexto familiar

    OpenAIRE

    Conejo, Simone Peixoto

    2014-01-01

    Esta pesquisa aborda a noção de cuidado em sua articulação com a saúde dos homens. Busca entender essas noções nos diálogos intrafamiliares à luz dos repertórios que circulam nas políticas de saúde atuais e no tempo longo da divisão de tarefas entre homens e mulheres no contexto familiar, por meio do olhar direcionado pela psicologia social crítica. Para obtenção de informações utilizamos entrevistas grupais semiestruturadas e genogramas com três famílias, cada grupo formado por avô, pai e fi...

  15. Chevaliers de la scène à l’écran

    Directory of Open Access Journals (Sweden)

    Sandra Gorgievski

    2012-08-01

    Full Text Available Le metteur en scène et acteur français Denis Llorca a dirigé le Centre dramatique national de Franche-Comté (1982-1991, avec lequel il a monté d’audacieux spectacles au texte dense, à la durée inhabituelle pour le spectateur moderne : Kings (1978 d’après Shakespeare [dix heures] ; Eux, les possédés (1982 d’après Dostoïevski [huit heures], ou encore Quatre Saisons pour les Chevaliers de la Table Ronde (1989 d’après la légende arthurienne [12 heures]. Avec sa propre compagnie, il a ensuite porté à la scène un projet de sept spectacles s’inspirant des mystères médiévaux, avec des textes empruntés à la Torah, aux Évangiles et au Coran, où le sublime se mêle au grotesque. Dans cet entretien, le réalisateur revient sur ses multiples visions du Moyen Âge dans sa recréation du mythe arthurien au théâtre, mais aussi à l’écran, dans le film qu’il a tiré de la pièce: Les Chevaliers de la Table Ronde (1990 avec Maria Casarès, Alain Cuny et Michel Vitold.

  16. Elaboración de una estrategia de inversión a corto plazo del Banco I.M. S.A., mediante el análisis y evaluación de instrumentos financieros internacionales cuya calificación se ajuste a lo solicitado en el marco regulatorio y permita generar una rentabilidad del portafolio de inversión

    OpenAIRE

    Alvarado Valverde, Alejandro

    2016-01-01

    Universidad de Costa Rica. Posgrado en Administración y Dirección de Empresas. Maestría Profesional en Administración y Dirección de Empresas con énfasis en Finanzas, 2016 El presente trabajo corresponde a la elaboración de una estrategia de inversión a corto plazo del Banco I.M. S.A. mediante el análisis y evaluación de instrumentos financieros internacionales cuya calificación se ajuste a lo solicitado en el marco regulatorio y que permita generar una rentabilidad del portafolio de inver...

  17. Aging of Al-0,3 at. % Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Ber, L.B.; Bykov, L.S.; Toropova, L.S.; Anastas' eva, G.K. (AN SSSR, Moscow. Inst. Metallurgii)

    1984-06-01

    Method of measuring electric conductivity, hardness and yield limit was used to study the kinetics of aging of Al-0.3 at.%Sc alloy in 20-450 deg c range. It was established by X-ray methods of monocrystal investigation and diffraction electron microscopy that coherent precipitations of equilibrium ScAl/sub 3/ pha se with li/sub 2/ type structure and 0.41 nm lattice parameter represent the product of decomposition of supersaturated solid solution. Characteristic features and the kinetics of ScAl/sub 3/ phase particle growth were studied by the electron microscopic method. The activation energy of scandium and aluminium diffusion equal to 3.81 MJ/kg was determined. The analysis of deformation hardening of Al-0.3 at.%Sc alloy at different stages of aging was conducted.

  18. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  19. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  20. Estudo medico da hemoglobinopatia SC em negroides paulistas

    OpenAIRE

    Raquel Ribeiro Gomes

    1988-01-01

    Resumo: A hemoglobinopatia SC é a segunda síndrome falcêmica mais importante no Brasil, devido à sua significativa prevalência entre negróides e também pelas manifestações clínicas apresentadas Apesar disso, ela tem sido pouco estudada em nosso país, não existindo na literatura nacional nenhum trabalho específico sobre essa doença. No presente trabalho, procurou-se investigar o significado médico da doença SC no Estado de são Paulo, analisando-se dois tipos de casuísticas de pacientes SC. Em ...

  1. Resolução alternativa de conflitos na área de saúde: derivação da análise econômica de processos da competência dos Juizados Especiais na Seção Judiciária do Ceará

    Directory of Open Access Journals (Sweden)

    Dartanhan Vercingetórix de Araújo e Rocha

    2014-06-01

    Full Text Available Objetivo: Aquilatar viabilidade na implementação de mecanismo de resolução alternativa de disputas na área da saúde, por meio da análise de processos em tramitação na segunda instância dos Juizados Especiais Federais no Ceará em novembro de 2012. Método: Foram coletados dados relacionados à composição dos polos da ação judicial, duração dos processos, valores das causas, posturas dos órgãos públicos e posicionamento do Poder Judiciário aos argumentos das partes. Resultados: Foram constatados o tratamento pulverizado outorgado aos reclamos dos usuários, de baixas complexidade e repercussão econômica; a demora na conclusão dos procedimentos derivada da postura dos órgãos de representação jurídica e a discreta taxa de prosperidade nos argumentos por eles manejados, além do ônus causado à União, mantenedora de todos os órgãos que atuam no sistema de justiça. Conclusões: Necessidade de expansão do modelo já praticado no âmbito do Comitê Interinstitucional de Resolução Administrativa de Demandas da Saúde (CIRADS, seja para se alcançar um término mais expedito das demandas ou diagnosticar as necessidades de ajustes no funcionamento do Sistema Único de Saúde (SUS.

  2. Envíos Confianza, S.C.

    OpenAIRE

    Banco Interamericano de Desarrollo (BID); S.C. Envíos Confianza

    2009-01-01

    Presentación acerca de Envíos Confianza, S.C., en el cual da a conocer su historia, misión, visión, valores, efecto de las remesas en comunidades e impacto de la crisis financiera. Además, señala la proyección para el 2009-2011.

  3. Hanseníase, preconceito e parrhesía: contribuições para se pensar saúde, educação e educação em saúde Hansen's disease, prejudice and parrhesia: reflective contributions on health, education and health education

    Directory of Open Access Journals (Sweden)

    Marcia Bastos de Sá

    2013-01-01

    Full Text Available Considerando que os campos profissionais da educação, da saúde e da educação em saúde implicam práticas destinadas ao governo das condutas dos indivíduos, desenvolvemos reflexão que visa contribuir para a problematização da formação profissional nesses campos. A partir de depoimento extraído de vídeo educativo que apresenta o tema do preconceito e do isolamento compulsório para portadores de hanseníase, tecemos considerações sobre a peculiaridade dos mecanismos de exclusão, conforme postulado por Michel Foucault, e apresentamos exemplos que evidenciam até que ponto esses mecanismos funcionaram, ainda recentemente, sobre os portadores da doença no Brasil. Retomando o fio dos eventos que levaram à mudança da denominação da doença - de lepra para hanseníase -, analisamos a luta empreendida por médico brasileiro contra o preconceito, alcançando uma reflexão de caráter ético, seguindo pistas das últimas investigações foucaultianas sobre o tema da constituição do sujeito moral e ativo, soberano de si mesmo.We consider that the professional fields of education, health and health education have practices that govern the conduct of individuals so we developed a reflection that aims to contribute towards problematizing professional training in these fields. Based on a testimony extracted from an educational video that presents the theme of prejudice and compulsory isolation for people with Hansen's disease, we discuss the peculiarity of the exclusion mechanisms, as postulated by Michel Foucault, and present examples that show to what extent these mechanisms have still functioned recently with those who have the disease in Brazil. Revisiting the events that led to the change of the disease's name - from leprosy to Hansen's disease - we analyzed the struggle of a Brazilian doctor against prejudice, making an ethical reflection following the clues of the Foucaultian investigations on the theme of the constitution of the

  4. Avaliação da satisfação dos usuários com o cuidado da saúde mental na Estratégia Saúde da Família

    Directory of Open Access Journals (Sweden)

    Valéria Cristina Christello Coimbra

    2011-10-01

    Full Text Available Esta pesquisa objetiva avaliar a satisfação de usuários portadores de sofrimento psíquico acompanhados pela Estratégia Saúde da Família, com vistas à integralidade. Foi um estudo de caso desenvolvido a partir de uma pesquisa de avaliação com abordagem qualitativa em uma unidade de saúde da família no município de Chapecó, SC. Os sujeitos do estudo foram 13 usuários com algum tipo de transtorno mental. Para avaliação da satisfação, foram utilizados sete domínios: autonomia, confidencialidade, comunicação, tratamento respeitoso, pronto-atendimento, condições das instalações básicas e acesso à redes de apoio social. Ao final do estudo, identificou-se que os usuários percebem os pontos fortes e os fracos da organização do serviço e do cuidado prestado: o vínculo, a relação entre a equipe e a comunidade, o cuidado com a família, as visitas domiciliares e o olhar integral do profissional de saúde no exame físico foram relatados como motivos de satisfação dos usuários.

  5. Health SA Gesondheid

    African Journals Online (AJOL)

    Health SA Gesondheid - Journal of Interdisciplinary Health Sciences is an open access, .... Chokwe M. Setati, Zerish Z. Nkosi, 130-137 ... Movement as a critical concept in model generation to attain wholeness · EMAIL FREE FULL TEXT ...

  6. SalSA status

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom)], E-mail: amyc@hep.ucl.ac.uk

    2009-06-01

    I review the status of SalSA, a proposed antenna array in a large volume salt formation for detecting ultra-high energy neutrinos. We report on measurements taken in 2007 of attenuation lengths in the 125-900 MHz frequency range at the Cote Blanche salt mine near New Iberia, Louisiana, which is the most precise in situ measurement of attenuation lengths in salt to date. We comment on the impact of these measurements on the feasibility of SalSA.

  7. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  8. Aspectos epidemiológicos da AIDS em Florianópolis/SC, Brasil Aspectos epidemiológicos del sida en Florianópolis/SC, Brasil Epidemiological aspects of AIDS in the city of Florianopolis, Brazil

    Directory of Open Access Journals (Sweden)

    Janelice de Azevedo Neves Bastiani

    2012-09-01

    Full Text Available O estudo teve como objetivo descrever os aspectos epidemiológicos das pessoas com 13 anos e mais, com AIDS, residentes em Florianópolis/SC entre 1986 e 2006. Estudo descritivo, transversal, com coleta das variáveis: ano de diagnóstico, sexo, idade, categoria de exposição, escolaridade, cor da pele e Regional de Saúde de residência, no Sistema Nacional de Agravos de Notificação e Sistema de Informação sobre Mortalidade. Constata-se a magnitude da AIDS em homens, com ensino fundamental, de cor da pele branca, idade entre 20 e 49 anos e heterossexuais. Observou-se a vulnerabilidade feminina na redução da razão entre os sexos masculino/feminino no período avaliado. Apresentam-se a base social e a especificidade dos doentes de AIDS em Florianópolis/SC, e sugerem-se investimentos no diagnóstico territorial na Estratégia de Saúde da Família e acompanhamento dos sistemas de informação pelas Regionais de Saúde, para avaliar a eficiência e a efetividade das estratégias de prevenção à AIDS em Florianópolis/SC.Este estudio objetivó describir los aspectos epidemiológicos de las personas mayores de 13 años, residentes en Florianópolis/SC, que contrajeron SIDA, de 1986 a 2006. Estudio transversal, con la colección de las variables: año de diagnóstico; sexo; edad; categoría de exposición; nivel de educación; color de la piel; la Autoridad Regional de Salud de residencia, en el Sistema Nacional de Agravos de Notificação y Sistema de Informação sobre Mortalidade. Se constató la magnitud de SIDA en hombres, con escuela secundaria completa, que eran de raza blanca, de entre 20 y 49 años y heterosexuales. Se observó la vulnerabilidad femenina en la reducción de la relación entre los géneros femenino masculino/femenino en el período del estudio. Se presenta la base social y la especificidad de los pacientes con SIDA en Florianópolis/SC, se sugiere el diagnóstico de la inversión territorial en la Estrategia de

  9. Compuestos perazufrados de platino(II) con ditioéteres y tiolatos fluorados. Estructuras cristalinas de [Pt(SC6F5)2 (p-C6H4FSCH2CH2-p-SC6H4F)], [Pt(p-SC6HF4)...

    OpenAIRE

    Jorge Bautista; Agusti Bertran; Sylvain Bernès; Ubaldo Duran; Hugo Torrens

    2003-01-01

    En este articulo se describen la síntesis y caracterización de los compuestos cis-[PtCl2(RfSCH2CH2SRf)], Rf = C6F5, p-SC6HF4, o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3), y las reacciones de estos compuestos con (SC6F5)– y (p-SC6HF4)– que generan cis- [Pt(SC6F5)2(RfSCH2CH2SRf)] y cis-[Pt(p-SC6HF4) 2(RfSCH2CH2 SRf)], Rf = o-SC6H4F, m-SC6H4F, p-SC6H4F, m-SC6H4(CF3). Para estos compuestos, los datos de RMN de 19F obtenidos a diferentes temperaturas, muestran la presencia e interconversion de isóm...

  10. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  11. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  12. Perfil de saúde dos trabalhadores de um Centro de Saúde-Escola

    Directory of Open Access Journals (Sweden)

    Nascimento Lucila Castanheira

    2002-01-01

    Full Text Available O estudo buscou descrever o perfil de saúde dos trabalhadores (184 de um Centro de Saúde-Escola de Ribeirão Preto, sob a perspectiva da Promoção de Saúde, modelo epidemiológico de Blum e fatores de risco para doenças crônico-degenerativas. Foi realizado estudo descritivo utilizando-se entrevista estruturada. Concluiu-se que os trabalhadores eram predominantemente do sexo feminino, faixa etária de 35 a 39 anos e escolaridade "superior completo". Dentre os achados, constatou-se que 61,9% tinham sobrepeso e obesidade; a hipertensão foi detectada em 33,1%; 41 (22,3% apresentaram pressão arterial acima do nível da normalidade e a obesidade mostrou-se presente em mais da metade dos indivíduos com pressão arterial alterada. Os dados possibilitaram explorar riscos autocriados para as doenças crônico-degenerativas; identificar fatores relacionados à promoção de saúde e prevenção de doenças e refletir sobre o autocuidado e auto-responsabilidade, visando à qualidade de vida que desfrutarão, em decorrência da transição demográfica e epidemiológica que vivenciamos.

  13. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  14. Educação em saúde como principal alternativa para promover a saúde do idoso

    Directory of Open Access Journals (Sweden)

    Danielli Gavião Mallmann

    2015-06-01

    Full Text Available Trata-se de uma revisão integrativa que objetivou identificar as evidências científicas sobre as ações educativas em saúde voltadas à promoção da saúde do idoso. A busca dos artigos foi realizada nas bases de dados Medline, Lilacs, BDENF, CINAHL e biblioteca virtual SciELO, por meio do cruzamento dos descritores Educação em Saúde, Idoso, Envelhecimento, Saúde do Idoso, Promoção da Saúde e Qualidade de vida, incluindo-se artigos publicados no período de 2003 a 2013, nos idiomas inglês, espanhol e português, realizados com idosos. Foram selecionados oito artigos, dos quais percebeu-se a qualidade de vida e a promoção do envelhecimento saudável como fatores resultantes das estratégias de educação em saúde. As ações de educação em saúde para idosos necessitam de metodologias que atentem para a complexidade do processo de envelhecimento e relacionem os fatores que cercam o indivíduo, como as crenças, os valores, as normas e os modos de vida.

  15. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  16. Desenvolvimento econômico, desigualdade e saúde

    Directory of Open Access Journals (Sweden)

    Pedro Reginaldo Prata

    1994-09-01

    Full Text Available O autor se refere a dimensão socioeconômica, individual e coletiva do fenômeno saúde-doença. Refere-se também ao fato das populações estarem sobre a influência desigual de fatores de risco e de proteção à saúde. Discute as desigualdades no desenvolvimento e a relação entre desenvolvimento, riqueza, saúde e justiça social. Questiona as teorias de desenvolvimento econômico, diferenciando desenvolvimento de crescimento. Cunha os conceitos de armadilha do desenvolvimento e refugiados sociais. Define uma comunidade saudável. Propõe a necessidade de mudança no modelo de desenvolvimento. Baliza o papel e as limitações do setor saúde no que diz respeito a iniqüidade social.

  17. Fonoaudiologia em saúde pública

    Directory of Open Access Journals (Sweden)

    Regina M. Freire

    1992-06-01

    Full Text Available Objetivou-se obter o entendimento das funções do fonoaudiólogo enquanto profissional da saúde. Discutem-se as dificuldades ligadas à implantação de um serviço novo, estranho às Unidades Básicas de Saúde. A seguir, analisa-se a demanda pelo serviço de Fonoaudiologia em postos de saúde, e verifica-se que 32% da população que busca esse serviço está em idade escolar e vem encaminhada pelas escolas, com queixa de problemas de aprendizagem. Uma aproximação maior dessas crianças, através do atendimento fonoaudiológico, delineia uma outra realidade: a de que não se pode considerar como distúrbio/desvio/problema/patologia marcas gráficas que se constituem como indícios do choque entre o processo de letramento e o de alfabetização. Entendendo a problemática do ponto de vista da saúde pública, propõe-se um programa de atendimento ao professor, cujo objetivo é o esclarecimento da escola com relação ao seu papel de co-construtora do processo de letramento da criança, devolvendo-lhe a responsabilidade pelo sucesso e/ou fracasso da alfabetização.

  18. "Pra tá no DC tem que ser meio doido. Se tu não és, vai ficar": a saúde mental dos servidores do Departamento de Criminalística do Instituto-Geral de Perícias do Rio Grande do Sul [doi: 10.5329/RECADM.20121102006

    Directory of Open Access Journals (Sweden)

    Neusa Rolita Cavedon

    2012-11-01

    Full Text Available O objetivo deste artigo é mostrar como se dá o cotidiano daqueles que trabalham com locais de crime, de violência, buscando verificar como isso afeta a saúde mental do trabalhador. A pesquisa etnográfica foi realizada com os servidores que exercem suas atividades no Departamento de Criminalística do Instituto-Geral de Perícias do Rio Grande do Sul. O sofrimento se dá em face das vivências dramáticas que envolvem entrar em contato com corpos dilacerados, em estado de putrefação, com familiares desesperados, diferentes contextos sociais, reviver a cena do crime mediante a elaboração do laudo, presenciar a violência impetrada contra crianças. A satisfação no trabalho se dá através do laudo bem montado, da ciência do resultado da perícia no âmbito do judiciário. O servidor do DC precisa enfrentar a morte violenta fazendo uso de mecanismos de defesa que privilegiem a vida, daí a ênfase no discurso que coloca a atividade como “apaixonante” por auxiliar na absolvição ou condenação das pessoas sob suspeita. Absolver ou condenar implica preservar a vida, absolver salvaria a vida de um inocente que poderia ficar na prisão injustamente, condenar significa garantir a vida dos integrantes da sociedade de onde o indivíduo emerge, posto que ele, em liberdade, poderia reincidir no crime.   Palavras-chave Perícia, saúde mental, sofrimento, prazer, etnografia.     "YOU’VE GOT TO BE CRAZY TO BE IN THE DC. IF YOU’RE NOT, YOU’RE GONNA BE": THE MENTAL HEALTH OF EMPLOYEES IN THE DEPARTMENT OF CRIMINALISTICS OF THE GENERAL INSTITUTE OF FORENSICS OF RIO GRANDE DO SUL   ABSTRACT This article’s goal is disclose the daily routine of people who work with crime and violence related places, in an attempt to reveal how the mental health of the servants is affected. The ethnographic research was conducted with employees at the Department of Criminalistics of the General Institute of Forensics of Rio Grande do Sul. The suffering

  19. Saúde, direito à saúde e justiça sanitária

    Directory of Open Access Journals (Sweden)

    João Arriscado Nunes

    2012-10-01

    Full Text Available Propõe‑se uma abordagem preliminar dos processos heterogéneos e contingentes através dos quais se definem e constituem mutuamente a saúde e o direito à saúde. São apresentadas e discutidas duas manifestações recentes dessa dinâmica. A primeira situa‑se na linha das transformações associadas às orientações de inspiração neoliberal no campo da saúde, apontando para a passagem da saúde como direito à saúde como imperativo, centrado na responsabilização individual e na centralidade da vigilância e da prevenção. A segunda, designada justiça sanitária, é exemplificada através de situações em que cidadãos, através da acção colectiva e mobilizando os vocabulários dos direitos e da justiça, procuram o reconhecimento como portadores de uma doença, os direitos associados a essa condição e a acção pública sobre situações que afectam a sua saúde.

  20. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  1. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  2. 75 FR 52238 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... new AD: 2010-18-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16414. Docket No... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  3. Aspectos ultrassonográficos associados à morbidade de formas clínicas crônicas de esquistossomose mansônica, utilizando-se protocolo proposto pela Organização Mundial da Saúde Sonographic features associated with morbidity of chronic clinical presentations of schistosomiasis mansoni using the protocol proposed by the World Health Organization

    Directory of Open Access Journals (Sweden)

    Daniel Alvarenga Fernandes

    2013-02-01

    Full Text Available OBJETIVO: Avaliar aspectos ultrassonográficos associados à morbidade em pacientes com formas clínicas crônicas de esquistossomose mansônica, utilizando-se protocolo proposto pela Organização Mundial da Saúde (OMS. MATERIAIS E MÉTODOS: Foram avaliadas duas populações distintas: a área endêmica e b institucional terciária, com histopatológico confirmando fibrose. Critérios de inclusão: diagnóstico confirmado por parasitológico de fezes para Schistosoma mansoni (método Kato-Katz. Critérios de exclusão: sorologia positiva para HIV, HTLV-1, VHB ou VHC. Foi utilizado protocolo ultrassonográfico de Niamey, proposto pela OMS. RESULTADOS: Avaliando-se isoladamente as medidas dos espaços periportais, estas se mostraram sem alterações em 21% dos indivíduos com doença avançada da instituição terciária. Utilizando-se todos os parâmetros do protocolo, 100% dos indivíduos da instituição terciária, com forma grave da doença, apresentaram fibrose periportal avançada. Em pacientes hepatoesplênicos da área endêmica não se identificou fibrose à ultrassonografia. CONCLUSÃO: O protocolo ultrassonográfico proposto pela OMS detecta fibrose periportal avançada nos pacientes com forma grave da doença, com maior sensibilidade do que a medida do espaço periportal isoladamente. A complexidade de identificação das fases iniciais da fibrose periportal, em áreas endêmicas, pela ultrassonografia, pode suscitar o campo da complementação diagnóstica e a continuidade do aprimoramento dos protocolos ultrassonográficos nestas áreas.OBJECTIVE: To evaluate sonographic features associated with morbidity in patients with chronic clinical presentations of schistosomiasis mansoni, according to the protocol proposed by the World Health Organization (WHO. MATERIALS AND METHODS: Two distinctive populations were evaluated: a patients from an endemic area, and b patients from a tertiary institution, with histopathologically confirmed

  4. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  5. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  6. SE PREVENINDO?

    Directory of Open Access Journals (Sweden)

    Ana Débora Assis Moura

    2010-01-01

    Full Text Available Este estudio tuvo como objetivo verificar el comportamiento de las prostitutas en relación a la prevención de enfermedades de transmisión sexual y del Síndrome de Inmunodeficiencia Adquirida-SIDA, así como investigar cómo se previenen de esas enfermedades. Se trata de una investigación exploratoria, con enfoque cualitativo, llevada a cabo en la Asociación de las Prostitutas en Ceará, Brazil, en septiembre de 2008, a través de una encuesta con 25 prostitutas. El análisis de los datos se hizo según el análisis de contenido, después de ser agrupados en cuatro categorías: conocimiento sobre las enfermedades de transmisión sexual/SIDA; convivencia con la(s enfermedad(es; prevención de la enfermedad de transmisión sexual/SIDA; y el uso de drogas. Se concluyó que las prostitutas no usan preservativos en todas las relaciones sexuales, por lo tanto, las enfermedades de transmisión sexual representan una realidad; la desinformación sobre la(s enfermedad(es es notable; el consumo de drogas lícitas e ilícitas es frecuente entre ellas, factor que las expone a situaciones más vulnerables con relación al VIH/SIDA.

  7. Se los por se lo

    Directory of Open Access Journals (Sweden)

    José Luis Rivarola

    1985-12-01

    Full Text Available El sistema de la conjugación "objetiva" plantea interesantesproblemas que fueron tratados en parte por K. Heger (1966 en suestudio comparativo del francés y del español. De la comparaciónse desprende, por ejemplo, que en español hay un cierto número deambigüedades que no permiten establecer un "paradigma tan completo y unívoco" como en el caso del francés. Dentro de estas ambigüedades se encuentran las que propicia el gramema se: "El morfema [gramema] se funciona no sólo como pronombre reflexivo, sinotambién como variante combinatoria del pronombre personal complemento indirecto de la tercera persona.

  8. Apoio social e saúde entre idosos

    Directory of Open Access Journals (Sweden)

    Ramos Marília P.

    2002-01-01

    Full Text Available O presente artigo trata da relação entre a saúde dos idosos e relacionamentos sociais, bem como na interpretação e entendimento desta problemática sob a luz de dois enfoques teóricos: um macro, centrado na Teoria da Integração Social de Emile Durkheim e outro micro, centrado na Teoria das Trocas, de Peter Blau, com ênfase na Teoria da Eqüidade. A integração social (freqüência de contatos pode ter efeitos negativos na saúde, mas isto tem de ser medido pela qualidade dos contatos. Algumas conclusões apresentadas indicam que as relações sociais têm um efeito na saúde, no sentido de que as pessoas, nas sociedades modernas, esperam a reciprocidade, e, quando isto não é possível, principalmente na fase do envelhecimento, as pessoas sentem-se dependentes, e isso pode afetar a saúde de diferentes maneiras. Por outro lado, quando as pessoas têm problemas de saúde, elas experienciam uma falta de relações sociais balanceadas devido à incapacidade para trocar em bases iguais. Sendo assim, conclui-se que a relação entre relações sociais e saúde na população idosa pode ser uma relação recíproca.

  9. Prevalência de sinais/sintomas sugestivos de sensibilização ao látex em profissionais de saúde Prevalencia de señales/síntomas sugestivos de sensibilidad al l átex en profesionales de la salud Prevalence of signs/symptoms suggestive of latex sensitization in health care workers

    Directory of Open Access Journals (Sweden)

    Lígia Andrade da Silva Telles Mathias

    2006-04-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: As referências na literatura sobre reações aos derivados do látex têm aumentado significativamente nos últimos anos. Faltam, entretanto, dados do nosso país relativos à prevalência de sensibilização ao látex nos profissionais da área da saúde. O objetivo deste estudo foi avaliar a prevalência de sinais/sintomas sugestivos de sensibilização ao látex em profissionais da área da saúde. MÉTODO: Após aprovação pelo Comitê de Ética foram selecionados indivíduos pertencentes ao quadro da instituição: funcionários do Setor de Limpeza, Contabilidade e Divisão de Enfermagem do Centro Cirúrgico; Médicos da Cirurgia, Ginecologia, Obstetrícia, Anestesiologia, Unidade de Terapia Intensiva e Clínica Médica. Após consentimento informado, os indivíduos foram submetidos a um questionário sobre: idade, sexo, categoria profissional; tipo e tempo de contato profissional com derivados do látex; tipo de luva; sinais/sintomas sugestivos de sensibilização ao látex dentro e fora do ambiente hospitalar; sinais/sintomas sugestivos de atopia e de alergia a alimentos. RESULTADOS: Foram avaliados 326 questionários (193 mulheres e 133 homens, com idade entre 30 e 73 anos. Setenta e cinco por cento dos entrevistados apresentaram até 10 anos de tempo na profissão. A prevalência dos sinais/sintomas sugestivos de sensibilização ao látex dentro do ambiente hospitalar em relação aos grupos compostos pelos funcionários do Setor de Contabilidade (não expostos a derivados do látex no ambiente de trabalho e o restante dos indivíduos (expostos a derivados do látex no ambiente de trabalho mostrou diferença significativa (p JUSTIFICATIVA Y OBJETIVOS: Las referencias en la literatura sobre reacciones a los derivados del látex han aumentado significativamente en los últimos años. Sin embargo faltan datos de nuestro país relativos a la prevalencia de sensibilidad al látex en los profesionales del

  10. rotor of the SC rotating condenser

    CERN Multimedia

    1974-01-01

    The rotor of the rotating condenser was installed instead of the tuning fork as the modulating element of the radiofrequency system, when the SC accelerator underwent extensive improvements between 1973 to 1975 (see object AC-025). The SC was the first accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990.

  11. Radiation Protection Section (SC/SL/RP)

    CERN Multimedia

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  12. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  13. Desigualdade social e saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Neri Marcelo

    2002-01-01

    Full Text Available Esse artigo estuda a relação entre desigualdade social e saúde no Brasil. A estratégia usada foi avaliar as necessidades e o consumo dos serviços de saúde, bem como o acesso a seguro saúde ao longo da distribuição de renda. Adicionalmente, por meio da estimação de uma regressão logística, foram avaliados outros determinantes do consumo dos serviços de saúde, com o intuito de se conhecer aonde e quem utiliza esses serviços no país. Os dados foram extraídos da Pesquisas Nacional de Amostra por Domicilio da Fundação Instituto Brasileiro de Geografia e Estatística levada a campo em 1998. Em geral, observou-se que os indivíduos nos primeiros décimos da distribuição de renda têm pior acesso a seguro saúde, necessitam de maiores cuidados médicos, mas consomem menos os serviços de saúde. As outras características extra rendimento indicam que os principais determinantes para o consumo dos serviços de saúde estariam fortemente associados aos grupos sociais mais privilegiados (de maior escolaridade, acesso a seguro saúde, água, esgoto, luz, coleta de lixo e a fatores que apontam para capacidade de geração de oferta desses serviços no país.

  14. A interdisciplinaridade vivenciada no PET-Saúde = The interdisciplinarity experienced in the PET- Saúde program

    Directory of Open Access Journals (Sweden)

    Assega, Mariana Lieka

    2010-01-01

    Full Text Available Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste em parte integrante e inseparável da saúde do indivíduo. A interação dos profissionais da saúde torna-se possível por meio de iniciativas como o PET-Saúde, o qual fomenta a formação profissional articulada com os profissionais da ESF, bem como, o processo de integração ensino-serviço-comunidade na perspectiva da interdisciplinaridade. Objetivo: Relatar a vivência de estudantes ao realizar uma pesquisa interdisciplinar. Descrição da experiência: Esse relato foi vivenciado no projeto PET-Saúde da Faculdade de Medicina de Marília, no sub projeto Saúde do Homem, visando construir e validar um instrumento de coleta de dados por meio da Técnica Delphi, para auxiliar a equipe de saúde detectar precocemente agravos odontológicos, visto que no Brasil, o perfil de saúde bucal, na faixa etária de 35 a 44 anos, está comprometido. Os participantes, deste estudo, são discentes de enfermagem e medicina, preceptora cirurgiã-dentista e tutora docente enfermeira. Para as atividades educacionais utilizou-se a metodologia ativa de ensino-aprendizagem. Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde

  15. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  16. Structural and optical characterization of electrodeposited CdSe in mesoporous anatase TiO2 for regenerative quantum-dot-sensitized solar cells.

    Science.gov (United States)

    Sauvage, Frédéric; Davoisne, Carine; Philippe, Laetitia; Elias, Jamil

    2012-10-05

    We investigated CdSe-sensitized TiO(2) solar cells by means of electrodeposition under galvanostatic control. The electrodeposition of CdSe within the mesoporous film of TiO(2) gives rise to a uniform, thickness controlled, conformal layer of nanostructured CdSe particles intimately wrapping the anatase TiO(2) nanoparticles. This technique has the advantage of providing not only a fast method for sensitization ( panels. XRD together with SAED analysis highlight that the deposit of CdSe is exclusively constituted of the hexagonal polymorph. In addition, hierarchical growth has also been shown, starting from the formation of a TiO(2)-CdSe core-shell structure followed by the growth of an assembly of CdSe nanoparticles resembling cauliflowers. This assembly exhibits at its core a mosaic texture with crystallites of about 3 nm in size, in contrast to a shell composed of well-crystallized single crystals between 5 and 10 nm in size. Preliminary results on the photovoltaic performance of such a nanostructured composite of TiO(2) and CdSe show 0.8% power conversion efficiency under A.M.1.5 G conditions-100 mW cm(-2) in association with a new regenerative redox couple based on cobalt(+III/+II) polypyridil complex (V(oc ) = 485 mV, J(sc ) = 4.26 mA cm (-2), ff=0.37).

  17. O debate sobre educação em saúde no âmbito do Conselho Municipal de Saúde de Vitória, ES, Brasil

    Directory of Open Access Journals (Sweden)

    Welington Serra Lazarini

    2014-12-01

    Full Text Available Analisou-se a relação entre educação em saúde e a política de participação e controle social em saúde da Secretaria Municipal de Saúde de Vitória-ES, Brasil, entre 2005 e 2012. Realizou-se análise documental nos planos municipais de saúde, relatórios de gestão e em 139 atas do Conselho Municipal de Saúde. Evidenciou-se que a gestão orientou sua política pela participação, mas restringiu-se ao Conselho Municipal de Saúde. A educação em saúde foi tratada pontualmente durante as reuniões. Quando debatida, foi como modelo tradicional, configurando-se em estratégia para vigilância. A Educação Popular em Saúde foi mencionada no segundo governo, mas sem a redefinição das práticas. Sinaliza-se a necessidade de reconhecer as diferentes formas de participação social em Vitória e ampliar o debate acerca do modelo dialógico da educação em saúde.

  18. Riscos químicos hospitalares e gerenciamento dos agravos à saúde do trabalhador de enfermagem

    Directory of Open Access Journals (Sweden)

    Lorena Sabbadini da Silva

    2012-04-01

    severidade, causando envenenamentos e toxicidade. Algumas substâncias químicas fazem parte do instrumento de trabalho da equipe de enfermagem. Essas substâncias são introduzidas na área de saúde e da enfermagem, em seus diferentes estados como gases, vapores e líquidos para uso em esterilização, desinfecção de materiais, anestesias e tratamentos medicamentosos de pacientes como, por exemplo, a quimioterapia.³,5. Essas substâncias são capazes de produzir tipos diversos de lesões celulares, essas lesões podem ter efeitos manifestados de imediato ou tardiamente. Essas manifestações tardias podem estar relacionadas à dificuldade que esses trabalhadores se defrontam em reconhecer e associar os sinais e sintomas ao manuseio destas substâncias. Prevenir é uma das formas de se evitar os problemas de saúde ocupacional que podem ser desencadeados por essa exposição; porém, para a efetividade dessa prevenção é necessário que os trabalhadores tenham conhecimento sobre os riscos propiciados pelas substâncias químicas6. O reconhecimento e a análise dos riscos relacionados a agentes químicos são atividades prioritárias para qualificar a intervenção na defesa da saúde do trabalhador: quem não reconhece não pode avaliar e prevenir o risco.¹Objetivo Identificar e analisar os tipos de riscos químicos capazes de desencadear a toxicidade em profissionais da área de enfermagem e os tipos de gerenciamentos de agravos que podem ser adotados pelos enfermeiros. Metodologia Estudo qualitativo, tipo revisão bibliográfica. Para alcançar os objetivos propostos, realizou-se levantamento bibliográfico nas bases de dados BDENF (Base de Dados de Enfermagem, ScIELO (Scientific Eletronic Library Online  e LILACS (Literatura Latino-americana e do Caribe de Ciências da Saúde. Utilizaram-se os seguintes descritores: Risco ocupacional, saúde do trabalhador, riscos químicos e enfermagem ocupacional. Foram selecionados todos os artigos nacionais, disponíveis na

  19. 78 FR 5712 - Airworthiness Directives; CFM International, S.A. Turbofan Engines Modified by Supplemental Type...

    Science.gov (United States)

    2013-01-28

    ..., S.A. Turbofan Engines Modified by Supplemental Type Certificate SE00034EN AGENCY: Federal Aviation... directive (AD) for CFM International, S.A. CFM56-3, CFM56-3B, and CFM56-3C turbofan engines. This AD... of multiple turbine blades, damage to the engine, and damage to the airplane. DATES: This AD...

  20. Educação Popular e Saúde e democracia no Brasil

    Directory of Open Access Journals (Sweden)

    Eduardo Navarro Stotz

    2014-12-01

    Full Text Available O ensaio se propõe a entender os limites, as possibilidades e os desafios do controle social do Sistema Único de Saúde à luz de uma reflexão sobre a democracia no Brasil com base nas referências da Educação Popular e Saúde.

  1. 76 FR 27237 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-05-11

    ...-153-AD; Amendment 39-16684; AD 2011-10-03] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-10-03 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16684... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  2. Stock Analysis of S.C. ROPHARMA S.A. the Example of Romanian Pharmaceutical Entity

    Directory of Open Access Journals (Sweden)

    Mihaela-Cristina ONICA

    2011-11-01

    Full Text Available Stock performance analysis can not find a better place than after presentation of earnings per share, the latter being one of the indicators on the performance of companies listed on capital markets. Exchange rates are considered final term market performance of listed companies since they incorporate information concerning stock, but also financial and accounting data on the net result for the year, sales per share, dividend per share, book value per share, etc. Stock rate of action is the barometer of a company's overall performance, officially recognized by the public through the capital market. But changes in stock price is determined by the evolution of economic and financial results of the enterprise, but also investors' expectations about the possibilities of its development, progress and prospects the industry in which company operates, and national and international economic trends.

  3. ELABORATION OF THE ECONOMIC REVIVAL STRATEGY AT THE SC CDP ARIS SA BAIA MARE

    Directory of Open Access Journals (Sweden)

    Vasile Berlingher

    2011-01-01

    Full Text Available Any enterprise develops, changes, its personnel changes in numbers or may be insufficient,but ensuring the strictly necessary number of personnel and its efficient putting into use isalready an obligation of each and every manager. In many organizations there exist humanresources able of performance, able to adapt to changes but not efficient enough becausethey are not told how to act in order to become proficient and this may well be, in somecases, on purpose. Individualism, as a mentality inherited across generations, the knownnegative experiences, all these put on hold any initiative for change so necessary in thisglobalization era. The manager, the leader or the group coordinator aware of the importanceof a balance between change and stability can avoid the ambiguities occurring insideorganizations, of the groups inside them, and for this person, in the cases where he is alsothe owner, any possible inconveniences.

  4. Lewis Porter, John Coltrane. Sa vie, sa musique

    OpenAIRE

    Parent, Emmanuel

    2008-01-01

    Les éditions Outre Mesure viennent de mettre à la disposition du lectorat français, avec la qualité de mise en page et en musique qu’on leur connaît, un nouveau livre de référence en musicologie du jazz. Salué à sa sortie par la critique en langue anglaise en 1998, John Coltrane. Sa vie, sa musique constitue en effet un ouvrage fort complet pour qui veut s’immerger dans le langage du heavyweight champion. L’auteur, enseignant à Rutgers (l’université du New Jersey abritant depuis les années 19...

  5. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  6. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  7. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  8. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  9. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  10. Recrystallization of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Ber, L.B.

    Scandium effect on the temperature range of aluminium recrystallization was investigated. Al-Sc alloys were studied under cold rolled and hot pressed conditions. It is found that the temperature range of Al-Sc alloy recrystallization depends on ScAl/sub 3/ particle dispersion during recrystallization heats. During heating in quenched alloys at 200-300 deg C decomposition occurs which prevents recrystallization, In the alloys with scandium contents less 0.2% decomposition and recrystallization processes pass simultaneously. In quenched alloys with scandium contents over 0.2% and in aged alloys the initiation and subsequent development of recrystallization are determined by the processes of coalescence and solution of ScAl/sub 3/ phase particles.

  11. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    Directory of Open Access Journals (Sweden)

    Aline Rodrigues de ALMEIDA

    2016-01-01

    Full Text Available A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorpora o foco na dimensão social das vulnerabilidades. Para promover saúde no Brasil, é indissociável do enfrentamento de uma realidade de iniquidades históricas de grandes proporções que impõem desafios cotidianos não apenas ao setor de saúde, mas a todos aqueles que constroem políticas públicas. A qualidade de vida depende da satisfação das necessidades básicas de todos os cidadãos, propondo uma gestão baseada na solidariedade social, uma visão holística dos problemas e a redução das iniquidades. A promoção da saúde em um país tão desigual como o Brasil propõe um desafio constante aos atores envolvidos no sistema de saúde. A compreensão das iniquidades em saúde para estabelecer uma assistência holística é um processo difícil, mas extremamente relevante para a saúde pública.

  12. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  13. O relativismo cultural é válido nas ciências da saúde? Exame de suas bases filosóficas

    Directory of Open Access Journals (Sweden)

    Erna Bastian

    1971-06-01

    Full Text Available Examina-se o conceito do relativismo cultural sob bases filosóficas e sua validade nas ciências da saúde. Analisam-se os têrmos absoluto, relativo e universal, chegando-se a um modêlo operacional do relativismo cultural nas ciências da saúde.

  14. Grupo PET-Saúde/Vigilância em Saúde do Trabalhador Portuário: vivência compartilhada

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Ferreira Queiróz

    2015-12-01

    Full Text Available Trata-se de um relato de vivência compartilhada do Grupo PET-Saúde/ Vigilância em Saúde do Trabalhador Portuário, da Universidade Federal de São Paulo – Unifesp e o Centro de Referência em Saúde do Trabalhador – CEREST, de Santos, SP. O objetivo é descrever a experiência desse grupo tutorial e sua contribuição para o fortalecimento de ações de vigilância em saúde do trabalhador de Santos. O trabalho portuário é a temática do PET-Saúde por sua importância no cenário nacional e por sofrer transformações que geram fatores de agravos à saúde dos trabalhadores. As ações são desenvolvidas englobando o CEREST, os serviços da rede de saúde de Santos e a comunidade portuária santista. Observa-se que os participantes têm compartilhado conhecimento teórico e prático profissional, contribuindo nas ações dos trabalhadores do CEREST e apontando na direção de aproximação com a rede básica de atenção à saúde.

  15. High-conjugation-efficiency aqueous CdSe quantum dots.

    Science.gov (United States)

    Au, Giang H T; Shih, Wan Y; Shih, Wei-Heng

    2013-11-12

    Quantum dots (QDs) are photoluminescent nanoparticles that can be directly or indirectly coupled with a receptor such as an antibody to specifically image a target biomolecule such as an antigen. Recent studies have shown that QDs can be directly made at room temperature and in an aqueous environment (AQDs) with 3-mercaptopropionic acid (MPA) as the capping ligand without solvent and ligand exchange typically required by QDs made by the organic solvent routes (OQDs). In this study, we have synthesized CdSe AQDs and compared their conjugation efficiency and imaging efficacy with commercial carboxylated OQDs in HT29 colon cancer cells using a primary antibody-biotinylated secondary antibody-streptavidin (SA) sandwich. We showed that the best imaging condition for AQDs occurred when one AQD was bound with 3 ± 0.3 SA with a nominal SA/AQD ratio of 4 corresponding to an SA conjugation efficiency of 75 ± 7.5%. In comparison, for commercial CdSe-ZnS OQDs to achieve 2.7 ± 0.4 bound SAs per OQD for comparable imaging efficacy a nominal SA/OQD ratio of 80 was needed corresponding to an SA conjugation efficiency of 3.4 ± 0.5% for CdSe-ZnS OQDs. The more than 10 times better SA conjugation efficiency of the CdSe AQDs as compared to that of the CdSe-ZnS OQDs was attributed to more capping molecules on the AQD surface as a result of the direct aqueous synthesis. More capping molecules on the AQD surface also allowed the SA-AQD conjugate to be stable in cell culture medium for more than three days without losing their staining capability in a flowing cell culture medium. In contrast, SA-OQD conjugates aggregated in cell culture medium and in phosphate buffer saline solution over time.

  16. PET-Saúde: micropolítica, formação e o trabalho em saúde

    Directory of Open Access Journals (Sweden)

    Kathleen Tereza da Cruz

    2015-12-01

    Full Text Available O presente artigo analisa os efeitos que podem ser coletados das múltiplas experiências cotidianas vivenciadas pelos tutores/as, preceptores/as e alunos/as participantes do Programa de Educação pelo Trabalho para Saúde (PET-Saúde quando se trata de utilizá-las para se pensarem transformações na micropolítica da formação universitária e no trabalho em saúde. Tem como eixo uma pergunta: O Programa Pet-Saúde, nos seus processos cotidianos, é capaz de produzir efeitos que alargam a matriz de formação que tem como característica principal os processos de ensignação? Mais do que polarizar entre o sim e o não, temos como objetivo colocar em discussão as apostas na formação e atuação do campo da produção do cuidado em saúde, tentando pensar o que têm sido esses campos no âmbito da educação brasileira, e como é possível re-inventar processos de formação que tomam muito mais as desaprendizagens e as potencialidades dos diferentes atores envolvidos.

  17. Superconductivity and ferromagnetism in nanomaterial NbSe2

    Science.gov (United States)

    Gill, Raminder

    2017-07-01

    Finding of superconductivity (SC) in ultra thin layer of Niobium diselenide (NbSe2) caught the attention of each condensed matter physicist in the era of nanotechnology. The coexistence of SC and magnetism have been a topic of interesting research in solid-state physics since the discovery of superconductivity. Ferromagnetism induced in any compound could destroy superconductivity by disturbing the cooper pairing of electrons of the atoms. The interplay between ferromagnetism (FM) and SC in nanomaterial NBSe2 impressed to study and to know the exact mechanism behind this coexistence which can lead to a very interesting research: superconductivity at room temperature. In this paper, I have theoretically studied the coexistence of SC and FM in NbSe2 and how this material could be useful in finding many high Tc nanomaterials.

  18. Síndrome hemofagocítico y salmonelosis en un paciente con hemoglobinopatía SC Hemophagocytic syndrome and salmonellosis in a patient with SC hemoglobinipathy

    OpenAIRE

    Luis Fernando Pinto; Javier Molina; Francisco Cuellar; Amado Karduss

    1989-01-01

    Se informa el caso de un joven de 14 años con hemoglobinopatía SC que tuvo un síndrome hemofagocítico (SH) secundario a salmonelosis. Se discuten las características de este síndrome y su diagnóstico diferencial. Se hace énfasis en la importancia de considerarlo entre las posibilidades diagnósticas dada la frecuencia en Colombia de las infecciones que pueden desencadenarlo, a saber: tuberculosis, salmonelosis y ...

  19. Sc20C60: a volleyballene

    Science.gov (United States)

    Wang, Jing; Ma, Hong-Man; Liu, Ying

    2016-06-01

    An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable.An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable. Electronic supplementary information (ESI) available: Sc20C60: a Volleyballene_SI. See DOI: 10.1039/c5nr07784b

  20. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    Directory of Open Access Journals (Sweden)

    Regina I. Cuizon

    2014-10-01

    Full Text Available Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng mga tesis at disertasyong nagawa mula sa mga piling SUCs. Desinyong kwalitatibo - kontent analisis sa pagsusuri ng: kaanyuan ayon sa suliranin, metodolohiya, paglalahad at interpretasyon ng mga datos, natuklasan, konklusyon, at rekomendasyon; kahinatnan ayon sa pagkatulad, pagkakaiba at kabuluhan; Emerging tema. Napag-alaman na ang karaniwang pinag-aralan ay 30% kahalagahang pangkatauhan, 20% larawangdiwa ng mga kababaihan at 10% gramatikang aspeto. Sa metodolohiyang ginamit, 80% desinyong kwalitatibo at 20% kwantitatibo-kwalitatibo. Sa paglikom ng datos 60% diretsahang pagsusuri, 30% talatanungan at 10% tseklis. Sa pag-analisa 90% kontent analisis at 10% gramatikal analisis. Batay sa natuklasan, ang pagsusuri ng maiikling kwento sa mga tesis at disertasyon mula sa iba’t ibang paaralan gamit ang meta analisis ay isang epektibo, mabisa, objektibong paraan at kagamitan na magagamit sa makatarungang paghatol; pamumuna sa kabuluhan at kagandahan; paghaham- bing sa mga kritikal na isyu; at pormulasyon ng panibagong pamantayan at batas.

  1. Spectral embedding based probabilistic boosting tree (ScEPTre): classifying high dimensional heterogeneous biomedical data.

    Science.gov (United States)

    Tiwari, Pallavi; Rosen, Mark; Reed, Galen; Kurhanewicz, John; Madabhushi, Anant

    2009-01-01

    The major challenge with classifying high dimensional biomedical data is in identifying the appropriate feature representation to (a) overcome the curse of dimensionality, and (b) facilitate separation between the data classes. Another challenge is to integrate information from two disparate modalities, possibly existing in different dimensional spaces, for improved classification. In this paper, we present a novel data representation, integration and classification scheme, Spectral Embedding based Probabilistic boosting Tree (ScEPTre), which incorporates Spectral Embedding (SE) for data representation and integration and a Probabilistic Boosting Tree classifier for data classification. SE provides an alternate representation of the data by non-linearly transforming high dimensional data into a low dimensional embedding space such that the relative adjacencies between objects are preserved. We demonstrate the utility of ScEPTre to classify and integrate Magnetic Resonance (MR) Spectroscopy (MRS) and Imaging (MRI) data for prostate cancer detection. Area under the receiver operating Curve (AUC) obtained via randomized cross validation on 15 prostate MRI-MRS studies suggests that (a) ScEPTre on MRS significantly outperforms a Haar wavelets based classifier, (b) integration of MRI-MRS via ScEPTre performs significantly better compared to using MRI and MRS alone, and (c) data integration via ScEPTre yields superior classification results compared to combining decisions from individual classifiers (or modalities).

  2. Saúde do homem e masculinidades na Política Nacional de Atenção Integral à Saúde do Homem: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Marco Antonio Separavich

    2013-06-01

    Full Text Available Este artigo, orientado pela teoria do gênero sobre masculinidades, revisa os textos que trataram do tema nos periódicos de Saúde Coletiva/Saúde Pública no período de 2005-2011. Os eixos temáticos encontrados coincidem com as prioridades conferidas pela Política Nacional de Atenção Integral à Saúde do Homem, criada pelo Ministério da Saúde em 2008. São eles: o acesso dos homens aos serviços de saúde, sexualidade, saúde reprodutiva, violência e os principais agravos à saúde masculina, contextualizados à luz dos determinantes sociais da saúde. Tais determinantes se baseiam em um tipo de masculinidade tradicional concebida como hegemônica, que apesar de comprometer a saúde masculina, não é o tipo único de masculinidade existente na sociedade. As diferentes masculinidades encontram-se imbricadas no processo saúde/doença vivido pelos homens. Elas devem ser consideradas na busca da adesão dos homens aos serviços de saúde.

  3. Saúde bucal coletiva: caminhos da odontologia sanitária à bucalidade

    Directory of Open Access Journals (Sweden)

    Narvai Paulo Capel

    2006-01-01

    Full Text Available O ensaio aborda o surgimento das primeiras atividades odontológicas sob responsabilidade do poder público no Brasil e sua evolução no século XX, enfatizando a emergência do marco referencial denominado odontologia sanitária. Caracteriza, sumariamente, a odontologia social e preventiva e a odontologia de mercado, indicando as principais publicações que se ocuparam dessas correntes. As características essenciais da saúde bucal coletiva e da bucalidade são apresentadas, tecendo-se considerações sobre a articulação da saúde bucal coletiva com a saúde coletiva. Discutem-se as implicações do conceito de bucalidade para a organização da prática odontológica e a necessidade de reorientação do trabalho clínico nos serviços de saúde bucal, no âmbito do Sistema Único de Saúde brasileiro. Indicam-se os elementos essenciais de uma agenda para a saúde bucal coletiva, com base nas proposições apresentadas na 3ª Conferência Nacional de Saúde Bucal.

  4. FARM-CHEMICALS S.A. PLANTA FORMULADORA Y PRODUCTORA DE AGROQUÍMICOS

    Directory of Open Access Journals (Sweden)

    Gabriel Arturo García Gómez

    2002-01-01

    Full Text Available En esta tesis se analiza el sector en el cual se encuentra la empresa Farm-Chemicals S.A. planta Formuladora y Productora de Agroquímicos genéricos, evaluando su potencial de mercado y se presenta un modelo financiero desde cuatro escenarios, con lo que obtenemos posibles panoramas futuros para la Compañía. La información ha sido preparada cuidadosamente, después de estudiar el mercado potencial existente, la situación competitiva de Farm-Chemicals S.A. y las expectativas futuras dentro del sector en que se desenvuelve.

  5. Recrystallization and Morphology of Microstructure in Al-Sc Alloys

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun; Zhang Zonghua

    2007-01-01

    Minor addition of Sc to aluminum results in the rapid precipitation of homogeneously distributed Al3Sc dispersoids. The presence of Al3Sc dispersoids is more effective recrystallization inhibitors. Our work established the precipitation of homogeneously distributed Al3Sc dispersoids, which are coherent with the matrix, have the L12 structure. It was also established that the addition of Sc was effective in improving the recrystallization resistance.

  6. A saúde mental em cuidados de saúde primários

    OpenAIRE

    Santos, Ana Isabel Monteiro dos

    2009-01-01

    As perturbações psiquiátricas no contexto da Clínica Geral / Medicina Geral e Familiar constituem um tema que tem vindo a ser estudado desde a década de 1960, sendo uma matéria complexa e com múltiplas implicações. Os estudos epidemiológicos mais recentes demonstram que as perturbações psiquiátricas e os problemas de saúde mental se tornaram a principal causa de incapacidade e uma das principais causas de morbilidade nas sociedades modernas. E, para além dos indivíduos que apresentam uma ...

  7. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  8. Norma Audio Revo SC-/PA-150

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Norma audio是意大利一间顶级HI-Fi音响器材生产商。这款IRevo SC-2/PA-150为正是公司旗下的一款高端型号产品。其中,Revo SC-2前置放大器的放大电路以低噪音、高速和宽频作为设计重点,能反映出音频信号中的每一个细节。

  9. Percepções sobre necessidades de saúde na Atenção Básica segundo usuários de um serviço de saúde

    Directory of Open Access Journals (Sweden)

    Paulo Alexandre de Moraes

    2011-03-01

    Full Text Available Trata-se de pesquisa qualitativa de caráter exploratório, com o objetivo de conhecer o conceito de necessidades de saúde, segundo a percepção de usuários de um serviço de saúde do interior paulista. Realizou-se 15 entrevistas, por meio de roteiro semi-estruturado, em janeiro de 2009. A leitura exaustiva das entrevistas permitiu a apreensão de elementos constitutivos das categorias, definidas a priori, segundo a Taxonomia das Necessidades de Saúde. Identificou-se que os usuários perceberam-se como detentores de necessidades; o contexto social pode apresentar forte influência na sua saúde, verificando-se que a autonomia na tomada de decisões é uma necessidade. Quanto ao vínculo, percebe-se que está intimamente ligado às necessidades de autonomia/autocuidado, pois de certo modo é reforçando a relação de confiança que será possível fortalecer os potenciais para o enfrentamento do processo saúde-doença. Conclui-se que existe a necessidade de instrumentos que auxiliem o profissional da área da Saúde Coletiva a identificar as necessidades de saúde dos usuários.

  10. Sindicalismo, SUS e planos de saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    Full Text Available Este artigo discute a interlocução do sindicalismo brasileiro com o Sistema Único de Saúde (SUS e os planos e seguros privados de saúde. São ponderadas algumas teses na Saúde Coletiva à luz de estudos mais recentes nas Ciências Sociais sobre o sindicalismo e realizada análise documental para o caso da Central Única dos Trabalhadores (CUT, tomado aqui como referência. Aponta-se a necessidade de considerar os pesos relativos que a ação sindical atribuiu a cada um dos aspectos da relação, SUS e planos privados de saúde, pelas distintas conjunturas do país. O conflito entre trabalhadores e empresas somado ao desemprego e à precarização do trabalho expõe os limites das coberturas assistenciais privadas e impele a representação sindical a pleitear a intervenção estatal. O trabalho refletiu sobre as distintas modalidades de ação sindical na empresa e no Estado. A complexidade dessa dinâmica fez emergir um setor sindical interessado na gestão da previdência complementar e dos planos de saúde e, ao mesmo tempo, recria as circunstâncias e traz novas possibilidades de as organizações sindicais se colocarem na cena política e aglutinar os interesses de amplos segmentos dos trabalhadores para pressionar o Estado na defesa da melhoria do sistema público de saúde.

  11. Reflexões sobre o papel das unidades de economia da saúde no âmbito de sistemas nacionais de saúde

    Directory of Open Access Journals (Sweden)

    Fabiola Sulpino Vieira

    Full Text Available Resumo O objetivo deste texto é apresentar algumas reflexões sobre o papel e a relevância das unidades de economia da saúde (UES no âmbito de sistemas nacionais de saúde. Parte-se dos fundamentos deste campo de conhecimento e de sua contribuição à gestão em saúde para tecer considerações sobre o papel e a relevância dessas unidades. São discutidas questões como o conhecimento dos gestores da saúde e lideranças políticas sobre economia da saúde, a necessidade de atuação transversal da UES na organização e de corpo técnico multidisciplinar qualificado, assim como a natureza técnica e política do trabalho, as possibilidades e limites para sua atuação, seus aspectos e a relação com grupos externos de pesquisa. Por fim, ressalta-se que o trabalho de equipe interna especializada em economia da saúde constitui um dos meios para qualificar o processo de tomada de decisão nas organizações públicas de saúde, visando à otimização do uso dos recursos e à equidade em sua alocação.

  12. Controle social do Sistema Único de Saúde: o que pensam os conselheiros municipais de saúde

    Directory of Open Access Journals (Sweden)

    Vera Dib Zambon

    2013-12-01

    Full Text Available Desafios estão presentes para a consolidação da participação da comunidade e este estudo objetiva analisar o controle social na perspectiva dos conselheiros municipais de saúde. Trata-se de estudo de abordagem qualitativa utilizando entrevistas semiestruturadas. Identificou-se que alguns conselheiros não reconhecem a participação social como diretriz do Sistema Único de Saúde. Apesar do reconhecimento dos conselhos como espaços deliberativos, identificam-se dificuldades como a centralização das decisões na gestão, a valorização do saber técnico e a não realização de conferências de saúde. Há limitações no efetivo exercício do papel de conselheiro, dificuldade de interlocução com as bases de representação e de acesso a informações. Aponta-se a necessidade de articulação dos conselheiros e capacitações. Conclui-se pela necessidade de valorização dos espaços colegiados instituídos no Pacto pela Saúde, para fortalecimento do controle social, com destaque à educação permanente em saúde.

  13. Estratégia saúde da família e saúde do trabalhador: um diálogo possível?

    Directory of Open Access Journals (Sweden)

    Francisco Antonio de Castro Lacaz

    Full Text Available Reflete-se sobre a omissão de práticas voltadas para a saúde dos trabalhadores no âmbito de atuação da Estratégia Saúde da Família (ESF e propõe-se a inclusão dessas práticas. Considera-se que a mudança do modelo de atenção médico-centrado exige uma nova abordagem que incorpore a análise de elementos da produção de bens, da circulação e do consumo. Fundamenta-se na teoria da determinação social do processo saúde-doença e nas categorias trabalho e reprodução social. Propõe-se que a incorporação da temática Saúde do Trabalhador (ST na ESF seja realizada pela operacionalização de: um instrumento que levante e analise variáveis e indicadores de reprodução social; um sistema de apoio matricial que integre os Centros de Referência em ST com as Unidades Básicas de Saúde; educação permanente das equipes da ESF em conteúdos de ST.

  14. Percepção de gerentes sobre a assistência à saúde coletiva

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    2002-02-01

    Full Text Available Este estudo tem como objetivo conhecer a percepção de gestores e gerentes dos serviços de saúde sobre a assistência à saúde coletiva no contexto do Sistema Único de Saúde (SUS no Distrito Federal (DF. Trata-se de uma pesquisa qualitativa realizada por meio de entrevistas semi-estruturadas com gestores e gerentes da Regional Norte de Saúde do Distrito Federal. Conclui-se que a implantação dos princípios do SUS ainda é um desafio a ser enfrentado, tanto pela comunidade como pelos profissionais de saúde, que precisam unir esforços para encontrar estratégias que redirecionem a assistência à saúde coletiva.

  15. Measurement of the SC magnetic field

    CERN Multimedia

    CERN PhotoLab

    1973-01-01

    The 3.5-metre-arm carrying 100 Hall plates used for the measurmeent of the SC magnetic field. The arm rotates in a horizontal plane, its positioning and the data read-out are controlled by an on-line computer.

  16. Magnet measuring equipment of SC2

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  17. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  18. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  19. Planejamento, gestão e ações à saúde do homem na estratégia de saúde da família

    Directory of Open Access Journals (Sweden)

    Leonardo Peixoto Pereira

    2014-12-01

    Full Text Available Objetivo: Analisar a situação do planejamento, da gestão e das ações de saúde diante da perspectiva de implantação da Política de Atenção à Saúde do Homem na Estratégia de Saúde da Família no município de Jequié. Métodos: Tratou-se de um estudo qualitativo. Entrevistaram-se gestores municipais dos serviços de saúde, profissionais de saúde da Estratégia de Saúde da Família e homens com 25 a 59 anos residentes nas áreas adscritas das unidades de saúde estudadas; realizou-se análise documental do Plano de Saúde e Relatórios de Gestão na Secretaria Municipal de Saúde e análise de conteúdo, modalidade temática. Resultados: Não há atividades assistenciais; de prevenção e promoção à saúde masculina desenvolvidas e os processos de implantação da atenção à saúde do homem encontram-se incipientes. Conclusão: É preciso ampliar o diálogo e reorganizar as estratégias de planejamento e gestão para compreender as reais necessidades masculina e articular com os atores envolvidos a implantação das ações de atenção à saúde do homem.

  20. A Robust Separation Assurance (SA) Architecture Using Integrated Airborne and Ground SA Concepts Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. proposes a robust SA architecture that uses integrated airborne and ground-based SA concepts such that SA functions are switched between...

  1. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  2. A música popular brasileira na construção do conhecimento em Saúde Pública: o tema processo de trabalho e saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    2014-01-01

    Full Text Available Este estudo destaca temas relativos ao trabalho e à saúde na música popular brasileira, especialmente no samba. Tem como objetivo apresentar um corpo de conhecimentos sobre o tema processo de trabalho e saúde. Nas canções selecionadas foram identificadas categorias tomadas como ponto de partida para discussão com a literatura. Com o desenvolvimento do texto, percebe-se o manancial da canção popular para proporcionar conteúdos sobre múltiplas dimensões do processo de trabalho e do processo saúde-doença dos trabalhadores, inclusive a dimensão coletiva e histórica da luta pelo direito à saúde. Esta pesquisa resultou na valorização da música popular brasileira como uma forma de se entenderem as relações trabalho-saúde e de se desenvolver conhecimento em Saúde Coletiva.

  3. Percepções e atuação do Agente Comunitário de Saúde em saúde mental

    Directory of Open Access Journals (Sweden)

    Maria Angélica Pagliarini Waidman

    2012-10-01

    Full Text Available Este estudo teve como objetivo identificar as percepções de Agentes Comunitários de Saúde acerca de saúde e transtorno mental, bem como verificar o preparo desses agentes para atuar na área. Trata-se de uma pesquisa qualitativa que utilizou como técnica de coleta de dados a entrevista semiestruturada e, para interpretação dos dados, a técnica de análise de conteúdo. Foram entrevistados 45 Agentes Comunitários de Saúde da Estratégia Saúde da Família, pertencentes às 21 unidades básicas de saúde do município de Maringá, PR. Os resultados obtidos demonstram os preconceitos em relação ao transtorno mental desses profissionais, que reconhecem a importância de se trabalhar tanto com o portador quanto com a família, mas não se sentem capacitados para prestar uma assistência adequada. Por compartilharem o mesmo contexto social e por conhecerem de perto a dinâmica da comunidade, vislumbramos os agentes como importantes facilitadores no cuidado à saúde mental.

  4. Práticas de cuidado à saúde de mulheres camponesas

    Directory of Open Access Journals (Sweden)

    Iraí Maria de Campos Teixeira

    2014-12-01

    Full Text Available O presente artigo apresenta resultados de pesquisa acerca de práticas de cuidado à saúde de mulheres camponesas do Assentamento Monte Alegre VI – SP. A metodologia, qualitativa, constou de observação participante, entrevistas individuais e coletivas, tendo ocorrido 15 visitas no período de abril de 2010 a julho de 2011. Participaram doze moradoras, das quais, seis agentes comunitárias de saúde. As práticas de cuidado à saúde referem-se a: companheirismo, diálogo, escuta ativa, mobilizações sociais, assistência multiprofissional dos serviços de saúde, uso de plantas medicinais, crença religiosa como apoio social e dietas. Tais práticas somam-se e articulam-se. As participantes ensinam e aprendem sobre o cuidado à saúde nas relações entre elas, nas intergeracionais e nas com os profissionais de saúde, além de recorrerem a outras fontes de informação e outros processos formativos específicos, como do Programa Saúde da Família.

  5. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Garcia Eloi S.

    1995-01-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  6. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  7. Scénario pédagogique et efficacité des instruments de communication

    Directory of Open Access Journals (Sweden)

    Stéphane Simonian

    2008-01-01

    Full Text Available Cette recherche traite de l’efficacité des scénarii pédagogiques au sein de deux formations universitaires en ligne et à distance, en se basant sur une approche enseignement. La littérature positionne de plus en plus les scénarii pédagogiques dans le modèle socioconstructiviste pour favoriser les interactions. Notre question porte alors sur la pertinence des instruments de communication (courriel, forum, clavardage en fonction des usages. Notre étude tend à montrer qu’une affordance dans l’usage des instruments de communication dépend d’un scénario pédagogique, lui-même basé sur une activité collaborative dans une durée assez courte.

  8. Le Corps Performatif: les enjeux des scènes contemporaines

    Directory of Open Access Journals (Sweden)

    Sylvie Roques

    2017-01-01

    Full Text Available Cet article présente la mise en perspective d’une recherche d’une dizaine d’années, faisant croiser le regard sur le texte dramatique porteur de représentations corporelles, et l’examen de formes scéniques actuelles où la présence du corps est indéniable. S’il est impossible de limiter le théâtre au texte, notre position est qu’il est aussi impossible d’y échapper. La première partie met en perspective une analyse textuelle d’un corpus de textes contemporains européens révélant nombre de représentations corporelles. La seconde partie interroge la chair des mots car la parole est une matérialité tangible, porteuse d’une originalité particulière. La troisième partie est consacrée enfin aux formes performances émergeantes sur les scènes européennes où le corps acquiert toute sa densité et sa force.

  9. Estado nutricional de trabalhadores que atuam na estrat?gia de sa?de da fam?lia na cidade de Manaus-AM, 2010

    OpenAIRE

    Moura, Josimara Fernandes de

    2011-01-01

    Introdu??o: As taxas se sobrepeso e obesidade vem aumentando nos ?ltimos anos e pouco se sabe dessa tend?ncia em trabalhadores da Estrat?gia de Sa?de da Fam?lia. Objetivo: Avaliar o estado nutricional de trabalhadores que atuam na estrat?gia de sa?de da fam?lia na cidade de Manaus-AM, 2010. Metodologia: A pesquisa foi conduzida, no per?odo de maio a outubro de 2010, selecionando-se o censo dos trabalhadores da Estrat?gia de Sa?de da Fam?lia do Distrito de Sa?de Sul, a saber:...

  10. Dialogia do riso: um novo conceito que introduz alegria para a promoção da saúde apoiando-se no diálogo, no riso, na alegria e na arte da palhaçaria Dialogy of Laughter: a new concept introducing joy for health promotion based on dialogue, laughter, joy and the art of the clown

    Directory of Open Access Journals (Sweden)

    Marcus Vinicius Campos Matraca

    2011-10-01

    Full Text Available Apresentamos e debatemos a Dialogia do Riso, um conceito baseado na prática da educação popular em saúde desenvolvida com alegria. Saúde entendida como um recurso para a vida e não como um objetivo de viver; promoção da saúde como uma reação positiva que leva a uma percepção ampliada, integrada, complexa e intersetorial: articula ambiente, educação, pessoas, estilo e qualidade de vida. O riso pode então ser incorporado como ferramenta de promoção da saúde, tese que defendemos. Para isso apresentamos considerações sobre o diálogo, o riso, a alegria e o palhaço, conceituando a Dialogia do Riso. O diálogo, fala entre duas ou mais pessoas para entendimento de alguma ideia mediada pela comunicação, é uma metodologia de reflexão conjunta, que visa melhorar a produção de novas ideias e compartilhar significados, essência da comunicação. O riso é um fenômeno universal, condicionado a aspectos da cultura, da filosofia, da história e da saúde; é dialógico, porque, através do humor nos deparamos com a comédia e o escárnio que existe por traz de cada riso, um código de comunicação inerente à natureza humana. Arrolamos argumentos para defender a alegria como estratégia para a promoção da saúde, e adotamos o palhaço, e usamos sua arte como ferramenta educacional que pode ser integrada como tecnologia social.The Dialogy of Laughter - a concept based upon the praxis of general health education performed with joy - is presented and discussed. Health is seen as a resource for life rather than a goal in life and promotion of health is a positive reaction leading to a broader, integrated and complex perception linking the environment, education, people, quality and style of life. Laughter can then be incorporated as a tool in health promotion as defended here. Considerations on dialogue, laughter, joy and the clown giving rise to the Dialogy of Laughter concept are presented. Dialogue, namely an exchange between

  11. ANALISIS DAYA SAING KEDELAI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sarwono Sarwono

    2014-09-01

    Full Text Available RCA (Revealed Comparative Advantage index of soybean in Indonesia from 1983 up to 2013 is less than one, mostly. It means that the competitiveness of soybean in Indonesia is low. The purpose of this study is to analyze the factors influence the soybean competitiveness. OLS (Ordinary Least Square was used as the analysis method. Hypotheses test based on that analysis model is not bias, so that, classic divergence test is needed. It is for getting the Best Linier Unbiased Estimator (BLUE appraisal. T statistic and F statistic were also applied. The result of this research shows that production and export have positive and significant influence. In addition, exchange rate and government policy do not influence the Indonesia soybean competitiveness.Indeks RCA (Revealed Comparative Advantage kedelai Indonesia dari tahun 1983-2013 kecenderungan bernilai kurang dari satu yang berarti daya saing kedelai Indonesia rendah.Penelitian ini bertujuan untuk menganalisis faktor-faktor yang mempengaruhi daya saing kedelai Indonesia.Metode analisis yang digunakan adalah Ordinary Least Square (OLS.Pengujian hipotesis berdasarkan model analisis tersebut tidak bias maka perlu dilakukan uji penyimpangan klasik yang tujuannya agar diperoleh penaksiran yang bersifat Best Linier Unbiased Estimator (BLUE.Pengujian statistik menggunakan uji t statistikdan uji f statistik.Hasil penelitian ini menunjukkan bahwa produksi dan ekspor berpengaruh secara positif dan signifikan terhadap daya saing kedelai Indonesia. Nilai tukar rupiah dan kebijakan pemerintah tidak berpengaruh terhadap daya saing kedelai Indonesia.

  12. Abuso sexual infanto-juvenil: a atuação do programa sentinela na cidade de Blumenau/SC

    Directory of Open Access Journals (Sweden)

    Glauco Anderson Espindola

    Full Text Available A violência sexual contra crianças e adolescentes é um problema de saúde pública que exige uma intervenção adequada. O presente estudo teve como objetivo identificar a atuação do Programa Sentinela, da cidade de Blumenau/SC, diante da violência sexual infanto-juvenil e mapear seus fatores de assistência e de vulnerabilidade. A metodologia empregada foi a análise documental das intervenções realizadas pelo programa. O estudo foi composto por 30 prontuários relativos a todas as crianças e adolescentes em situação de violência sexual atendidos pelo Sentinela que foram desligados do programa no segundo semestre de 2009. Os resultados apontam o programa como uma ferramenta contra a violência sexual infanto-juvenil, mas, da mesma forma, demonstram que ele necessita de melhorias. Entre os fatores de assistência, observouse a credibilidade do Sentinela, o atendimento aos cuidadores das crianças e adolescentes, a variedade de intervenções e a articulação entre aspectos psicológicos, sociais e legais. Verificou-se, por outro lado, a falta de comunicação entre as instituições para articular as medidas de proteção necessárias, o não planejamento das intervenções, a não realização de intervenção com o autor da violência e a ausência de informações em alguns prontuários como fatores de vulnerabilidade.

  13. Nas Trilhas (desconhecidas da saúde: a política pública de saúde para os homens no Brasil.

    Directory of Open Access Journals (Sweden)

    Marlene Neves Strey

    2012-11-01

    Full Text Available Neste estudo abordamos as diferentes formas de masculinidades e sua relação com a saúde, contempladas na Política de Atenção Integral à saúde do Homem (PNAISH implementada no Brasil no ano de 2009. Através de uma análise documental dessa política, pretendemos compreender os discursos masculinos que nela estão, bem como analisar a relação entre o discurso da política e as diferentes formas de produção de saúde. Devido a não estarem acostumados a se expor a um profissional de saúde, os homens sentem-se envergonhados, e além disso, atribuem sua baixa procura aos serviços de saúde, à falta de cuidados e escuta adequadas com um olhar de gênero que possa dar conta de suas demandas. Essa nova política de saúde para os homens criada no Brasil pretende atuar de maneira a atingir uma mudança cultural, que possibilite aos homens maior cuidado com sua saúde. Além disso, olhar para os modos de produção de masculinidades nos dias atuais e seus discursos sobre saúde é estar atento aos comportamentos que, devido à herança pautada nas diferenças entre os sexos, contribui para obstaculizar o acesso dos homens aos serviços de saúde.

  14. A política de saúde bucal em pauta no Conselho Municipal de Saúde no Município de Nova Friburgo - RJ

    Directory of Open Access Journals (Sweden)

    Rafael Gomes Ditterich

    Full Text Available Objetivo O presente estudo teve como objetivo analisar, por meio dos documentos técnicos do Conselho Municipal de Saúde (CMS, a organização dos serviços de saúde bucal no Município de Nova Friburgo - RJ, a partir da institucionalização da Política Nacional de Saúde Bucal. Metodologia Para a análise documental, utilizou-se o registro de frequência e categorização por assunto: saúde bucal das atas do CMS de junho/2006 a agosto/2011, do Plano Municipal de Saúde de 2003-2005 e 2010-2013, e os documentos encaminhados entre 2005 e 2011. Resultado Os registros analisados até 2012 indicaram que a população estava desassistida na questão da média complexidade, como também no acesso à água fluoretada. As equipes de saúde bucal ainda não tinham sido qualificadas e ampliadas, como é bem colocado como prioridade no Brasil Sorridente. O Município ainda não desenvolvia programas de prevenção e promoção de saúde bucal de forma contínua e efetiva. Conclusão Concluiu-se que a Política Nacional de Saúde Bucal, até o ano de 2012, não tinha ainda reflexo nas ações de saúde bucal em Nova Friburgo.

  15. Saúde e desenvolvimento

    Directory of Open Access Journals (Sweden)

    Ana Luiza D'Ávila Viana

    Full Text Available Considerando que os modernos sistemas de saúde são o resultado da complexa interação de processos econômicos, políticos e sociais, o objetivo do trabalho é discutir a relação entre saúde e desenvolvimento no Brasil, mostrando que o esgotamento do modelo liberal de política econômica abre nova perspectiva para a retomada do desenvolvimento, entendido como combinação entre crescimento da economia, mudanças na estrutura produtiva e melhora das condições de vida da população. O complexo produtivo da saúde joga papel decisivo nesse processo, pois constitui um campo em que inovação tecnológica e acumulação de capital geram oportunidades de investimento, trabalho e renda, além de produzir avanços importantes para melhorar o estado de saúde das pessoas. A recente adoção de políticas públicas voltadas para articular, de forma positiva, aspectos da política econômica e da política social revela que a questão do desenvolvimento nacional ganhou nova centralidade na agenda governamental, o que abre a perspectiva de maior integração entre a lógica econômica e a lógica sanitária. Entretanto, é preciso reconhecer que o Brasil ainda não logrou alcançar uma associação virtuosa entre saúde e desenvolvimento.

  16. Comunicação entre usuários e trabalhadores de saúde em colegiados de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Marcelen Palu Longhi

    2013-02-01

    Full Text Available Atualmente, têm sido observados problemas relativos à comunicação nos fóruns de participação social da saúde. O presente estudo tem o objetivo de analisar a comunicação entre usuários e trabalhadores de saúde, em colegiados da Saúde da Família. O referencial teórico utilizado foi a Teoria da Ação Comunicativa de Habermas. Realizou-se uma pesquisa qualitativa. Os dados coletados revelaram duas dimensões que se entrelaçavam: distanciamentos e aproximações entre usuários e trabalhadores de saúde. Quanto aos distanciamentos, destacaram-se a presença de relações assimétricas, de coerção e de manipulação por parte dos trabalhadores de saúde, processos que prejudicam a participação dos usuários. Por outro lado, estiveram presentes momentos de interação e lutas por direitos, abordados nas aproximações entre usuários e trabalhadores de saúde. Por fim, consideramos que a comunicação nos colegiados da Saúde da Família apresenta potencialidades e limites, sendo que estes devem ser problematizados, especialmente, por meio da educação permanente em saúde.

  17. Precipitation hardening in ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems

    Energy Technology Data Exchange (ETDEWEB)

    Kharakterova, M.L.; Eskin, D.G.; Toropova, L.S. (Russian Academy of Sciences, Moscow (Russian Federation). A.A. Baikov Inst. of Metallurgy)

    1994-07-01

    The processes of precipitation hardening in cast ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems were studied in the temperature range of aging from 100 to 450 C and at exposures to 200 h. It was shown that the CuAl[sub 2] and ScAl[sub 3] phases were involved in the process of aging in ternary Al-Sc-Cu alloys, and the Si and V (AlSiSc) phases, in ternary Al-Sc-Si alloys with excess silicon in a supersaturated solid solution. The V phase was for the first time revealed as the hardening phase in aluminum alloys.

  18. Aprendem doença, educam para a saúde : influência da formação, em futuros profissionais de saúde em concepções saúde/doença, educação para a saúde e sua implementação

    OpenAIRE

    Araújo, Isabel Maria Batista de

    2004-01-01

    Dissertação de mestrado em Educação, área de especialização em Educação para a Saúde Sucessivas reuniões internacionais apelam à implementação de actividades de educação para a saúde, apoiando-se na evolução do conceito de saúde, entendido como um recurso, um estado positivo de bem-estar individual e comunitário. Perspectivam a educação para a saúde como processo de capacitar os indivíduos e comunidades a aumentar o controlo sobre os factores que determinam a saúde através de diferentes me...

  19. 75 FR 19193 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-04-14

    ...-063-AD; Amendment 39-16257; AD 2010-08-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-08-02 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16257... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, -100 SU, -200...

  20. 75 FR 14333 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and...

    Science.gov (United States)

    2010-03-25

    ...-055-AD; Amendment 39-16248; AD 2010-07-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... by adding the following new AD: 2010-07-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER... applies to Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE,...

  1. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  2. Reduced-Latency SC Polar Decoder Architectures

    CERN Document Server

    Zhang, Chuan; Parhi, Keshab K

    2011-01-01

    Polar codes have become one of the most favorable capacity achieving error correction codes (ECC) along with their simple encoding method. However, among the very few prior successive cancellation (SC) polar decoder designs, the required long code length makes the decoding latency high. In this paper, conventional decoding algorithm is transformed with look-ahead techniques. This reduces the decoding latency by 50%. With pipelining and parallel processing schemes, a parallel SC polar decoder is proposed. Sub-structure sharing approach is employed to design the merged processing element (PE). Moreover, inspired by the real FFT architecture, this paper presents a novel input generating circuit (ICG) block that can generate additional input signals for merged PEs on-the-fly. Gate-level analysis has demonstrated that the proposed design shows advantages of 50% decoding latency and twice throughput over the conventional one with similar hardware cost.

  3. Analysis of the factors affecting the choice of profession of the first and last students at nursing department in school of healthSağlık yüksekokulu hemşirelik bölümü ilk ve son sınıf öğrencilerinin meslek seçimini etkileyen faktörlerin incelenmesi

    Directory of Open Access Journals (Sweden)

    Gül Ergün

    2016-03-01

    Full Text Available The choice of profession made a conscious person directly affects the success and job satisfaction in the profession.This study carried out descriptive for determine factors that influence the choice of profession of nursing students in the first and last grade a nursing department of school of health. Research was carried out with the participation of students in the first and last grades in the nursing department of a university health school in March. Population of the study constituted by first and final grades students in health school nursing department (including 140 first grade, 87 last grade,  total of 227 students. The sample was determined as population. Data of the research was collected with The Scale of Nurse Career Choise (HMSÖ which developed originally by Zysberg and Berry, Turkish validity and reliability made by Önler and Saraçoğlu (2010 and survey questions (13 questions that created to by the researchers review the literature to determine the Socio-demographic features. The data was analyzed in SPSS 15 package program by frequency, percentiles and average.The students participating in survey 132 are female and 58 are male. Of students 58.4% first grade, 41.6% the fourth grade. At the preference of the profession the mean scores of the item" I always has wanted to help people." was found to be 98% first grades and 90% in the fourth grades. The item “There is no unemployment in nursing” was scored a very high rate in both groups (First-grade; x=82.883, fourth grade; x=82.279. According to the results of the research; The reasons for choosing the profession of nursing are found opinion not to be unemployed after graduation and a profession that provide opportunity to help people.   Özet Bilinçli olarak yapılan meslek seçimi kişinin meslekteki başarısını ve iş doyumunu doğrudan etkiler. Bu çalışma bir üniversitesin sağlık yüksekokulu hemşirelik bölümü ilk ve son sınıf öğrencilerinin meslek se

  4. Single chain Fab (scFab fragment

    Directory of Open Access Journals (Sweden)

    Brenneis Mariam

    2007-03-01

    Full Text Available Abstract Background The connection of the variable part of the heavy chain (VH and and the variable part of the light chain (VL by a peptide linker to form a consecutive polypeptide chain (single chain antibody, scFv was a breakthrough for the functional production of antibody fragments in Escherichia coli. Being double the size of fragment variable (Fv fragments and requiring assembly of two independent polypeptide chains, functional Fab fragments are usually produced with significantly lower yields in E. coli. An antibody design combining stability and assay compatibility of the fragment antigen binding (Fab with high level bacterial expression of single chain Fv fragments would be desirable. The desired antibody fragment should be both suitable for expression as soluble antibody in E. coli and antibody phage display. Results Here, we demonstrate that the introduction of a polypeptide linker between the fragment difficult (Fd and the light chain (LC, resulting in the formation of a single chain Fab fragment (scFab, can lead to improved production of functional molecules. We tested the impact of various linker designs and modifications of the constant regions on both phage display efficiency and the yield of soluble antibody fragments. A scFab variant without cysteins (scFabΔC connecting the constant part 1 of the heavy chain (CH1 and the constant part of the light chain (CL were best suited for phage display and production of soluble antibody fragments. Beside the expression system E. coli, the new antibody format was also expressed in Pichia pastoris. Monovalent and divalent fragments (DiFabodies as well as multimers were characterised. Conclusion A new antibody design offers the generation of bivalent Fab derivates for antibody phage display and production of soluble antibody fragments. This antibody format is of particular value for high throughput proteome binder generation projects, due to the avidity effect and the possible use of

  5. Novel red-emission of ternary ZnCdSe semiconductor nanocrystals

    Science.gov (United States)

    Chung, Shu-Ru; Wang, Kuan-Wen; Chen, Hong-Shuo; Chen, Hong-Hong

    2015-02-01

    The effect of chain lengths of fatty acids on the physical properties of CdSe and ZnCdSe semiconductor nanocrystals (NCs) synthesized by the colloidal chemistry procedure is investigated. The fatty acids, lauric acid (LA), and stearic acid (SA), with different lengths of carbon chains, are used to prepare CdSe and ZnCdSe NCs when hexyldecylamine (HDA) is applied as the sole surfactant. For CdSe-SA and ZnCdSe-SA, they have the same emission wavelength at 592 nm and the same particle size of 3.3 nm; however, their quantum yield (QY) is 75 and 16 %, respectively. In contrast, the emission wavelength of CdSe-LA and ZnCdSe-LA NCs is 609 and 615 nm, the particle size is about 3.5 and 4 nm under the same reaction time, and the QY of them are 33 and 59 %, respectively. The X-ray diffraction pattern shows that ZnCdSe NCs all have the wurtzite structure, and their main peaks are located between those of pure CdSe and ZnSe materials. The main phase of ZnCdSe-SA and ZnCdSe-LA is ZnSe and CdSe, respectively, implying that alloyed ZnCdSe NC can be prepared and ZnSe and CdSe phase can be promoted by SA and LA, respectively. Moreover, the QY of red-emission ZnCdSe-LA is higher than 50 %. These results suggest that the growth rate of CdSe as well as ZnCdSe NC can be enhanced by using LA as complex reagent and HDA as sole surfactant. It is expected that the reported effective synthetic strategy can be developed as a very practical, easy and not time-consuming approach to prepare red emissive NCs with high QY and high reproducibility.

  6. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Christiane Gasparini Araújo Costa

    2015-10-01

    Full Text Available ResumoA agricultura urbana e periurbana (AUP vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS, enquanto uma atividade de Promoção da Saúde (PS, e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abordagem qualitativa no município de Embu das Artes, SP. Da análise, emergiram as seguintes categorias: concepção de saúde, resultados na saúde, resgate de práticas e hábitos tradicionais e reorientação dos serviços de saúde. Identificou-se a estreita ligação entre a prática das hortas e as diretrizes e campos de ação da PS como: criação de ambientes saudáveis, reforço da ação comunitária, desenvolvimento de habilidades pessoais, estímulo à autonomia e empoderamento e demandas por reorientação dos serviços. As atividades de horta instituídas nas UBS se mostraram uma estratégia de implementação das práticas integrativas e complementares (PIC. Conclui-se que as atividades de cultivo nas hortas comunitárias mostram-se como práticas promotoras da saúde que integram elementos fundamentais das PIC.

  7. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  8. O sistema social da saúde: conceito, limites e possibilidades

    Directory of Open Access Journals (Sweden)

    Sandra Regina Martini Vial

    2014-06-01

    Full Text Available Discutem-se as possibilidades de definir o sistema da saúde como um sistema social, diferenciado funcionalmente, a partir da ótica da Teoria dos Sistemas Sociais, utilizando os pressupostos gerais da Teoria e a estrutura apresentada por Niklas Luhmann sobre o sistema médico. Apresentam-se alguns “desassossegos” provocados pela Teoria; as possíveis relações entre o sistema da saúde e o que Luhmann chamou de sistema médico e como esse sistema, atualmente, pode ser considerado sistema da saúde; e, por fim, a nossa concepção do sistema da saúde na atualidade.

  9. A formação de recursos humanos em odontologia e as exigências do setor público: uma contribuição para serviços de saúde públicos e de qualidade = The development of human resources in dentistry and the demands of the public sector: a contribution for health’s services publics and with quality

    Directory of Open Access Journals (Sweden)

    Lazeris, Andréa Manente

    2007-01-01

    Full Text Available Necessário se faz investigar melhor a estrutura em que se fundamenta a odontologia convencional e o setor saúde em geral, analisando suas contradições e compreender as relações entre prática, educação e investigação em saúde, e os modos de produção econômica, bem como qualificar a relativa autonomia das instituições de ensino. O objetivo geral do presente estudo é avaliar a formação de recursos humanos em odontologia e frente às exigências do setor público. Foi realizada pesquisa aplicada, quantitativa e exploratória, sendo classificada como tipicamente de campo, caracterizando-se como um estudo de caso. Foi aplicado um questionário entre os cirurgiões-dentistas que trabalham no Serviço Público de Saúde do município de Itajaí-SC. Foram analisados os procedimentos realizados no município e na instituição formadora a Universidade Federal de Santa Catarina. A estabilidade salarial para 97,4% é o principal motivo para o exercício profissional em serviço público. Todo o trabalho é realizado sem Auxiliar de Consultório Dentário, apesar de a maioria se considerar apto para trabalhar a quatro mãos quando se formou, (69,23%. 84,6% informaram não haver incentivo para aperfeiçoamento ou treinamento pela Secretaria Municipal de Saúde de Itajaí/SC. A maioria dos profissionais sugere que existe necessidade de alterações na formação atual de odontologia, no sentido de um aperfeiçoamento com as questões éticas, sociais, humanísticas e de integração. Quanto à natureza do trabalho executado os resultados contrastantes sugerem indicar filosofias de tratamento opostas, revelando um predomínio da visão curativa e reabilitadora em relação à preventiva no exercício público da profissão por parte do município

  10. Caso Molinos Roa S.A.: historia empresarial

    OpenAIRE

    2013-01-01

    Durante su trayectoria empresarial Molinos Roa S.A. ha enfocado sus estrategias gerenciales al logro de objetivos basados en principios y valores corporativos, por lo anterior el documento presenta el estudio de la historia empresarial, donde se da un reflejo de la pujanza y la visión de gestores y administradores. Sin embargo se analiza el impacto que trae en el negocio de la industria arrocera la firma de los tratados de libre comercio, así como el contrabando desmedido de este cereal y el ...

  11. An??lise das percep????es de professores e profissionais de sa??de sobre pr??ticas educativas em sa??de: subs??dios para a estrat??gia integrada de preven????o da dengue.

    OpenAIRE

    Assis, Sheila Soares de

    2012-01-01

    A dengue integra o conjunto de doen??as negligenciadas, constituindo-se como um grave problema de sa??de p??blica em todo o mundo, inclusive no Brasil. A abordagem dos aspectos relacionados ao processo sa??de-doen??a ?? uma responsabilidade partilhada entre os servi??os de sa??de e os de educa????o. No ensino formal, os temas relacionados ?? sa??de devem ser tratados de forma transversal. Entretanto, historicamente a responsabilidade da abordagem deste tema tem reca??do sobre os componentes c...

  12. Varyasyong Leksikal sa mga Dayalektong Mandaya

    Directory of Open Access Journals (Sweden)

    Dr. Raymund M. Pasion

    2014-12-01

    Full Text Available Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP.Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuhayan ng Mandaya na makikita sa munisipalidad ng Caraga, Manay, Bagangaat Cateel? Disenyong kwalitatibo ginamit.Metodong indehinusat deskriptibo naman ang ginamit mula sa paglilikom hanggang sa pag-aanalisa ng mga datos. Samantalang, ang mga impormante ay pinilisa pamamagitan ng kombinasyong purposive at snow-ball sampling. Natuklasan, na ang wikang Mandaya ay nakitaan ng varyasyong lekisikal ayon sa magkakaiba ang anyo, may pagkakatulad ang anyo, at magkakatulad ang anyo subalit magkakaiba ang bigkas. Gayunpaman, pinaniniwalaang dahil sa paktor na heograpikal, sikolohikal at sosyolohikal na nagaganap sa kanilang kultura ay hindi rin maipagkailang nagyari ang varyasyong leksikal na aspekto nito.

  13. Homossexualidade e o direito à saúde: um desafio para as políticas públicas de saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Grayce Alencar Albuquerque

    Full Text Available Objetivou-se evidenciar a atuação das políticas públicas direcionadas à saúde da população homossexual brasileira. Trata-se de uma revisão integrativa da literatura, realizada na Scientific Eletronic Library Online (SciELO e na Literatura Latino-Americana e do Caribe em Ciências da Saúde (Lilacs, utilizando os Decs: políticas públicas, assistência integral à saúde e homossexualidade. A saúde LGBT é apontada como vulnerável mesmo após a publicação de importantes documentos que garantem o acesso e a inclusão do grupo na saúde. A fragilidade na efetivação das propostas preconizadas vão ao encontro ao atendimento discriminatório e heteronormativo prestado pelos profissionais de saúde.

  14. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  15. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    2012-12-01

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  16. Análisis factorial confirmatorio del Cuestionario SA-45 en una muestra mexicana

    OpenAIRE

    2012-01-01

    El objetivo de la presente investigación consistió en examinar la estructura factorial, la fiabilidad y los datos normativos del Cuestionario SA-45 (Symptom Assessment-45) en una muestra de estudiantes universi-tarios mexicanos. Como se predijo, los análisis factoriales confirmatorios indicaron que el modelo de nueve factores proporcionaba el mejor ajuste del SA-45. Así mismo, los datos demostraron buenos niveles de fiabilidad (consistencia interna) del cuestionario. Los datos normativos most...

  17. A revista Saúde em Debate como fonte e objeto de estudo

    OpenAIRE

    Sophia,Daniela Carvalho

    2013-01-01

    A presente nota de pesquisa busca divulgar estudo sobre o Centro Brasileiro de Estudos da Saúde e o movimento de reforma sanitária desenvolvido no âmbito do Programa de História das Ciências e da Saúde Pública da Casa de Oswaldo Cruz. Atém-se à revista Saúde em Debate , periódico do Centro, devido à relevância que teve na área ao longo dos dez anos de publicação. A utilização da revista na pesquisa deu ...

  18. Qualidade em saúde: que trajetos de formação dos enfermeiros?

    OpenAIRE

    Pinho, Carla Amorim

    2012-01-01

    ENQUADRAMENTO: A avaliação da qualidade dos serviços de saúde, a crescente melhoria do desempenho dos profissionais, e a monitorização sistemática das atividades desenvolvidas pelas instituições de saúde, potenciam a qualidade dos cuidados prestados. A intervenção dos enfermeiros e dos restantes profissionais de saúde é imprescindível na promoção desta qualidade conforme defendem os diversos modelos da sua gestão. Para a generalidade destes, considera-se que a supervisão clí...

  19. A autonomia do paciente no processo terapêutico como valor para a saúde

    OpenAIRE

    Jussara Calmon Reis de Souza Soares; Kenneth Rochel de Camargo Jr.

    2007-01-01

    No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomi...

  20. Contribuições do PET-Saúde/Redes de Atenção Psicossocial à Saúde da Família

    Directory of Open Access Journals (Sweden)

    Larissa de Almeida Rézio

    2015-12-01

    Full Text Available O estudo objetivou analisar as contribuições do Programa de Educação pelo Trabalho para a Saúde – PET-Saúde/Redes de Atenção Psicossocial à Saúde - a uma unidade de Estratégia de Saúde da Família em Cuiabá, Mato Grosso, Brasil. Trata-se de um estudo descritivo, com abordagem qualitativa, utilizando entrevista com cinco profissionais de saúde e dois acadêmicos bolsistas e registros de atividades realizadas no serviço. À luz da análise de conteúdo temática, sistematizamos quatro subtemas: “articulação da rede”; “qualificação da assistência à saúde mental”, “melhora do conhecimento dos profissionais” e “superação de estigmas sobre o paciente em sofrimento psíquico”. Houve sensibilização dos profissionais e bolsistas sobre a importância do acompanhamento das pessoas com sofrimento mental na atenção básica, em articulação com serviços de saúde mental.

  1. A Motivação dos Profissionais de Saúde das Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Antônio Alves Filho

    Full Text Available Relata-se pesquisa que objetivou estudar a motivação para o trabalho dos profissionais de saúde vinculados às Unidades Básicas de Saúde do município de Natal. Compreendeu-se a motivação como um processo e aplicou-se a Teoria das Expectativas que a considera como um fenômeno processual e envolve cinco componentes: resultados do trabalho, expectativa, valên-cia, instrumentalidade e força motivacional. Entendeu-se também a motivação como um fenômeno relacionado com o contexto de trabalho e adotou-se a perspectiva psicossociológica. Aplicou-se o Inventário da Motivação e Significado do Trabalho, identificando-se os fatores que mais contribuem, bem como os que enfraquecem a força motivacional dos profissionais de saúde. Conclui-se que a maioria dos profissionais apresentou força motivacional moderada e em queda, por vivenciarem e perceberem um contexto deteriorado com condições de trabalho desfavoráveis.

  2. Eventos de massa, desastres e Saúde Pública

    Directory of Open Access Journals (Sweden)

    Camilla Figueiredo de Castro

    2014-09-01

    Full Text Available O Brasil tem sediado eventos de massa (EM e seus participantes estão sujeitos a riscos à saúde. Objetivou-se sistematizar as principais relações, de interesse da Saúde Pública, entre eventos de massa e ocorrência de desastres. Foram realizadas três estratégias metodológicas: revisão da literatura de EM, com busca sistemática, sistematização das principais informações sobre EM e seleção e sistematização das Referências que tratavam do tema desastre em suas palavras-chave, título ou Resumo. Foram selecionadas 28 Referências sobre EM, a maioria artigo científico, revisão de literatura, de 2012 e de natureza esportiva. Os principais assuntos abordados foram sistemas de vigilância e planejamento dos EM. Evidenciou-se a pouca informação analítica sobre os EM, bem como a importância de eventos não transmissíveis para a ocorrência de desastres, com destaque aos relacionados à multidão. O risco de desastres deve ser considerado no planejamento dos EM, para aumentar a capacidade de resposta considerando áreas estratégicas como: emergência médica, vigilância de doenças transmissíveis e vetores, segurança alimentar e dos serviços de saúde, saúde ambiental e laboratório. Ressalta-se a importância de pesquisas analíticas e de registro das experiências relacionadas aos EM, para a redução de risco de desastres.

  3. A autonomia do paciente no processo terapêutico como valor para a saúde

    Directory of Open Access Journals (Sweden)

    Jussara Calmon Reis de Souza Soares

    2007-04-01

    Full Text Available No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomia caracteriza-se como relativa e relacional, inseparável da dependência. É também condição necessária para a saúde, compreendida em seu sentido mais amplo, como potência auto-recuperadora do organismo humano. Assim, autonomia passa a ser um valor fundamental a ser resgatado e defendido tanto na clínica, quanto no campo das ciências humanas e sociais em saúde. Discutem-se implicações do resgate da autonomia, ainda que como um vir-a-ser, como precondição para a saúde e a cidadania, para a própria vida.

  4. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  5. Quand l’idée fixe se met « à table »

    Directory of Open Access Journals (Sweden)

    Cécile de Bary

    2008-03-01

    Full Text Available Un livre de cuisine, comme A table de Claudian, édité en 1963, peut relever de la prose d’idées dans la mesure où son projet est sous-tendu par une idéologie très précise, qui seule lui donne sa cohérence. Si l’ethnocentrisme consiste à ne pas reconnaître à l’autre une culture, par exemple, ce livre apparaît comme ethnocentrique, puisqu’il a pour projet de départager les peuples qui savent et ceux qui ne savent pas. Il est encore réactionnaire, voué au rétablissement des savoir-faire des terroirs, contre les corruptions parisiennes en particulier. Dès lors, la présentation d’un plat est toujours susceptible de s’étendre ou de se faire discours, sous la poussée d’un lyrisme acrimonieux. Pour autant, il ne s’agit pas d’un faux livre de cuisine, d’un traité ou d’une « physiologie ». La recette est l’aboutissement logique de l’idée fixe. Elle est le lieu d’une bataille que l’argumentation sert, qu’elle met en scène et qu’elle prépare.

  6. Dinâmica do capital e sistemas locais de saúde: em busca de uma análise integradora do setor saúde

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Siliansky de Andreazzi

    2006-06-01

    Full Text Available Apresenta-se uma proposta metodológica direcionada à análise dos determinantes da oferta de atenção à saúde, com base na dinâmica da acumulação de capital a ser agregada aos elementos de definição das políticas de saúde mais convencionalmente empregados na área da Saúde Coletiva. A análise está baseada nos conceitos e métodos da Economia Industrial, já testados para o setor saúde em trabalhos desenvolvidos no âmbito europeu e por pesquisadores da CEPAL, aos quais se propõem agregar variáveis do contexto geral, que condicionam possibilidades e impõem limites às estratégias dos agentes locais, e análises de corte histórico que permitam identificar rugosidades. Destina-se a apoiar os gestores do SUS, estaduais e municipais, na sua atribuição de comando único do setor saúde sobre um determinado território, o que inclui o conjunto das possibilidades de regulação do setor privado - do planejamento da oferta ao controle de qualidade.

  7. Saúde Ambiental e Atenção Primária à Saúde nos microterritórios: a taxa de mortalidade infantil para subsidiar a atuação da equipe de saúde Salud Ambiental y Atención Primaria de Salud en los microterritorios: la tasa de mortalidad infantil para orientar los trabajos del equipo de salud Environmental Health and Primary Health Care in micro-territories: the infant mortality rate as a guide for the healthcare team

    Directory of Open Access Journals (Sweden)

    Angelo Borsarelli Carvalho de Brito

    2013-06-01

    Full Text Available Nos últimos 20 anos, o Sistema Único de Saúde no Brasil vem avançando no aprimoramento da atenção primaria e da vigilância em saúde ambiental. No País, também, melhorou a cobertura do saneamento básico. Mas existem iniquidades macrorregionais e são escassas as informações sobre os microterritórios, onde as ações básicas de saúde se concretizam. Descrever a influência das coberturas do sistema de abastecimento de água (SAA, esgotamento sanitário (ES e coleta de resíduos sólidos domiciliares (CRSD na taxa mortalidade infantil (TMI nas áreas de abrangência das unidades básicas de saúde (UBS do Distrito de Saúde Noroeste de Campinas-SP. Foi conduzido estudo ecológico com dados secundários referentes a 2000. As coberturas nas oito UBS: do SAA variou entre 96,3 %, de Valença, e 99,9 % de Integração; de ES entre 67 %, de Ipaussurama e 99,8 % de Integração; da CRSD entre 95,8 % de Florence e 99,9 % de Perseu e Integração. A TMI variou entre 5,5 ‰, na UBS Perseu e 22,9 ‰ Floresta. Observou-se que existe relação inversa, quanto maior a cobertura do SAA (R2=0,73, de ES (R2=0,78 e da CRSD (R2= 0,95 menor a TMI nas UBS. Além de outros fatores, o saneamento básico determina o processo saúde doença da população e conforme os achados, existem iniquidades também nos microterritórios de abrangência das UBS que devem ser consideradas pelos gestores e profissionais de saúde, principalmente, da atenção primária na pactuação das prioridades, ações e metas para atenção integral e vigilância em saúde e atuação intersetorial.En los últimos 20 años, el Sistema Único de Salud en el Brasil ha mejorado la atención primaria de salud y la vigilancia de la salud ambiental. En Brasil, mejoró también la cobertura de saneamiento básico. Existen desigualdades macrorregionales y poca información sobre los microterritorios donde se llevan a cabo las acciones de la atención primaria. Se pretende describir la

  8. Percepção do processo saúde-doença: significados e valores da educação em saúde

    Directory of Open Access Journals (Sweden)

    Ana Maria Chagas Sette Câmara

    Full Text Available A relevância sociológica do estudo das representações sociais do processo saúde-doença está no fato de que elas fundamentam práticas e atitudes dos seus atores, assim como as relações que eles estabelecem com o seu contexto social e com aquilo que lhes acontece. O problema dessa pesquisa consiste em conhecer as representações sociais do processo saúde-doença dos profissionais do PSF, considerando que esse conhecimento pode ser fundamental para o desenvolvimento de práticas educativas em saúde. A abordagem metodológica desta pesquisa foi qualitativa, tendo por base as representações sociais dos profissionais de apoio e das equipes de saúde da família do Centro de Saúde Milionários, em Belo Horizonte, Minas Gerais. Para a coleta de dados, foi utilizada entrevista individual semi-estruturada abordando os seguintes aspectos: processo saúde-doença; educação em saúde; e barreiras ou dificuldades para prescrição/adoção de hábitos saudáveis. Os dados foram analisados pela técnica de análise de conteúdo, a partir das categorias: dimensões do processo saúde-doença; barreiras ou dificuldades para adoção de hábitos saudáveis; e significados e valores da educação em saúde. Os dados apontam que há necessidade de modificações conceituais na formação permanente desses profissionais e da inclusão do enfoque coletivo, abordando o conceito ampliado de saúde com seus determinantes sociais e contextuais. Faz-se necessária também a busca de novas metodologias de educação em saúde, para que os profissionais do PSF possam ir além da informação e consigam a ressignificação dos conceitos do processo saúde-doença, podendo de fato estabelecer novas práticas e novos processos de trabalho em saúde.

  9. Prefeitos eleitos, descentralização na saúde e os compromissos com o SUS

    Directory of Open Access Journals (Sweden)

    Lenaura de Vasconcelos Costa Lobato

    Full Text Available O artigo analisa a municipalização na saúde por meio das proposições para a política de saúde de prefeitos eleitos no ano de 2012. Realizou-se análise documental das plataformas de governo dos então candidatos e de documentos oficiais da política e da gestão municipais de saúde - Relatórios das Conferências Municipais de Saúde e Planos Municipais de Saúde - de 24 municípios brasileiros nas cinco regiões do País. Os resultados indicam que os programas das candidaturas, em geral, incorporam a defesa do direito à saúde, embora principalmente através da ampliação da oferta de serviços médicos.

  10. Cs3Sm7Se12

    Directory of Open Access Journals (Sweden)

    Christof Schneck

    2012-01-01

    Full Text Available The title compound, tricaesium heptasamarium(III dodecaselenide, is setting a new starting point for realization of the channel structure of the Cs3M7Se12 series, now with M = Sm, Gd–Er. This Cs3Y7Se12-type arrangement is structurally based on the Z-type sesquiselenides M2Se3 adopting the Sc2S3 structure. Thus, the structural set-up of Cs3Sm7Se12 consists of edge- and vertex-connected [SmSe6]9− octahedra [dØ(Sm3+ – Se2− = 2.931 Å], forming a rock-salt-related network [Sm7Se12]3− with channels along [001] that are apt to take up monovalent cations (here Cs+ with coordination numbers of 7 + 1 for one and of 6 for the second cation. The latter cation has a trigonal–prismatic coordination and shows half-occupancy, resulting in an impossible short distance [2.394 (4 Å] between symmetrically coupled Cs+ cations of the same kind. While one Sm atom occupies Wyckoff position 2b with site symmetry ..2/m, all other 11 crystallographically different atoms (namely 2 × Cs, 3 × Sm and 6 × Se are located at Wyckoff positions 4g with site symmetry ..m.

  11. Cs(3)Sm(7)Se(12).

    Science.gov (United States)

    Schneck, Christof; Elbe, Andreas; Schurz, Christian M; Schleid, Thomas

    2012-01-01

    The title compound, tricaesium hepta-samarium(III) dodeca-selenide, is setting a new starting point for realization of the channel structure of the Cs(3)M(7)Se(12) series, now with M = Sm, Gd-Er. This Cs(3)Y(7)Se(12)-type arrangement is structurally based on the Z-type sesquiselenides M(2)Se(3) adopting the Sc(2)S(3) structure. Thus, the structural set-up of Cs(3)Sm(7)Se(12) consists of edge- and vertex-connected [SmSe(6)](9-) octa-hedra [d(Ø)(Sm(3+) - Se(2-)) = 2.931 Å], forming a rock-salt-related network [Sm(7)Se(12)](3-) with channels along [001] that are apt to take up monovalent cations (here Cs(+)) with coordination numbers of 7 + 1 for one and of 6 for the second cation. The latter cation has a trigonal-prismatic coordination and shows half-occupancy, resulting in an impossible short distance [2.394 (4) Å] between symmetrically coupled Cs(+) cations of the same kind. While one Sm atom occupies Wyckoff position 2b with site symmetry ..2/m, all other 11 crystallographically different atoms (namely 2 × Cs, 3 × Sm and 6 × Se) are located at Wyckoff positions 4g with site symmetry ..m.

  12. Modelo(s) de Saúde de base à Prática Clínica dos Fisioterapeutas

    OpenAIRE

    Santos, Liane Raquel Pinho dos

    2015-01-01

    Introdução: A evolução dos modelos de saúde ocorreu juntamente com as mudanças da definição do conceito de saúde e reabilitação, mas ainda é desconhecido o modelo predominante de saúde em que se enquadra a prática clínica dos fisioterapeutas que trabalham em terapia manual. Objetivo(s): Criação de um questionário para avaliação do modelo de saúde em que se enquadra a prática clínica dos fisioterapeutas e após a aplicação, verificar o conhecimento dos modelos de saúde, o grau de concordânci...

  13. ViSC Social Competence Program.

    Science.gov (United States)

    Strohmeier, Dagmar; Hoffmann, Christine; Schiller, Eva-Maria; Stefanek, Elisabeth; Spiel, Christiane

    2012-01-01

    The ViSC Social Competence Program has been implemented in Austrian schools within the scope of a national strategy plan, Together Against Violence. The program is a primary preventive program designed for grades 5 to 8. The prevention of aggression and bullying is defined as a school development task, and the initial implementation of the program lasts one school year. The program consists of universal and specific actions that are implemented through in-school teacher training and a class project for students. The program was evaluated with a randomized intervention control group design. Data were collected from teachers and students. Results suggest that the program reduces aggression in schools.

  14. Cuidados paliativos: o desafio das equipes de saúde

    Directory of Open Access Journals (Sweden)

    Fernanda de Carvalho Braga

    2013-12-01

    Full Text Available O avanço tecnológico possibilitou tanto a redução da morte quanto o prolongamento da vida. Essa última traz consigo a necessidade de se pensar em como cuidar de pessoas fora de perspectiva de cura, especialmente porque tal cuidado inclui aspectos psicossociais, com implicações tanto para as relações entre os profissionais quanto com o paciente e sua família. Este estudo teve como objetivo buscar na literatura nacional artigos sobre equipes de saúde que oferecem cuidados paliativos. Realizou-se uma revisão de produção em periódicos nacionais com os descritores cuidados paliativos, equipe de saúde e neonatologia. Foram identificados 62 trabalhos, porém somente 11 atenderam ao critério de relacionar pelo menos dois descritores. Nenhum artigo relacionou as três palavras-chaves. O baixo número de publicações evidencia a necessidade de mais pesquisas nessa área, pois proporcionar qualidade de vida desde o diagnóstico da doença até o momento do óbito representa grande estresse para os profissionais de saúde.

  15. Saúde, este obscuro objeto de desejo

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    1997-07-01

    Full Text Available Exploram-se no presente ensaio as relações entre saúde e desejo, envolvendo um dado querer denominado "saúde" e as formas que este querer adquire no contexto do viver contemporâneo. Aponta-se ao final para uma situação radical no que toca à saúde, vítima de um processo irreversível de expansão, que acaba por inviabilizar qualquer tentativa de defini-la, levando a uma perda total de sentido, no contexto de um universo humano tentendo à completa robotização.The present essay explores the relations between health and desire involving a given yearning named "health" and the forms that such feeling acquires in the contemporaneous context of living. It ultimately points to a radical situation in terms of health, victim of a irreversible process of expansion that eventually makes any attempt of definition not viable, leading to a total loss of meaning within a human universe tending to complete robotization.

  16. O impacto da homofobia na saúde do adolescente

    Directory of Open Access Journals (Sweden)

    Taison Regis Penariol Natarelli

    2015-12-01

    Full Text Available Resumo Objetivo: Objetivou-se conhecer os tipos de violência sofrida por adolescentes homossexuais e compreender a influência da homofobia na saúde dessa população. Métodos: Foram realizadas entrevistas, em profundidade, com nove adolescentes residentes em um município do interior de São Paulo que se autodeclararam homossexuais. Resultados: Os tipos de violência sofridos e referidos pelos adolescentes foram: física, verbal, psicológica e sexual. A homofobia provoca percepções negativas sobre si mesmo e a não adoção de hábitos de vida saudáveis relacionados aos cuidados com alimentação, prática de atividades físicas, padrão de sono e ideações suicidas. Foram relatadas situações de homofobia nos serviços de saúde. Conclusão: Adolescentes homossexuais são vulneráveis a diferentes tipos de violência. A dificuldade de acesso aos serviços de saúde é um fator concorrente ao aumento da vulnerabilidade. A contribuição deste estudo reside na problematização de tópicos que podem auxiliar na construção do cuidado integral dos adolescentes homossexuais.

  17. A Crise do Sistema Único de Saúde e a Fuga para o Mercado

    Directory of Open Access Journals (Sweden)

    Rosângela Minardi Mitre Cotta

    1998-06-01

    Full Text Available Este trabalho discute as conseqüências paradoxais das ações em saúde, pensadas a partir do ideal universalizante igualitário, consubstanciado na Constituição de 1988; bem como os dilemas que hoje se interpõem ao setor público em saúde.Uma análise da conjuntura atual do relacionamento entre o setor público e o privado em saúde foi desenvolvida tendo como subsídio a investigação empírica, com atenção especial ao conhecimento local.A técnica amostrai utilizada foi a "amostragem por experts".Através deste método, identificam-se os atores mais relevantes para o processo de construção e implantação do Sistema Único de Saúde. Impõe-se, assim, a combinação de conhecimentos estratégicos específicos, derivados de vários atores políticos inseridos direta ou indiretamente no processo de implementação da política de saúde em curso.Quarenta e nove entrevistas participantes foram realizadas com atores relevantes para o setor saúde, escolhidos em instituições públicas e privadas da saúde. Finalmente, procedeu-se à análise documental e estatística.Os resultados mostraram que as formas perversas de interação do sistema público de saúde com o mercado, conseqüência da maneira desorganizada de o governo implementar a Reforma Sanitária, apontam para um retrocesso na forma de custeio da saúde no país. Tem-se, de um lado, a obrigatoriedade de contribuição previdenciária e, de outro, o pagamento de seguros privados de saúde, sem, ao final, ter-se a garantia de um atendimento satisfatório.Institui-se, portanto, na saúde, um jogo do "salve-se quem puder", jogo em que a fuga para o mercado não representa uma saída total do sistema público, nem garantia de atendimento.

  18. Caracterização das atividades de enfermagem em saúde coletiva desenvolvidas na regional norte de saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    Full Text Available O estudo teve como objetivo identificar e analisar as ações desenvolvidas pela equipe de enfermagem em saúde coletiva na Regional Norte de Saúde do Distrito Federal. Para a coleta de dados aplicou-se um questionário com a descrição das diversas atividades cotidianas da assistência a 29 enfermeiras, 91 auxiliares de enfermagem e 42 agentes de saúde. Para a melhor compreensão de como as atividades são desenvolvidas realizou-se grupos focais com cada uma das categorias profissionais. Os resultados mostram que todos elementos da equipe empregam grandes esforços para organizar, controlar e atender a demanda espontânea e ainda executar as atividades de auxilio às ações médicas, consequentemente priorizam o atendimento individual em detrimento do coletivo.

  19. Uma experiência em comunicação e saúde

    Directory of Open Access Journals (Sweden)

    Marina Ruiz de Matos

    2009-12-01

    Full Text Available Este trabalho refere-se à experiência desenvolvida no município de Guarulhos, sob o patrocínio do Ministério da Saúde, com o objetivo de envolver radiocomunicadores no processo educativo em saúde. Organizaram-se oficinas de trabalho com a participação de funcionários dos serviços municipais de saúde e de radialistas das rádios comunitárias das mesmas áreas de abrangência, para reflexão, discussão e elaboração de ações conjuntas sobre temas de saúde. Desenvolveu-se metodologia que articulou, além de textos acadêmicos, outros tipos de linguagem como pintura, música, radionovela, poesia etc., na abordagem dos assuntos. A avaliação final constou de um questionário preenchido pelos participantes e a análise das respostas indicou tratar-se de uma metodologia compatível com os objetivos de alcançar envolvimento e desenvolver parcerias entre comunicadores, serviços de saúde e comunidade.

  20. Conselhos locais de saúde: caminhos e (descaminhos da participação social

    Directory of Open Access Journals (Sweden)

    Edgar Andrade Lisboa

    Full Text Available Resumo Este estudo analisou a criação e a implantação dos conselhos locais de saúde no município de Anchieta, no estado do Espírito Santo. Buscou-se identificar os fatores que apoiaram ou limitaram a sua efetiva participação no contexto do Sistema Único de Saúde local. Por meio de abordagem qualitativa, realizaram-se 13 entrevistas com os conselheiros. Utilizou-se a análise de conteúdo, evidenciando três categorias trabalhadas neste texto: Ser ou não ser conselheiro de saúde? Eis a questão!; O não pertencimento e a não participação; e Conselhos locais de saúde: elos, meios e mediações. Concluiu-se que os conselheiros enfrentam grandes dificuldades que acabam por desvirtuar os caminhos desejados da participação social no âmbito do Sistema Único de Saúde. Por isso, é imprescindível que haja vontade política, apoio à participação efetiva e programas de educação para a cidadania dos atores envolvidos nesses fóruns, para que assim possam exercer de forma plena seu papel.

  1. Espaço público na Atenção Básica de Saúde: Educação Popular e promoção da saúde nos Centros de Saúde-Escola do Brasil

    Directory of Open Access Journals (Sweden)

    Inês Nascimento de Carvalho Reis

    2014-12-01

    Full Text Available Os marcos conceituais do trabalho são a promoção da saúde e educação em saúde, priorizando suas semelhanças, dentre as quais se destaca a importância do diálogo como estratégia de abordagem operacional. Buscou-se identificar a evolução dos conceitos, das práticas e da institucionalização da Promoção da Saúde, na perspectiva da educação na Atenção Básica de Saúde no Sistema Único de Saúde. O tema foi pesquisado nos 17 Centros de Saúde Escola (CSE do Brasil, onde se apresentam práticas educativas não convencionais em sala de espera (SE. Na ocasião, foram entrevistados 91 sujeitos (24 gestores, 35 profissionais e 32 usuários. Demonstra-se que a visibilidade das SE como espaço público poderia ser ampliada pela valorização do saber popular e do agir em conjunto, incentivando a cidadania ao trabalhar de forma criativa e otimizando os recursos disponíveis.

  2. Measurement of (43)Sc and (44)Sc production cross-section with an 18MeV medical PET cyclotron.

    Science.gov (United States)

    Carzaniga, Tommaso Stefano; Auger, Martin; Braccini, Saverio; Bunka, Maruta; Ereditato, Antonio; Nesteruk, Konrad Pawel; Scampoli, Paola; Türler, Andreas; van der Meulen, Nicholas

    2017-11-01

    (43)Sc and (44)Sc are positron emitter radionuclides that, in conjunction with the β(-) emitter (47)Sc, represent one of the most promising possibilities for theranostics in nuclear medicine. Their availability in suitable quantity and quality for medical applications is an open issue and their production with medical cyclotrons represents a scientific and technological challenge. For this purpose, an accurate knowledge of the production cross sections is mandatory. In this paper, we report on the cross section measurement of the reactions (43)Ca(p,n)(43)Sc, (44)Ca(p,2n) (43)Sc, (46)Ti(p,α)(43)Sc, and (44)Ca(p,n)(44)Sc at the Bern University Hospital cyclotron. A study of the production yield and purity performed by using commercially available enriched target materials is also presented. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Synthesis and structure of a new layered oxyfluoride Sr{sub 2}ScO{sub 3}F with photocatalytic property

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yongkun; Tang, Kaibin, E-mail: kbtang@ustc.edu.cn; Zhu, Baichuan; Wang, Dake; Hao, Qiaoyan; Wang, Yan

    2015-05-15

    Highlights: • A new oxyfluoride compound Sr{sub 2}ScO{sub 3}F was prepared by a solid state route. • The structure of this compound was determined by GSAS program based on XRD data. • The photocatalytic property was investigated under UV irradiation. - Abstract: A new Ruddlesden–Popper type scandium oxyfluoride, Sr{sub 2}ScO{sub 3}F, was synthesized by a conventional solid state reaction route. The detailed structure of Sr{sub 2}ScO{sub 3}F was investigated using X-ray diffraction (XRD) and selected area electron diffraction (SAED). The disorder distribution pattern of fluorine anions was determined by the {sup 19}F nuclear magnetic resonance (NMR) spectrum. The compound crystallizes in a K{sub 2}NiF{sub 4}-type tetragonal structure (space group I4/mmm) with O/F anions disordered over the apical sites of the perovskite-type Sc(O,F){sub 6} octahedron layers interleaved with strontium cations. Ultraviolet–visible (UV–vis) diffuse reflection spectrum of the prepared Sr{sub 2}ScO{sub 3}F indicates that it has an absorption in the UV–vis region. The photocatalytic activity of Sr{sub 2}ScO{sub 3}F was further investigated, showing an effective photodegradation of Rhodamine-B (RB) within 2 h under UV light irradiation.

  4. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  5. Justiça social e equidade em saúde: uma abordagem centrada nos funcionamentos

    Directory of Open Access Journals (Sweden)

    Carlos Dimas Ribeiro

    2015-12-01

    Full Text Available Trata-se de um ensaio de natureza teórica que objetiva defender uma concepção de justiça social voltada aos funcionamentos dos indivíduos, articulando a discussão da justiça com o debate sobre equidade em saúde. Na introdução, são discutidas as circunstâncias da justiça, abordando a questão da escassez dos recursos no campo da saúde. No primeiro item, analisa-se a noção da equidade em saúde, apresentando os principais enfoques abordados, em particular o conceito de equidade em saúde proposto por Margaret Whitehead, amplamente utilizado na saúde coletiva. No segundo item, apresenta-se, brevemente, a Abordagem das Capacitações desenvolvida por Amartya Sen e Martha Nussbaum, que recuperam a noção aristotélica de funcionamento. Ao final, critica-se essa abordagem e defende-se a Perspectiva dos Funcionamentos (PF, proposta por Maria Clara Dias, aplicada ao campo da saúde. Dessa forma, os concernidos da justiça são sistemas funcionais e o que se quer igualar para propósitos de justiça é a integridade funcional dos seres vivos. São apresentadas algumas vantagens dessa perspectiva, considerada aquela que melhor preenche os requisitos de uma concepção de justiça extensiva a todos no Brasil.

  6. Andragogia na saúde: estudo bibliométrico

    OpenAIRE

    Draganov, Patrícia Bover [UNIFESP; Friedländer,Maria Romana; Sanna, Maria Cristina [UNIFESP

    2011-01-01

    O sucesso da aprendizagem envolve o uso de estratégias adequadas. Como a clientela de formação profissional e de educação permanente e a população assistida, para quem se dirigem as ações de educação em saúde, são majoritariamente adultas, metodologias como a Andragogia, que é a arte e ciência de conduzir adultos ao aprendizado, são uma alternativa interessante. Com o objetivo de quantificar e descrever a produção científica sobre Andragogia nas Ciências da Saúde no período de 1999 a 2009, re...

  7. Saúde e meio ambiente nas cidades: os desafios da saúde ambiental

    Directory of Open Access Journals (Sweden)

    Nelson Gouveia

    1999-02-01

    Full Text Available Dentro de alguns poucos anos, nosso planeta contará com mais habitantes em áreas urbanas do que em áreas rurais. A urbanização desenfreada, sem mecanismos regulatórios e de controle, típica dos países periféricos, trouxe consigo enormes repercussões na saúde da população. Problemas como a insuficiência dos serviços básicos de saneamento, coleta e destinação adequada do lixo e condições precárias de moradia, tradicionalmente relacionados com a pobreza e o subdesenvolvimento, somam-se agora à poluição química e física do ar, da água e da terra, problemas ambientais antes considerados "modernos". Novamente, é sobre as populações mais carentes que recai a maior parte dos efeitos negativos da urbanização, gerando uma situação de extrema desigualdade e iniqüidade ambiental e em saúde. Para reverter esse quadro é preciso que haja uma reincorporação das questões do meio ambiente nas políticas de saúde, e a integração dos objetivos da saúde ambiental numa ampla estratégia de desenvolvimento sustentável. Uma abordagem mais integrada, com mecanismos intersetoriais que possibilitem um diálogo amplo entre as partes, trará enormes benefícios na conquista de melhores condições de vida nas cidades. A saúde ambiental hoje tem o desafio de promover uma melhor qualidade de vida e saúde nas cidades e a oportunidade de enfrentar o absurdo quadro de exclusão social, sob a perspectiva da eqüidade.In a matter of few years there will be more urban than rural dwellers worldwide. The rapid urbanisation lacking adequate control and regulatory mechanisms typical of developing countries, brought along huge effects to the health of the population Environmental problems traditionally related to poverty and underdevelopment such as insufficient provision of sanitation services, waste collection and disposal, and precarious housing conditions, are now added to environmental problems considered of "modern life" such as the

  8. Chemical Chaperones Increasing Expression Level of Soluble Single-chain Fv Antibody(scFv2F3)

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Glutathione peroxidase (GPX) is a selenoenzyme that protects the biomembrane and other cellular components against oxidative damage. The selenium-containing single chain Fv fragment of monoclonal antibody 2F3 (SescFv2F3 ) is a kind of GPX mimic and it has a wide clinical applications because of its high activity and low antigenicity. Se-scFv2F3 is generated by the chemical modification of the single chain Fy fragment of monoclonal antibody 2F3 ( scFv2F3 ), which can be expressed in E. coli. In this article, the effect of chemical chaperones, such as glycerol, glucose, and β-cyclodextrin added to the culture medium, on the expression of soluble scFv2F3 was investigated. The expression level was evaluated by the determination of soluble scFv2F3 contents in the whole cell lysates.The results suggest that both glycerol and β-cyclodextrin greatly increase the expression level of soluble scFv2F3, and β-cyclodextrin is found to be more effective compared with glycerol. Glucose has a slight effect on the expression level of soluble scFv2F3. This is the first example, wherein β-cyclodextrin has been used as a chemical chaperone during the cell culture to improve the expression level of recombinant proteins. In addition, chemical chaperones are found to decrease the toxic effect of IPTG on cells.

  9. Estresse no trabalho e interrupção de atividades habituais, por problemas de saúde, no Estudo Pró-Saúde

    National Research Council Canada - National Science Library

    Luís Eduardo Teixeira de Macedo; Dóra Chor; Valeska Andreozzi; Eduardo Faerstein; Guilherme L. Werneck; Claudia S. Lopes

    2007-01-01

    .... Esta investigação, do tipo transversal, se insere em um estudo prospectivo de 2.343 funcionários técnico-administrativos de uma universidade no Estado do Rio de Janeiro - Estudo Pró-Saúde...

  10. Indutores de mudança na formação dos profissionais de saúde: pró-saúde e PET-SAÚDE

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    . Ele estimula que o objeto de estudo deixe de ter o foco na doença e passe a olhar para o cuidado à pessoa. Sua finalidade é formar profissionais com perfil adequado aos sistemas locais, e isso implica fomentar a capacidade de aprender, trabalhar em equipe, comunicar-se, ter agilidade diante das situações, capacidade propositiva e habilidade crítica(9.O Pró-Saúde proveu incentivos financeiros vinculados às parcerias das instituições de ensino com os gestores estaduais e municipais de saúde. Tal parceria adequou a estrutura física e instrumentalizou com novos equipamentos as Unidades de Saúde que acolhem os estudantes e as práticas de ensino e aprendizagem, bem como promoveu espaços de educação permanente partilhados entre a academia eos serviços.Sendo contemplada pelos últimos editais do Pró-Saúde e do PET-Saúde, a Universidade de Fortaleza (UNIFOR instituiu mudanças nos cursos de graduação em saúde a partir da ampliação dos cenários de prática para a rede municipal, das práticas interdisciplinares e da adoção de metodologias ativas no processo ensino aprendizagem, objetivando os determinantes de saúde (promoção, prevenção, recuperação e reabilitação. Estes são contemplados em todos os eixos de formação discente, possibilitando intervenções e ações integradas que o considerem sujeito do processo ensino-aprendizagem e visando à produção do conhecimento e prestação de serviços ancorados nos princípios do Sistema Único de Saúde (SUS.Em parceria com o Sistema Municipal de Saúde Escola (SMSE de Fortaleza, a UNIFOR vem frisando a necessidade de investimentos na Estratégia Saúde da Família e na educação popular em saúde a serem desenvolvidos pelas equipes de saúde, como preconiza o MS(8. Com o apoio dos dez cursos de graduação da área da saúde, a UNIFOR tem contribuído com a inclusão da equipe ampliada de saúde nos Centros de Saúde da Família (CSF para favorecer a qualidade do serviço, além do

  11. A narrativa nas pesquisas qualitativas em saúde

    Directory of Open Access Journals (Sweden)

    Marcelo Eduardo Pfeiffer Castellanos

    2014-04-01

    Full Text Available O forte interesse das ciências sociais e humanas em saúde nos estudos narrativos levou a várias formas de incorporação das contribuições desses estudos na pesquisa qualitativa em saúde. Torna-se importante refletir sobre os contextos e as características dessa incorporação. Para tanto, destacamos as principais questões teóricas aí envolvidas, assim como situamos essa incorporação no contexto da produção científica mais ampla das ciências sociais e humanas em saúde. Apontamos, também, a contribuição dos estudos narrativos para reflexão sobre as relações entre estrutura e ação social ou entre contextos específicos de interação social e contextos societários mais amplos. Essa contribuição pode ser identificada na análise das relações narrativamente estabelecidas entre interpretação, experiência e ação, ao longo do processo de saúde-doença-cuidado. Argumenta-se que as narrativas não somente organizam interpretações, mas também consistem em uma forma específica de agenciamento social. Nesse sentido, as interpretações narrativas e as performances narrativas podem ser vistas como elementos centrais da construção social de experiências e trajetórias de adoecimento e cuidado.

  12. Saúde dos imigrantes: multidimensionalidade, desigualdades e acessibilidade em Portugal

    Directory of Open Access Journals (Sweden)

    Beatriz Padilla

    Full Text Available Este artigo descreve os aspectos multidimensionais da saúde das populações imigrantes e os seus descendentes, tomando como exemplo o caso português. Por um lado, coloca-se ênfase na importância da acessibilidade e das diferentes barreiras que a condicionam e por outro lado, salientam-se as intervenções do estado e da sociedade civil em prol da saúde dos imigrantes, num contexto actual marcado pela crise internacional.

  13. Letramento funcional em saúde: reflexões e conceitos sobre seu impacto na interação entre usuários, profissionais e sistema de saúde

    Directory of Open Access Journals (Sweden)

    Maria da Penha Baião Passamai

    2012-06-01

    Full Text Available Letramento funcional em saúde (LFS é o grau pelo qual os indivíduos têm a capacidade para obter, processar e entender informações básicas e serviços necessários para a tomada de decisões adequadas em saúde. O tema preocupa pesquisadores/profissionais da saúde/formuladores de políticas públicas. Sua natureza interdisciplinar, relacional e interacional indica que o LFS sofre a influência dos sistemas de saúde/educacional, mídia, família, ambiente de trabalho/comunidade/decisão política. Analisam-se conceitos de LFS versus interação usuários-profissionais-sistema de saúde, norteando-se pelas questões: Em que consiste o LFS? Em que medida interfere na comunicação entre usuários, profissionais e sistema de saúde? Quais são suas consequências na saúde pública? Medidas para elevação do LFS devem melhorar as competências individuais e serviços de saúde humanizados, aperfeiçoando suas comunicações, escritas/orais, satisfazendo as necessidades/habilidades dos usuários.

  14. Da medicina do trabalho à saúde do trabalhador From occupational medicine to workers' health

    Directory of Open Access Journals (Sweden)

    René Mendes

    1991-10-01

    Full Text Available Ensaio de revisão sobre a evolução dos conceitos e práticas da medicina do trabalho à saúde do trabalhador, passando pela saúde ocupacional. Busca-se responder às seguintes questões: quais as características básicas da medicina do trabalho (na sua origem e na sua evolução; como e por que evoluiu a medicina do trabalho para a saúde ocupacional; por que o modelo da saúde ocupacional se mostrou insuficiente; em que contexto surge a saúde do trabalhador; quais as principais características da saúde do trabalhador.The evolution of the concepts and practice of occupational medicine, occupational health and workers' health is tentatively reviewed. An attemp is made to answer the following questions: what were the major characteristics of occupational medicine throughout its evolution? How and why did occupational medicine evolve into occupational health? Why has the "occupational health model" become inadequate? Writhin what context did workers' health arise? What are the principal characteristics of workers' health?

  15. Síndrome hemofagocítico y salmonelosis en un paciente con hemoglobinopatía SC Hemophagocytic syndrome and salmonellosis in a patient with SC hemoglobinipathy

    Directory of Open Access Journals (Sweden)

    Luis Fernando Pinto

    1989-02-01

    Full Text Available

    Se informa el caso de un joven de 14 años con hemoglobinopatía SC que tuvo un síndrome hemofagocítico (SH secundario a salmonelosis. Se discuten las características de este síndrome y su diagnóstico diferencial. Se hace énfasis en la importancia de considerarlo entre las posibilidades diagnósticas dada la frecuencia en Colombia de las infecciones que pueden desencadenarlo, a saber: tuberculosis, salmonelosis y leishmaniasis.

    We report a case of hemophagocytlc syndrome occurrlng In a 14 year old boy with SC hemoglobinopathy and salmonellosis; the clinical features of the syndrome are discussed; the need to consider this syndrome In the differential diagnosis is emphazised, since several of the infections that may lead to It- tuberculosis, salmonellosis, lelsmaniasis. are frequently found in colombian patients

  16. Influência da propaganda na utilização de medicamentos em um grupo de idosos atendidos em uma unidade básica de saúde em Aracaju (SE, Brasil The influence of the advertising in the medication use in a group of elderly attended in a primary health care unit in Aracaju (Sergipe, Brasil

    Directory of Open Access Journals (Sweden)

    Divaldo Pereira de Lyra Jr

    2010-11-01

    Full Text Available O crescimento da população idosa brasileira tem levado a uma maior tendência ao uso de medicamentos. A sua utilização inadequada pode ser induzida por vários fatores, dentre eles a propaganda, podendo trazer danos à saúde do usuário. O objetivo do estudo foi avaliar a influência da propaganda no consumo de medicamentos por um grupo de idosos atendidos em unidade básica de saúde de Aracaju, Sergipe. No período de abril a junho de 2007, um grupo de 230 idosos, com idade acima de 60 anos, de ambos os gêneros, foi entrevistado. A maioria dos entrevistados (73% possuía pelo menos uma doença crônica e 73,9% consumiam pelo menos um medicamento regularmente. Do total de entrevistados, 17,8% da amostra relataram utilizar medicamentos por influência da propaganda; 2,2% consideraram que os medicamentos veiculados na mídia nunca fazem mal e 6,5% acreditavam que eles sempre fazem bem. No estudo, correlações foram feitas e demonstraram que quem mais consome medicamentos influenciados pela propaganda também considera que eles sempre fazem bem e vice-versa (p= 0,04. Os dados revelaram que parte dos idosos sofreu influência da propaganda no consumo de medicamentos, não levando em consideração os riscos que estes poderiam causar.The growth of the Brazilian elderly people has led to a trend to an increase in the medication use. The inadequate use of drugs can be induced by some factors, like advertisement, with the risk of damaging the user's health. The objective of the study was to evaluate the advertisement influence in medication use in a group of elderly patients in a primary health care unit in Aracaju, Sergipe, Brazil. 230 elderly aging over 60 years with both genders had been interviewed from April to June of 2007. The majority of the interviewees (73% has at least a chronic health condition and 73.9% consumed regularly at least one medication. 17.8% of the sample informed to use medication motivated by publicity influence; 2

  17. Diretrizes Curriculares na saúde e as mudanças nos modelos de saúde e de educação

    Directory of Open Access Journals (Sweden)

    Carlos Otávio Fiúza Moreira

    2015-12-01

    Full Text Available Artigo produzido a partir de pesquisa bibliográfica e de questões formuladas para uma conferência no módulo “Educação na Saúde II” do Mestrado Profissional da Rede Nordeste de Formação em Saúde da Família. O texto discute questões dos campos da saúde e da educação relacionadas à emergência de novos modelos de saúde e de formação; analisa também as Diretrizes Curriculares Nacionais (DCN de três cursos da área da saúde (Medicina, Enfermagem e Odontologia como expressão desses novos modelos para saúde e para a educação. Uma questão transversal ao artigo são as relações entre os campos da saúde e da educação. Para isto, lança‑se mão do conceito de campo, desenvolvido pelo sociólogo Pierre Bourdieu. Considera‑se, ainda, o desafio de transformar as DCN em currículos e programas, ferramentas ou dispositivos necessários para fazer a passagem do que está prescrito para os cenários de ensino e aprendizagem.

  18. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is introduced in this paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AlCl3 aluminum coagulant and P-FeCl3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing, flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  19. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is in troduced inthis paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AiCI3 aluminum coagulant and P-FeCI3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing,flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  20. Final Scientific Report: DE-SC0002194

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald [Univ. of Washington, Seattle, WA (United States)

    2017-04-07

    We provide the final scientific report for DE-SC0002194. During the term of this grant, 28 publications spanning a variety of topics were addressed under the rubric of advanced x-ray methods and their application to extreme conditions of time-resolution or x-ray intensities. Notable accomplishments include a new observation of XANES features associated with f-shell reconfiguration in lanthanides, size-dependent x-ray heating effects under XFEL illumination conditions, theoretical development of improved treatments of inelastic x-ray scattering for 'warm dense matter' conditions, and several new instrument develop efforts for atomic, molecular, and condensed phase studies in the lab and at major facility lightsources.

  1. Processo comunicativo e humanização em saúde

    Directory of Open Access Journals (Sweden)

    Suely Ferreira Deslandes

    2009-01-01

    Full Text Available O artigo aborda o processo comunicacional como um dos desafios enfrentados na humanização em saúde. Reflete sobre potencialidades e requisitos para a produção do agir comunicativo e aponta alguns obstáculos, baseando-se em estudos antropológicos sobre a cultura biomédica. Com base no conceito de entendimento, discute sobre os encontros em saúde e a relevância da validação e do reconhecimento do discurso dos diferentes atores. Aponta para a importância de se relativizarem marcas identitárias associadas à cultura biomédica, desconstruírem-se alguns conceitos, criticarem seus contextos de aplicabilidade e até mesmo se propor novas marcas por meio da humanização. Discute-se a relação entre as tecnologias biomédicas e o processo comunicacional. O desafio colocado é o de aprender, reconhecer e negociar com o outro, que detém direitos, autonomia e estoque cultural peculiares. Finalmente, discute os esforços teóricos para que a humanização das práticas em saúde venha a fazer parte do ethos ou visão do mundo dos profissionais de saúde.

  2. Fenomenologia heideggeriana como referencial para estudos sobre formação em saúde

    Directory of Open Access Journals (Sweden)

    Alberto Durán González

    2012-09-01

    Full Text Available Reflete-se sobre as possibilidades da fenomenologia heideggeriana como referência na análise da educação na saúde. Heidegger propõe, em "Ser e tempo", a investigação sobre o sentido do ser, fundamental para o conhecimento que o homem possa ter de si mesmo como ser finito. Suas ideias provocaram transformações na concepção humanista moderna e na prática em educação. O indivíduo é sempre ator, sendo na medida em que existe, experimentando a si próprio na existência. O modo de ser privativo da saúde, o padecimento, é acompanhado sempre de uma limitação da possibilidade de viver. Assim, a fenomenologia heideggeriana nos ajuda a questionar a educação em saúde. Compreende-se que o homem se encontra sempre em copresença, entre a preocupação substitutiva e a libertadora. Este caminho se mostra possível quando contemplados os diversos modos de ser-professor e de ser-estudante. Possibilita-se, assim, aprofundar o ensinar-aprender na formação em saúde.

  3. Analysis of a health team's records and nurses' perceptions concerning signs and symptoms of delirium Análisis de registros producidos por el equipo de salud y de la percepción de los enfermeros sobre las señales y síntomas de delirio Análise dos registros produzidos pela equipe de saúde e da percepção dos enfermeiros sobre os sinais e sintomas de delirium

    Directory of Open Access Journals (Sweden)

    Rosa Carla Gomes da Silva

    2011-02-01

    confusión aguda/delirio, con implicaciones para la calidad de los cuidados, sugiriendo la necesidad de adoptar medidas formativas dirigidas a los equipos de salud.Esta pesquisa pretendeu conhecer a dimensão do subdiagnóstico da confusão aguda/delirium, ao analisar os registros produzidos pela equipe de saúde e percepção dos enfermeiros sobre esse fenômeno. Foi desenvolvido em um hospital universitário central, de Portugal, delineada dentro do paradigma quantitativo, utilizando a técnica documental e entrevista. A amostra obtida, pela aplicação da Escala de Confusão NeeCham, foi de 111 doentes com diagnóstico de confusão aguda/delirium, internados em unidades de cuidados agudos médicos e cirúrgicos. Identificou-se taxa de subdiagnóstico do fenômeno de 12,6% nos registros e de 30,6% tendo em conta a percepção dos enfermeiros. Em 8,1%, dos 111 casos, não foi identificado qualquer indicador de confusão aguda/delirium. Somente 4,5% dos doentes tinha o fenômeno diagnosticado. Os resultados apontam dificuldade para se identificar a confusão aguda/delirium, com implicações para a qualidade dos cuidados, sugerindo a necessidade de medidas formativas dirigidas às equipes de saúde.

  4. Para uma análise existencial da saúde

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2006-12-01

    Full Text Available A ontologia fundamental de Heidegger de Ser e Tempo tem servido de fonte de inspiração para investigadores que realizam seus trabalhos nas áreas de saúde mental e saúde coletiva, a despeito das dificuldades de interpretação dessa obra. O entendimento equivocado por Binswanger, na tentativa de transpô-la para a psicanálise, serve de exemplo e é brevemente exposto com base na análise detalhada feita por Loparic. Neste artigo, parte-se do pressuposto de que a linguagem antimetafísica de Heidegger pode ajudar a fechar o que denomina de fenda ontológica entre saúde mental e saúde do corpo. Na primeira parte, recapitulam-se alguns equívocos que podem ser cometidos na interpretação da ontologia heideggeriana e delineiam-se os critérios de não-objetivação e não-determinismo. Na segunda, o autor aporta sua contribuição pessoal, ao explicitar sua própria interpretação da analítica existencial da saúde, articulada em torno de termos, tais como: padecimento, socorro e reatamento.

  5. Refletindo sobre valores éticos da Saúde Global

    Directory of Open Access Journals (Sweden)

    Paulo Antonio de Carvalho Fortes

    2015-06-01

    Full Text Available Desde as últimas décadas do século passado vem sendo construído o campo da saúde global, enfocando questões de saúde supraterritoriais, que extrapolam as fronteiras nacionais, assim como seus determinantes e suas possíveis soluções. Este ensaio objetiva refletir sobre os valores éticos envolvidos na saúde global: justiça social, equidade e solidariedade. Procedeu-se à revisão de artigos científicos e documentos de agências multilaterais. Identificou-se a defesa da saúde global como um bem universal público, analisando os valores da justiça e da equidade com enfoque na alocação e distribuição de recursos, com tendência a priorizar os mais desfavorecidos. São apresentados conceitos de solidariedade, buscando compreender se há a responsabilidade moral de ser solidário com pessoas de outros países, o que justificaria a cooperação internacional na saúde.

  6. Necessidades em saúde: questões importantes para o trabalho da enfermagem

    Directory of Open Access Journals (Sweden)

    Edir Nei Teixeira Mandu

    1999-03-01

    Full Text Available A construção de novos parâmetros e práticas em saúde e enfermagem, no sentido do efetivo exercício de direitos sociais, é um desafio posto na atualidade. Este trabalho é uma contribuição ao enfrentamento desse desafio. Olhando para o saber da enfermagem, reflete-se sobre um dado modo de interpretação das necessidades em saúde. A partir de uma discussão acerca das necessidades humanas e de sua relação com o trabalho em saúde, submete-se à crítica a interpretação das necessidades humanas/em saúde presente na teoria de Wanda de Aguiar Horta. Destaca-se na análise a importância da autonomia/autovalorização humana e a interpretação de necessidades a partir da consideração aos sujeitos que recebem-fazem saúde e ao contexto social.

  7. Što se dogodilo gospodinu Davisonu

    Directory of Open Access Journals (Sweden)

    Una Krizmanić Ožegović

    2014-12-01

    Full Text Available Prije svega, dozvolite mi da kažem da svi osjećamo najiskreniju sućut zbog onoga što se dogodilo gospodinu Davidsonu. Naravno, nitko od nas nije mogao ni pomisliti da će sve tako završiti. To ne treba ni napominjati. Mislim, doista ne vjerujem da je bilo tko mogao predvidjeti posljedice onoga što se dogodilo. Daleko od toga da smo sjeli i proveli detaljnu analizu rizika kad smo odlučili djelovati u tome smjeru. Naravno da ne. Riječ je o spontanoj odluci, jednostavno nas je ponio trenutak. No, unatoč nedostatku podrobnije analize, mogu sa sigurnošću reći kako ovakav ishod nitko od nas nije mogao ni zamisliti. Mislim, očito da nije. Jednostavno, mi nismo takvi ljudi, nitko od nas. Mislim da se to podrazumijeva. Mislim da sa sigurnošću mogu reći kako se to uvriježilo među nekim ljudima koje je ovo pogodilo, u odnosu na kasniji tijek događaja. Uključujući i samoga gospodina Davidsona. S obzirom na sve što smo uspjeli zaključiti. Mislim, znate, neki od ljudi kojima se okružio bili su s pravom oprezni, s obzirom na ono što bismo mogli nazvati pristupom. Tako barem ja to, i dandanas, vidim: takav pristup u sadašnjem trenutku ne bi bio dobro prihvaćen, s obzirom na trenutačne okolnosti. Govorim s obzirom i u odnosu na treće strane, u ovome kontekstu. S obzirom da smo držali kako bi se izravan pristup protumačio kao neprimjeren, u odnosu na širi kontekst i povijest i tome slično.

  8. O complexo industrial da saúde e a necessidade de um enfoque dinâmico na economia da saúde

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2003-01-01

    Full Text Available O artigo desenvolve um enfoque analítico voltado para o estudo do complexo industrial da saúde, englobando o conjunto das atividades produtivas e suas relações de interdependência, segundo uma perspectiva de economia política e da inovação. A lógica empresarial capitalista penetra em todos os segmentos produtivos, envolvendo tanto as indústrias que já operavam tradicionalmente nessas bases quanto segmentos que possuíam formas de organização em que era possível verificar a convivência de lógicas empresariais com outras que dela se afastavam, como a produção de vacinas e produtos biológicos, fitoderivados e a prestação de serviços de saúde. O artigo analisa a interação entre o sistema de saúde e o sistema econômico-industrial, mostrando como tem havido uma dicotomia na relação entre ambos, que se exprime na deterioração do potencial de inovação do país e numa crescente e preocupante vulnerabilidade externa da política de saúde. Sugere-se que o enfoque neoclássico tradicional da economia da saúde é insuficiente para tratar do complexo industrial da saúde, dada a intensidade do processo de mudança estrutural, e a necessidade de um enfoque teórico alternativo que incorpore a dinâmica de transformação econômica e institucional, de acumulação e de inovação.

  9. Anomalous Halo Formation in an Arc-Melted ScNi-Sc2Ni Off-Eutectic Binary Alloy

    Directory of Open Access Journals (Sweden)

    Kai Wang

    2016-07-01

    Full Text Available Diverse non-equilibrium eutectic structures have attracted numerous experimental and theoretical studies. One special type is the formation of a halo of one phase around a primary dendrite of another phase. In our experiments, it was occasionally observed that ScNi halos grow as dendritic morphology around the primary Sc 2 Ni dendrites in an arc-melted ScNi-Sc 2 Ni off-eutectic binary alloy. The formation of this anomalous halo structure was then well reproduced by employing quantitative phase-field simulations. Based on the phase-field simulation, It was found that (i the large undercooling and growth velocity of the ScNi phase during solidification causes the formation of halos; and (ii the released latent heat induces the recalescence phenomenon, and changes the solidification sequence largely, resulting in the anomalous halo structure in the Sc-34 at % Ni alloy.

  10. O Direito à Saúde no Sistema Prisional

    Directory of Open Access Journals (Sweden)

    Gabrielle Jacobi KOLLING

    2013-04-01

    Full Text Available O direito à saúde é objeto de constante análise e, a cada momento, visualiza-se a necessidade de enfrentar diferentes interfaces desse direito fundamental. A complexidade inerente ao sistema social, e, por conseguinte, ao da saúde também, demanda-nos romper com a classificação de cidadãos de primeira e de segunda classe; isso não é republicano, tampouco democrático. A lógica dos desumanizados e excluídos (esquecidos e negligenciados deve ser cambiada pela lógica da inclusão. A análise enfocará a saúde no sistema prisional. Para isso, é condição de possibilidade analisarmos os condicionantes de saúde e os seus efeitos no panorama prisional-sanitário brasileiro. Observaremos, ainda, as ações governamentais para efetivar o direito à saúde no sistema prisional, em especial a Política Pública de Saúde “Plano Nacional de Saúde no Sistema Penitenciário”, que se apresenta como uma tentativa concreta de romper com a negligência do Estado em relação aos integrantes do sistema prisional, aos esquecidos, aos sem voz. ABSTRACT The right to health is matter of constant analysis and, at each moment the need to challenge the different interfaces of this basic right is visible. The innate complexity of the social system and, by consequence to the health system as well, demands that we break with the concept of first and second class citizens; this is not republican or even democratic. The de-humanized and excluded logic (forgotten and neglected must be traded for the inclusion logic. The analysis will focus the prison system’s health. For this is condition of possibility to analyze the health conditions and its effects in the Brazilian prison-sanitary scope. We will also observe the government’s actions to make the right to heath effective in the prison system, in special the Public Health Policy “Nacional Health Plan in the Prison System”, which is presented as a real attempt to break with the state’s negligence

  11. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Pinto

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  12. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Pinto Luiz Felipe

    2004-01-01

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  13. Desigualdades socioeconômicas na saúde

    Directory of Open Access Journals (Sweden)

    Diaz Maria Dolores M.

    2003-01-01

    Full Text Available Este artigo analisa as desigualdades socioeconômicas na área da saúde no Brasil, por meio da mensuração de índice de concentração para a variável autoavaliação do estado de saúde. Utilizou-se a base de dados originada pela Pesquisa Domiciliar sobre Padrões de Vida - PPV - realizada pelo IBGE no período de março/1996 a março/1997, em convênio com o Banco Mundial. Entre os principais resultados, deve-se destacar a constatação de que existem diferenças estatisticamente significativas entre índices calculados a partir de distintas variáveis caracterizadoras do nível socioeconômico dos indivíduos. Neste caso, em particular, os indicadores calculados a partir da classificação baseada na variável renda indicou, sistematicamente, a presença de desigualdades na saúde ligeiramente superiores àquelas identificadas a partir da utilização das despesas familiares. Constatou-se, ainda, que os resultados obtidos são bastante robustos em relação às distintas ponderações utilizadas na construção das escalas de equivalência entre os indivíduos. Todas as simulações realizadas revelaram a presença de desigualdades que favorecem os indivíduos pertencentes às camadas mais elevadas das escalas socioeconômicas adotadas.

  14. Saúde Masculina: representação e experiência de homens trabalhadores com o corpo, saúde e doença.

    Directory of Open Access Journals (Sweden)

    Marco Antonio Alves SEPARAVICH

    2015-10-01

    Full Text Available Este estudo analisou as experiências e representações de homens trabalhadores com o corpo, saúde, doença e cuidado, e os problemas principais de saúde por eles percebidos, quais sejam, a hipertensão arterial e as lombalgias crônicas. Analisou-se como explicam as suas causas; a forma como enfrentam e buscam a resolução ou mitigação desses problemas de saúde, as terapêuticas utilizadas, a interferência que elas acarretam em suas rotinas de vida e identidades. A revisão da literatura da Saúde Coletiva sobre a saúde do homem e masculinidades mostrou que as demandas masculinas na busca por tratamentos nos serviços públicos de saúde e a percepção de que são portadores de necessidades específicas de saúde são minoritárias. Constatou-se também que as abordagens socioantropológicas de como eles convivem e lidam com as enfermidades que os acometem também são raras. Justifica-se, portanto, o interesse e as razões que motivaram este trabalho. As demandas minoritárias masculinas aos serviços de saúde, concebidas a partir da masculinidade tradicional socialmente vigente, e os dados epidemiológicos das altas taxas de morbimortalidade masculina, embasaram a formulação da Política Nacional de Atenção Integral à Saúde do Homem (PNAISH, cujos objetivos buscam promover a melhora da saúde da população masculina na faixa etária dos 20 aos 59, facilitando o seu acesso aos serviços de atendimento integral à saúde na atenção primária. Campinas abriga projeto piloto de tal política. Analisou-se o processo de implementação da PNAISH em um dos centros de saúde da cidade elegido como piloto, cujos serviços estruturam-se na Estratégia Saúde da Família. Entrevistou-se 9 profissionais que nele atuam, especificamente na saúde do adulto, considerando o conhecimento que têm de tal política, as atividades que realizam para o seu atendimento, e os obstáculos observados que dificultam a sua implementação. Para o

  15. BiodanÃa e SaÃde Percebida: um Olhar BiocÃntrico sobre a SaÃde

    OpenAIRE

    Kelen Gomes Ribeiro

    2008-01-01

    Diante da constataÃÃo de uma grande quantidade de abordagens de desenvolvimento humano e de terapias existentes e praticadas no Brasil, atendendo a uma considerÃvel parcela da demanda social relativa aos cuidados com a saÃde dos indivÃduos, consideramos relevante estudar uma abordagem que se coloca como novidade no campo da SaÃde: o Sistema BiodanÃa. A escolha por esse Sistema ocorreu tambÃm devido à nossa afinidade com o mesmo e ao fato de termos realizado pesquisa de iniciaÃÃo cientÃfica so...

  16. A transição paradigmática da saúde como um dever do cidadão: um olhar da bioética em Saúde Pública

    Directory of Open Access Journals (Sweden)

    Paula Gaudenzi

    Full Text Available Uma das preocupações atuais da saúde pública é qual seria o tipo de responsabilização que poderia legitimamente ser exigida dos indivíduos pela sua saúde e, em particular, perguntar-se se é moralmente justificada alguma forma de penalização contra os comportamentos considerados não saudáveis. A bioética aplicada à moralidade das ações em saúde pública pretende garantir tanto um padrão de acesso a um sistema de saúde com cobertura universal quanto o desenvolvimento das capacidades humanas, devendo, portanto, enfrentar o conflito entre os princípios da justiça social e da autonomia individual, ponderando a proteção da saúde dos necessitados e as liberdades fundamentais de todos e de cada um. Para isso, bioética e saúde pública deverão interrogar-se sobre os efeitos biopolíticos inscritos nas políticas sanitárias, situando-se na encruzilhada entre a Era dos Direitos e o Estado de Exceção.

  17. A transição paradigmática da saúde como um dever do cidadão: um olhar da bioética em Saúde Pública

    Directory of Open Access Journals (Sweden)

    Paula Gaudenzi

    2010-06-01

    Full Text Available Uma das preocupações atuais da saúde pública é qual seria o tipo de responsabilização que poderia legitimamente ser exigida dos indivíduos pela sua saúde e, em particular, perguntar-se se é moralmente justificada alguma forma de penalização contra os comportamentos considerados não saudáveis. A bioética aplicada à moralidade das ações em saúde pública pretende garantir tanto um padrão de acesso a um sistema de saúde com cobertura universal quanto o desenvolvimento das capacidades humanas, devendo, portanto, enfrentar o conflito entre os princípios da justiça social e da autonomia individual, ponderando a proteção da saúde dos necessitados e as liberdades fundamentais de todos e de cada um. Para isso, bioética e saúde pública deverão interrogar-se sobre os efeitos biopolíticos inscritos nas políticas sanitárias, situando-se na encruzilhada entre a Era dos Direitos e o Estado de Exceção.

  18. IEC SC15E: Report on liaison activities of CIGRÉ-SC15

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    2000-01-01

    WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...

  19. Energy dependence of deformation parameters in the SC(p,p') SC reaction

    Energy Technology Data Exchange (ETDEWEB)

    Jones, K.W.; Glashausser, C.; de Swiniarski, R.; Nanda, S.; Carey, T.A.; Cornelius, W.; Moss, J.M.; McClelland, J.B.; Comfort, J.R.; Escudie, J.

    1986-01-01

    Values of deformation parameters have been extracted from macroscopic coupled-channels analyses of inelastic proton scattering to the first 2 , 3 , and 4 states of SC over the energy range from 200 to 700 MeV. The apparent deformations are almost unchanged over this energy interval; they agree also with nucleon scattering data at much lower energies and at 800 MeV and 1 GeV.

  20. Programa de Monitoreo Ambiental para Cementos Cienfuegos S.A

    OpenAIRE

    Mario A. Curbelo Hernández; José Luis Romero Cabrera; Henrry Ricardo Cabrera

    2012-01-01

    La presente investigación se realizó en las instalaciones de Cementos Cienfuegos S.A. Cuba, con el objetivo de diseñar e implementar un programa de monitoreo de las variables de concentración de polvo en aire, tasa de deposición y concentración de metales pesados, para la valoración de la calidad del aire a partir de índices establecidos en la norma NC ISO 111:2004. Este programa incluye también el monitoreo de los parámetr...

  1. Genética, saúde e sociedade

    OpenAIRE

    2013-01-01

    O documentário apresenta quatro projetos de pesquisa realizados pelo Instituto de GenéticaMédica Populacional (INAGEMP) em diferentes regiões do país.As atividades mencionadasrepresentam uma amostra do trabalho do INAGEMP, que se estruturou de modo a colocar agenética médica populacional na prática ao associar pesquisa e atenção em saúde parapopulações afetadas por doenças com forte componente genético em sua etiologia.

  2. Significado da massagem com aromaterapia em saúde mental

    OpenAIRE

    Domingos,Thiago da Silva; Braga,Eliana Mara

    2014-01-01

    Objetivo Compreender o significado da intervenção de massagem com aromaterapia em saúde mental para o usuário durante a internação psiquiátrica.Métodos Pesquisa qualitativa que incluiu 22 participantes com diagnóstico de Transtornos de Personalidade internados em unidade psiquiátrica de um hospital geral. Foram realizadas entrevistas semiestruturadas, com uma questão norteadora aos participantes, os quais se submeteram a intervenç...

  3. Possible pharmacological interactions in hypertensive and/or diabetic elderly in family health units at Blumenau (SC

    Directory of Open Access Journals (Sweden)

    Vicente Codagnone Neto

    2010-12-01

    Full Text Available The aim of this study was to examine the possible adverse drug-drug interactions in the elderly population (>60 years diagnosed either with diabetes, arterial hypertension or both, at a Family Health Unit (FHU clinic in Blumenau, state of Santa Catarina, Brazil. For this purpose 318 subjects were interviewed using a pretested form with social and demographic aspects regarding their disease and its complications. All drugs used by this population were grouped, and the drug-drug interactions were detected by using the "Drug Interaction Checker" software, and classified for frequency and severity. The average age of patients was 70.6 years, with a higher number of female patients (216; 67.9%. Most subjects were being treated for both diseases (149; 46.86%. Out of a total of 1,541 medications prescribed, the most prevalent were: hydrochlorothiazide (131; 8.4% and enalapril maleate (130; 8.4%. A total of 295 possible drug-drug interactions were detected in 152 patients (1.9 interactions per subject, 275 (93.2% moderate and 20 (6.8% severe or highly severe. The possible interaction prevalence was 0.93 (0.55 to 1.40 depending on health unit. The most frequent possible interaction was that between acetylsalicylic acid and enalapril maleate (37; 12.5%. Patients had an average consumption of 6.6 drugs and 9.8% of subjects reported physical discomfort when using medicines. Elderly patients use many medications that could cause adverse reactions and possible drug-drug interactions, where this issue warrants closer attention of prescribers and health providers.Buscou-se identificar possíveis interações medicamentosas em pessoas idosas com diabetes melito (DM e/ou hipertensão arterial sistêmica (HAS sendo atendidas em unidades de Saúde da Família, em Blumenau (SC. Entrevistaram-se 318 pessoas com 60 e mais anos, portadoras de DM e/ou HAS, mediante questionário estruturado pré-testado, com variáveis sócio-demográficas da doença e do tratamento. As

  4. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  5. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    2011-09-01

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  6. Phase diagram of (Li(1-x)Fe(x))OHFeSe: a bridge between iron selenide and arsenide superconductors.

    Science.gov (United States)

    Dong, Xiaoli; Zhou, Huaxue; Yang, Huaixin; Yuan, Jie; Jin, Kui; Zhou, Fang; Yuan, Dongna; Wei, Linlin; Li, Jianqi; Wang, Xinqiang; Zhang, Guangming; Zhao, Zhongxian

    2015-01-14

    Previous experimental results have shown important differences between iron selenide and arsenide superconductors which seem to suggest that the high-temperature superconductivity in these two subgroups of iron-based families may arise from different electronic ground states. Here we report the complete phase diagram of a newly synthesized superconducting (SC) system, (Li1-xFex)OHFeSe, with a structure similar to that of FeAs-based superconductors. In the non-SC samples, an antiferromagnetic (AFM) spin-density-wave (SDW) transition occurs at ∼127 K. This is the first example to demonstrate such an SDW phase in an FeSe-based superconductor system. Transmission electron microscopy shows that a well-known √5×√5 iron vacancy ordered state, resulting in an AFM order at ∼500 K in AyFe2-xSe2 (A = metal ions) superconductor systems, is absent in both non-SC and SC samples, but a unique superstructure with a modulation wave vector q = (1)/2(1,1,0), identical to that seen in the SC phase of KyFe2-xSe2, is dominant in the optimal SC sample (with an SC transition temperature Tc = 40 K). Hence, we conclude that the high-Tc superconductivity in (Li1-xFex)OHFeSe stems from the similarly weak AFM fluctuations as FeAs-based superconductors, suggesting a universal physical picture for both iron selenide and arsenide superconductors.

  7. A construção coletiva da Biblioteca Virtual em Saúde

    Directory of Open Access Journals (Sweden)

    Abel Laerte Packer

    2005-08-01

    Full Text Available Retoma-se a origem da Biblioteca Virtual em Saúde (BVS como produto da evolução do programa de cooperação técnica em informação científica em saúde na América Latina e no Caribe. Analisa-se sua conformação tecnológica como produto da reestruturação da comunicação científica promovida pela internet, destacando o aprimoramento conceitual e operacional do modelo de gestão coletiva de informação e conhecimento no espaço virtual e os desafios de promover o acesso e uso democráticos da informação e do conhecimento atualizado nos processos que envolvem a saúde coletiva e individual.

  8. Financiamento do Sistema Único de Saúde nos governos FHC, Lula e Dilma

    Directory of Open Access Journals (Sweden)

    Adilson Soares

    Full Text Available O artigo discute questões relativas ao financiamento e à alocação de recursos no SUS, no contexto de dois projetos políticos distintos. O estudo analisa os gastos com saúde no Brasil, no período de 1995 a 2012, comparados aos gastos internacionais, ao PIB e a Receita Corrente Bruta. Na análise, buscou-se comparar os compromissos assumidos com o SUS nas gestões dos presidentes FHC, Lula e Dilma. Observou-se que, com relação ao comportamento dos gastos com saúde, no âmbito federal, os governos do Partido dos Trabalhadores não diferiram dos governos do Partido da Social Democracia Brasileira. O perfil dos gastos com saúde não deu conta de atender ao sonho da reforma sanitária dos anos 1980.

  9. Conceitos de saúde em discursos contemporâneos de referência científica

    Directory of Open Access Journals (Sweden)

    Coelho Maria Thereza Ávila Dantas

    2002-01-01

    Full Text Available Este trabalho investiga o conceito de saúde em alguns discursos de referência científica, como a sociologia funcionalista, a antropologia e a epistemologia, a partir de autores representativos desses discursos, bem como focalizando suas relações com a noção de doença e com a prática clínica. No campo da sociologia, destacam-se os conceitos de normalidade, rotulação e desvio no referencial da teoria do rótulo. Apresentam-se em seguida os principais modelos de saúde na antropologia médica norte-americana, avaliando-se criticamente as proposições de uma nova perspectiva supostamente capaz de superar a dualidade entre cultura e sociedade: a teoria dos sistemas de signos, significados e práticas. Analisa-se a distinção canguilhemiana entre normalidade e saúde, ressaltando sua originalidade, juntamente com a proposição de saúde como capacidade normativa. Por fim, propõe-se uma distinção entre os conceitos de saúde primária, saúde secundária e saúde terciária como etapa inicial para um processo de construção teórica capaz de subsidiar políticas e práticas sociais baseadas em uma concepção positiva de saúde.

  10. Saúde e imigrantes: as representações e as práticas sobre a saúde e a doença na Comunidade Cabo-Verdiana em Lisboa

    OpenAIRE

    Bárbara, Bäckström

    2009-01-01

    Trata-se da versão publicada da Tese de Doutoramento em Saúde Internacional apresentada ao Instituto de Higiene e Medicina Tropical da Universidade Nova de Lisboa em 2006, sob orientação da Prof. Graça Carapinheiro Este trabalho de investigação constitui uma aproximação sociológica no âmbito da saúde internacional e no contexto da sociologia da saúde, em particular da saúde dos migrantes, relativamente às suas representações e práticas de saúde e de doença. O objecto de investigação centra...

  11. Redes de atenção à saúde sob a luz da teoria da complexidade

    Directory of Open Access Journals (Sweden)

    Cecilia Arruda

    2015-03-01

    Full Text Available Objetivo: Refletir acerca dos princípios que norteiam as Redes de Atenção em Saúde sob a luz dos princípios da Teoria da Complexidade de Edgar Morin. Métodos: Trata-se de uma reflexão teórica. Resultados: Esta reflexão foi organizada em três atos: primeiro, apresenta-se uma contextualização histórica das Redes de Atenção em Saúde no Brasil; segundo, a conexão entre as Redes de Atenção em Saúde e os princípios da teoria da complexidade de Edgar Morin; terceiro, expõe-se alguns desafios para construção das Redes de Atenção em Saúde na perspectiva da complexidade. Conclusão: A conexão existente entre os pressupostos das RAS e os princípios da Teoria da Complexidade sugere a possibilidade de se aprofundar o entendimento, tanto das dificuldades, como das possibilidades de transformação da realidade do serviço de saúde público brasileiro, em busca da implementação da prática da integralidade da atenção à saúde.

  12. Promoção da Saúde na Escola: história e perspectivas

    Directory of Open Access Journals (Sweden)

    Andréa Monteiro de Castro Graciano

    2015-03-01

    Full Text Available Introdução: A promoção da saúde nas escolas envolve a educação em saúde, a criação de entornos saudáveis e a provisão de serviços de saúde. Este estudo objetivou realizar uma revisão crítica da literatura sobre a promoção da saúde nas escolas. Metodologia: Os critérios prévios de inclusão foram: artigos que relacionavam saúde escolar e promoção da saúde, sem limite temporal de publicação. Foram realizadas buscas eletrônicas nas principais bases de dados, entre janeiro e março de 2014. Foram utilizadas as seguintes palavras-chave e conjunto de palavras: promoção da saúde, saúde escolar, health promotion e school health [termo MeSH e termo palavra]. Também foram pesquisados estudos que preencheram os critérios de inclusão originados da lista de referências dos artigos selecionados. Revisão de literatura / Discussão: A saúde escolar avançou em sintonia com o conhecimento técnico-científico e com o desenvolvimento sócio-político, superando, de forma gradativa, o paradigma biomédico para a concepção da iniciativa das Escolas Promotoras de Saúde. No Brasil, foi instituído um novo programa para a saúde do escolar denominado Programa Saúde na Escola (PSE. O PSE se identifica como uma estratégia para a integração e articulação permanente entre as políticas e ações de educação e saúde. Considerações finais: Uma escola promotora de saúde caracteriza-se como uma escola que busca um estilo de vida, aprendizagem e trabalho que favoreça o desenvolvimento da saúde.

  13. Concepção de enfermeiros de uma rede pública de saúde sobre Educação para a Saúde

    Directory of Open Access Journals (Sweden)

    Gisele Coscrato

    2013-06-01

    Full Text Available Estudo qualitativo que objetivou conhecer as concepções de 12 enfermeiros assistenciais, que compõem a rede pública de saúde de um município do interior paulista, sobre Educação para a Saúde, e propor ação educativa. Utilizou-se da metodologia da pesquisa-ação. A coleta dos dados ocorreu no segundo semestre de 2009, nas unidades públicas de saúde desse município. Foram usadas as técnicas de observação participante e entrevistas individuais. A análise e interpretação dos dados foi feita por categorização, fundamentada na teoria de Paulo Freire. Como resultados, revelou-se o reducionismo da Educação para a Saúde na abordagem pedagógica que envolvia a transmissão de conhecimentos, contemplando uma tendência biologicista da formação acadêmica. Porém, nos círculos de discussão, presumiu-se o despertar de uma consciência política relacionada à temática e à promoção da saúde. Concluindo, apreendeu-se a necessidade de mudanças na formação, e de viabilizar novos modos de produção de ciência, na busca pela transformação social.

  14. Semper patrui in fratrum filios seviunt. Les oncles se déchaînent toujours contre les fils de leurs frères. Autour de Thietmar de Mersebourg et de sa Chronique. Représentations de la parenté aristocratique en Germanie vers l’an mille dans les sources narratives.

    Directory of Open Access Journals (Sweden)

    Laurence Leleu

    2010-07-01

    Full Text Available Cette étude s’attache à l’analyse du discours élaboré, dans les sources narratives germaniques du Xe et du début du XIe siècle, sur la famille et la parenté aristocratiques, pour envisager les rapports entre autoreprésentation aristocratique, représentation cléricale et réalité sociale. La famille ne se définit pas biologiquement mais est un phénomène historiquement construit. Le discours sur la parenté et la famille, délivré par des clercs, montre comment ceux-ci, et plus globalement le grou...

  15. Human bulbar conjunctival hemodynamics in hemoglobin SS and SC disease.

    Science.gov (United States)

    Wanek, Justin; Gaynes, Bruce; Lim, Jennifer I; Molokie, Robert; Shahidi, Mahnaz

    2013-08-01

    The known biophysical variations of hemoglobin (Hb) S and Hb C may result in hemodynamic differences between subjects with SS and SC disease. The purpose of this study was to measure and compare conjunctival hemodynamics between subjects with Hb SS and SC hemoglobinopathies. Image sequences of the conjunctival microcirculation were acquired in 9 healthy control subjects (Hb AA), 24 subjects with SC disease, and 18 subjects with SS disease, using a prototype imaging system. Diameter (D) and blood velocity (V) measurements were obtained in multiple venules of each subject. Data were categorized according to venule caliber by averaging V and D for venules with diameters less than (vessel size 1) or greater than (vessel size 2) 15 µm. V in vessel size 2 was significantly greater than V in vessel size 1 in the AA and SS groups (P ≥ 0.009), but not in the SC group (P = 0.1). V was significantly lower in the SC group as compared to the SS group (P = 0.03). In AA and SS groups, V correlated with D (P ≤ 0.005), but the correlation was not statistically significant in the SC group (P = 0.08). V was inversely correlated with hematocrit in the SS group for large vessels (P = 0.03); however, no significant correlation was found in the SC group (P ≥ 0.2). Quantitative assessment of conjunctival microvascular hemodynamics in SS and SC disease may advance understanding of sickle cell disease pathophysiology and thereby improve therapeutic interventions.

  16. 76 FR 58401 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-09-21

    ... Zone; Swim Around Charleston, Charleston, SC in the Federal Register (76 FR 38586). We received no... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  17. Crianças e adolescentes trabalhadores: um compromisso para a saúde coletiva

    Directory of Open Access Journals (Sweden)

    Carlos Minayo-Gomez

    Full Text Available Neste estudo, apresentam-se sucintamente algumas questões referentes ao trabalho infanto-juvenil e suas repercussões na saúde. Apontam-se as principais características estruturais que circunstanciam e justificam socialmente a incorporação precoce desse significativo e crescente segmento da população no mercado de trabalho. Constata-se que, no Brasil, a legislação existente, que proíbe o trabalho de crianças e normatiza o do menor de 18 anos, freqüentemente não é observada. Diante desse quadro, coloca-se como imperativo desenvolver programas de vigilância à saúde desses trabalhadores, em articulação com órgãos públicos e instâncias da sociedade civil.

  18. Coherent broadband mid-infrared supercontinuum generation in As2Se3 photonic crystal fiber

    CERN Document Server

    Yuan, Wu

    2013-01-01

    The generation of fully coherent broadband mid-infrared (MIR) supercontinuum (SC) from 2.3 um to 8.3 um is demonstrated by using a 4.1 um pump and an As2Se3 photonic crystal fiber (PCF).By introducing the random quantum noise and the power instability on the input pulse and by numerically implementing the Young,s double slits experiment, we examine the coherence properties across the SC spectrum. It is found that the coherence of this MIR SC source depends strongly on the input pulse duration, the peak power, the power stability, and the zero-dispersion wavelength (ZDW) of the As2Se3 PCF.The optimal conditions for the MIR SC with a maximal coherent bandwidth are identified.

  19. Núcleo de Apoio à Saúde da Família: uma análise da atenção à saúde em municípios da Região Metropolitana do Recife

    OpenAIRE

    Nascimento,Cynthia Maria Barboza do

    2014-01-01

    O Núcleo de Apoio à Saúde da Família (Nasf) tem como objetivo aumentar a abrangência e o escopo das ações da Estratégia de Saúde da Família. Este núcleo reúne profissionais de diferentes categorias que devem atuar em parceria com a saúde da família. A produção do cuidado pelo Nasf é um objeto bastante complexo e compreender como se organiza e desenvolve-se seu processo de trabalho é relevante para o planejamento de sistemas de saúde mais integrais e resolutivos. O estudo tem como objetivo ana...

  20. The interdisciplinarity experienced in the PET- Saúde program A interdisciplinaridade vivenciada no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Sueli Moreira Pirolo

    2010-01-01

    em parte integrante e inseparável da saúde do indivíduo. A interação dos profissionais da saúde torna-se possível por meio de iniciativas como o PET-Saúde, o qual fomenta a formação profissional articulada com os profissionais da ESF, bem como, o processo de integração ensino-serviço-comunidade na perspectiva da interdisciplinaridade. Objetivo: Relatar a vivência de estudantes ao realizar uma pesquisa interdisciplinar. Descrição da experiência: Esse relato foi vivenciado no projeto PET-Saúde da Faculdade de Medicina de Marília, no sub projeto Saúde do Homem, visando construir e validar um instrumento de coleta de dados por meio da Técnica Delphi, para auxiliar a equipe de saúde detectar precocemente agravos odontológicos, visto que no Brasil, o perfil de saúde bucal, na faixa etária de 35 a 44 anos, está comprometido. Os participantes, deste estudo, são discentes de enfermagem e medicina, preceptora cirurgiã-dentista e tutora docente enfermeira. Para as atividades educacionais utilizou-se a metodologia ativa de ensino-aprendizagem. Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde.

  1. Thermal stability of Al-Mg-Sc-Zr alloy

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wei-tao; YAN De-sheng; RONG Li-jian

    2006-01-01

    The thermal stability of Al3(Sc,Zr) precipitates in the cold worked Al-Mg-Sc-Zr alloy after elevated temperature exposure was investigated. The evaluation was conducted using room temperature tensile, Vicker's hardness, optical metallography and scanning electron microscope (SEM) with the backscatter. The results show that the Al3(Sc,Zr) precipitates and mechanical properties have no obvious change, and the grains keep elongated along the working direction as that in cold worked sample after exposure at 300 ℃ for 1 000 h. The coarsening of Al3(Sc,Zr) precipitates occurs and is no longer effective on the recrystallization resistance, and partial recrystallization is observed after 400 ℃ exposure. In particular, after 500 ℃ exposure, the hardness decreases drastically and the alloy has fully recrystallized due to the obvious coarsening of Al3(Sc,Zr) precipitates.

  2. Quatro tensões na saúde pública

    Directory of Open Access Journals (Sweden)

    Nicolas Lechopier

    2015-04-01

    Full Text Available Este artigo examina a interação da ética, da antropologia social e da epistemologia na saúde pública. Na primeira seção do artigo, introduzimos ao amplo espectro de abordagens existentes que consideram a saúde pública como um campo político, como uma ciência e como um projeto antropológico global que levanta inúmeras questões éticas. Na segunda seção, propomos uma apresentação mais detalhada das principais questões levantadas pela saúde pública através de uma rede de quatro tensões dialéticas fundamentais. A primeira tensão concerne principalmente às dubiedades das definições de saúde e às finalidades propostas para esse campo. A segunda tensão concerne à legitimidade dos meios utilizados para chegar aos objetivos da saúde pública. A terceira tensão diz respeito ao regime de evidência e ao referencial das abordagens empregadas na saúde pública. A quarta tensão se origina nas relações de poder construídas no interior dessas práticas da saúde pública. Sugerimos que essas quatro tensões, nas quais a polarização apresenta uma variedade de formatos, relacionam-se entre si. Isso conduz à conclusão de que na saúde pública, as considerações éticas, antropológicas e epistemológicas precisam andar juntas. Para entender criticamente as questões da saúde pública, precisamos, portanto, levar em conta as íntimas interações entre as ciências, os valores e as práticas.

  3. DESARROLLO DE UN SISTEMA DE INFORMACIÓN PARA LA EMPRESA DATECSA S.A

    Directory of Open Access Journals (Sweden)

    Nelson Javier Reyes

    2013-09-01

    Full Text Available En el siguiente documento se presenta un estudio, implementación y análisis de un sistema para administrar la información de la empresa Colombiana Datecsa S.A. Inicialmente, se tienen en cuenta los requerimientos de los usuarios del sistema, a partir de esto se selecciona la opción tecnológica más viable, para su posterior implementación. Finalmente, se analiza la seguridad del sistema desarrollado, lo que conlleva a demostrar su robustez.

  4. Concepções de saúde de mulheres cuidadoras-leigas : estratégias à sua promoção da saúde

    OpenAIRE

    2007-01-01

    A situação das mulheres cuidadoras-leigas, acompanhantes de crianças hospitalizadas, representa nesse estudo, a sua visão em relação à saúde, a qualidade da atenção dispensada a elas pelos profissionais e as políticas públicas de saúde instituídas em um ambiente hospitalar. Trata-se de uma pesquisa qualitativa do tipo descritivo-exploratório e intervencionista desenvolvida em um hospital-escola na cidade de Porto Alegre/RS, que objetivou conhecer as concepções de saúde de mulheres cuidadoras-...

  5. Avaliação fisioterápica em pacientes pós cirurgia de câncer de mama em Joinville/SC

    Directory of Open Access Journals (Sweden)

    Adriana Teodoro

    2011-07-01

    Full Text Available O câncer de mama é uma neoplasia maligna e também a principal causa morte entre as mulheres. Com o aparecimento do câncer (CA de mama surgem diversas alterações na vida das mulheres acometidas, principalmente após a cirurgia, elas passam a ter uma nova realidade corporal, pois ocorrem alterações importantes em nível anatômico, fisiológico e funcional. O objetivo do presente trabalho foi identificar as alterações, seqüelas, limitações e complicações através de avaliações fisioterápicas em indivíduos que foram submetidos a cirurgias de CA de mama pelo Sistema Único de Saúde (SUS na cidade de Joinville/SC no período de 2007 a 2010. Foram avaliadas 36 mulheres acometidas pelo CA de mama e submetidas à cirurgia. Os dados foram obtidos por entrevistas, exame físico e revisão de prontuários fornecidos pelo Hospital Municipal São José de Joinville/SC. Dos resultados encontrados 88,9% apresentou o carcinoma ductal invasivo, a mastectomia radial modificada com 33,4%, a hipoestesia foi à maior alteração de sensibilidade encontrada, também foi diagnosticado restrição na amplitude de movimento, presença de edema, linfedema, fibrose e aderência, a atividade funcional de maior dificuldade em realizar foi de carregar sacolas. Apesar da gravidade que a lesão neoplásica representa e das complicações apresentadas foi encontrado índice maior de normalidade em relação às complicações e alterações no pós-cirúrgico. Acredita-se que esta normalidade foi atribuída a orientações recebidas pela equipe médica, em realizar após a cirurgia algum tipo de exercício físico ou fisioterapia para acelerar seu retorno as atividades funcionais, melhorando a qualidade de vida e evitando assim suas complicações.

  6. Cyclotron production of (44)Sc: From bench to bedside.

    Science.gov (United States)

    van der Meulen, Nicholas P; Bunka, Maruta; Domnanich, Katharina A; Müller, Cristina; Haller, Stephanie; Vermeulen, Christiaan; Türler, Andreas; Schibli, Roger

    2015-09-01

    (44)Sc, a PET radionuclide, has promising decay characteristics (T1/2 = 3.97 h, Eβ(+)av = 632 keV) for nuclear imaging and is an attractive alternative to the short-lived (68)Ga (T1/2 = 68 min, Eβ(+)av = 830 keV). The aim of this study was the optimization of the (44)Sc production process at an accelerator, allowing its use for preclinical and clinical PET imaging. (44)CaCO3 targets were prepared and irradiated with protons (~11 MeV) at a beam current of 50 μA for 90 min. (44)Sc was separated from its target material using DGA extraction resin and concentrated using SCX cation exchange resin. Radiolabeling experiments at activities up to 500 MBq and stability tests were performed with DOTANOC by investigating different scavengers, including gentisic acid. Dynamic PET of an AR42J tumor-bearing mouse was performed after injection of (44)Sc-DOTANOC. The optimized chemical separation method yielded up to 2 GBq (44)Sc of high radionuclidic purity. In the presence of gentisic acid, radiolabeling of (44)Sc with DOTANOC was achieved with a radiochemical yield of ~99% at high specific activity (10 MBq/nmol) and quantities which would allow clinical application. The dynamic PET images visualized increasing uptake of (44)Sc-DOTANOC into AR42J tumors and excretion of radioactivity through the kidneys of the investigated mouse. The concept "from-bench-to-bedside" was clearly demonstrated in this extended study using cyclotron-produced (44)Sc. Sufficiently high activities of (44)Sc of excellent radionuclidic purity are obtainable for clinical application, by irradiation of enriched calcium at a cyclotron. This work demonstrates a promising basis for introducing (44)Sc to clinical routine of nuclear imaging using PET. Copyright © 2015 Elsevier Inc. All rights reserved.

  7. Assessing the growth and recovery of Salmonella Enteritidis SE86 after sodium dichloroisocyanurate exposure

    Directory of Open Access Journals (Sweden)

    Fernanda Stoduto Ferreira

    2013-09-01

    Full Text Available The objective of the present study was to assess the growth and the recovery of Salmonella (S. Enteritidis SE86 in different diluents, culture media and using different plating methods after the exposure to 200 mg/kg sodium dichloroisocyanurate (NaDCC. Before and after NaDCC exposure, SE86 was cultured at 30 °C and 7 °C in the following diluents: Peptone water (P, Saline solution (SaS, Peptone water+Saline solution (P+SaS, Peptone water+Tween 80+Lecithin+Sodium thiosulfate (P+N and Saline solution+Tween 80+Lecithin+Sodium thiosulfate (SaS+N. The SaS diluent was chosen because it was able to maintain cells viable without growth and was further used for plating SE86 on non selective medium (Tryptic Soy Agar-TSA and on selective media (Mannitol Lysine Crystal Violet Brilliant Green Agar-MLCB; Brilliant Green Agar-BGA; Salmonella Shigella Agar-SS and Xylose Lysine Dextrose-XLD. The Thin Agar Layer method (TAL i.e., selective media overlayed with non selective TSA was also evaluated. Results indicated that SE86 not exposed to NaDCC was able to grow in P, P+N, SaS+N and P+SaS, but not in SaS, that was able to maintain cells viable. SE86 exposed to NaDCC demonstrated similar counts after dilution in SaS and the plating on non selective TSA, selective media MLCB, BGA, SS and XLD and on TAL media. SE86, S. Typhimurium and S. Bredeney, exposed or not exposed to NaDCC, showed no significant differences in counts on TSA, XLD and XLD overlayed with TSA, suggesting that all those media may be used to quantify NaDCC-exposed Salmonella by plating method.

  8. Assessing the growth and recovery of Salmonella Enteritidis SE86 after sodium dichloroisocyanurate exposure.

    Science.gov (United States)

    Ferreira, Fernanda Stoduto; Horvath, Mariana Bandeira; Tondo, Eduardo Cesar

    2013-01-01

    The objective of the present study was to assess the growth and the recovery of Salmonella (S.) Enteritidis SE86 in different diluents, culture media and using different plating methods after the exposure to 200 mg/kg sodium dichloroisocyanurate (NaDCC). Before and after NaDCC exposure, SE86 was cultured at 30 °C and 7 °C in the following diluents: Peptone water (P), Saline solution (SaS), Peptone water+Saline solution (P+SaS), Peptone water+Tween 80+Lecithin+Sodium thiosulfate (P+N) and Saline solution+Tween 80+Lecithin+Sodium thiosulfate (SaS+N). The SaS diluent was chosen because it was able to maintain cells viable without growth and was further used for plating SE86 on non selective medium (Tryptic Soy Agar-TSA) and on selective media (Mannitol Lysine Crystal Violet Brilliant Green Agar-MLCB; Brilliant Green Agar-BGA; Salmonella Shigella Agar-SS and Xylose Lysine Dextrose-XLD). The Thin Agar Layer method (TAL) i.e., selective media overlayed with non selective TSA was also evaluated. Results indicated that SE86 not exposed to NaDCC was able to grow in P, P+N, SaS+N and P+SaS, but not in SaS, that was able to maintain cells viable. SE86 exposed to NaDCC demonstrated similar counts after dilution in SaS and the plating on non selective TSA, selective media MLCB, BGA, SS and XLD and on TAL media. SE86, S. Typhimurium and S. Bredeney, exposed or not exposed to NaDCC, showed no significant differences in counts on TSA, XLD and XLD overlayed with TSA, suggesting that all those media may be used to quantify NaDCC-exposed Salmonella by plating method.

  9. PROPUESTA PARA EL INCREMENTO DE VENTAS DE TRAVESURAS S.A,

    OpenAIRE

    López Reyes, Andrés Felipe

    2013-01-01

    objetivo general del trabajo fue realizar un diagnostico a la empresa Travesuras S.A ante la situación que se ha venido presentando en los últimos años: la baja en sus ventas y la necesidad de cierre de algunos puntos de venta. A partir de lo cual se plantea una propuesta de incremento de ventas que dé solución a la situación.

  10. Acessibilidade e resolubilidade da assistência em saúde mental: a experiência do apoio matricial

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Dias Quinderé

    2013-07-01

    Full Text Available Os Centros de Atenção Psicossocial (CAPS têm também como finalidade articular ações de saúde mental no território, principalmente na Atenção Primária à Saúde (APS. O apoio matricial é uma das formas para esta articulação, pois objetiva assegurar retaguarda especializada às equipes de saúde. Diante disto, a pesquisa pretende compreender como as ações de matriciamento em saúde mental contribuem para a acessibilidade e a resolubilidade dos casos. Trata-se de uma pesquisa qualitativa realizada nas cidades de Fortaleza e Sobral, no Estado do Ceará, cujos sujeitos entrevistados foram 37 (trinta e sete trabalhadores de saúde mental e da atenção primária, 14 (quatorze usuários e 13 (treze familiares que participaram das ações do apoio matricial. Conforme os resultados demonstraram os trabalhadores da APS não se sentem instrumentalizados para intervir nos casos de saúde mental. Existe uma precipitação nos encaminhamentos dos usuários para os CAPS, dificultando a acessibilidade da assistência em saúde mental. Porém, identificou-se que as discussões em saúde mental na atenção primária possibilitam a apropriação dos casos pelos trabalhadores da APS e promovem a aproximação entre as equipes. Deste modo influenciam na resolubilidade dos casos de saúde mental.

  11. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III ni

  12. Effective single chain antibody (scFv) concentrations in vivo via adenoviral vector mediated expression of secretory scFv

    NARCIS (Netherlands)

    Arafat, WO; Gomez-Navarro, J; Buchsbaum, DJ; Xiang, J; Casado, E; Barker, SD; Mahasreshti, PJ; Haisma, HJ; Barnes, MN; Siegal, GP; Alvarez, RD; Hemminki, A; Nettelbeck, DM; Curiel, DT

    2002-01-01

    Single chain antibodies (scFv) represent powerful interventional agents for the achievement of targeted therapeutics. The practical utility of these agents have been limited, however, by difficulties related to production of recombinant scFv and the achievement of effective and sustained levels of s

  13. Propuesta de diseño de un cuadro de mando integral para el despacho Lara Eduarte, S.C.

    OpenAIRE

    2013-01-01

    Tesis de maestría -- Universidad de Costa Rica. Posgrado en Administración y Dirección de Empresas. Maestría Profesional en Administración y Dirección de Empresas con énfasis en Gerencia, 2013 En el primer capítulo de este estudio se contextualiza la industria y se define el marco conceptual en el que se desenvuelve el Despacho Lara Eduarte, S.C. Los despachos de contaduría pública en Costa Rica y en el mundo entero son empresas de servicios profesionales con conocimiento y experiencia com...

  14. Danos materiais causados à Saúde Pública e à sociedade decorrentes de inundações e enxurradas no Brasil, 2010-2014: dados originados dos sistemas de informação global e nacional

    Directory of Open Access Journals (Sweden)

    Aline Costa Minervino

    2016-03-01

    Full Text Available Resumo Este estudo apresenta uma análise de dados sobre danos materiais por desastres hidrológicos no Brasil, de 2010 a 2014. Trata-se de em estudo descritivo que contrasta os resultados de dois bancos de dados de desastre: EM-DAT (global e S2iD (nacional. A análise mostra diferenças tanto no número total de ocorrências de desastres (EM-DAT = 36; S2iD = 4070, quanto nos danos materiais resultantes (EM-DAT – R$ 9,2 bilhões; S2iD – R$ 331,4 bilhões. A análise da distribuição de eventos permite concluir que os cinco estados mais afetados por tais eventos (SC, RS, MG, SP e PR estão nas regiões sul e sudeste, condizente com achados de outros estudos. As edificações que tiverem maiores prejuízos materiais foram, nesta ordem: unidades habitacionais, obras de infraestrutura pública, instalações públicas de uso comunitário, instalações públicas prestadoras de outros serviços, instalações públicas de ensino e instalações públicas de saúde. O prejuízo a instalações pública de saúde apresentou valores elevados. Apesar das limitações de ambos, o EM-DAT e o S2iD demonstraram sua utilidade em determinar tendências sazonais e de longo prazo, bem como padrões e áreas onde se concentram riscos, auxiliando tomadores de decisão na identificação das áreas mais afetadas e vulneráveis aos desastres.

  15. Pesquisa em saúde, política de saúde e eqüidade na América Latina

    Directory of Open Access Journals (Sweden)

    Alberto Pellegrini Filho

    2004-06-01

    Full Text Available O autor analisa as relações entre pesquisa de saúde, políticas de saúde e eqüidade na América Latina. Descreve novas tendências no modo de produção do conhecimento, que permitem maior integração entre as necessidades sociais e a pesquisa, facilitando o vínculo entre esta e o processo de definição de políticas. Analisa as manifestações das novas tendências na América Latina e finaliza com a descrição de algumas iniciativas promovidas pela OPAS no sentido de aproveitar as oportunidades abertas pelas novas tendências para a melhoria das condições de saúde na região. Busca defender a tese de que a informação e o conhecimento são bens públicos essenciais e que as iniqüidades de acesso a esses bens são importantes determinantes das iniqüidades em saúde. Para que as políticas de saúde e as políticas de pesquisa em saúde se integrem e se consolidem como políticas públicas voltadas a atender ao interesse público e à promoção da eqüidade, é necessário o fortalecimento do processo democrático de definição das mesmas, multiplicando os atores envolvidos, os espaços e oportunidades de interação entre eles e instrumentando sua participação com o acesso eqüitativo a informações e conhecimentos científicos pertinentes que permitam a defesa fundamentada de seus interesses.

  16. A integralidade das ações em saúde e a intersetorialidade municipal

    Directory of Open Access Journals (Sweden)

    Liane Teresinha Schuh Pauli

    2013-12-01

    Full Text Available Com a inclusão dos contextos biopsicosocial, econômico e cultural nos conceitos do processo saúde/doença aumentaram as exigências de atuação no âmbito municipal, levando à necessidade de novos contornos no planejamento e na política. Sob a justificativa de avançar no cumprimento das normas legislativas e direcionar esforços intersetoriais capazes de garantir a integralidade das ações em saúde, objetivamos com esta investigação analisar a percepção relativa ao conceito de saúde/doença nos vários níveis da gestão pública e o relacionamento do setor de trabalho com a área da saúde, verificando a viabilidade da intersetorialidade e a percepção sobre a importância desta como estratégia para a promoção da integralidade das ações em saúde. A pesquisa realizou-se em duas etapas, com a utilização do método qualitativo de análise em ambas, por meio de entrevista individual gravada no local de trabalho (Técnica do Discurso do Sujeito Coletivo, o que possibilitou a análise dos depoimentos verbais através das ideias centrais e suas correspondentes expressões-chave. Constituíram-se como sujeitos da pesquisa todos os elementos envolvidos na gestão municipal da cidade de Vera Cruz,RS, mais dois assessores diretos de cada um destes. Observou-se que existe a concepção do conceito de saúde ampliado e positivo, há o reconhecimento da responsabilidade dos vários setores sobre o processo saúde/doença da população e a intenção do trabalho intersetorial. Concluiu-se que, com mudanças político-organizacionais, capacitação de recursos humanos e planejamento, pode-se alcançar melhoria nas ações de promoção da integralidade das ações em saúde.

  17. The high-temperature modification of ScRuSi - Structure, 29Si and 45Sc solid state NMR spectroscopy

    Science.gov (United States)

    Hoffmann, Rolf-Dieter; Rodewald, Ute Ch.; Haverkamp, Sandra; Benndorf, Christopher; Eckert, Hellmut; Heying, Birgit; Pöttgen, Rainer

    2017-10-01

    A polycrystalline sample of the TiNiSi type low-temperature (LT) modification of ScRuSi was synthesized by arc-melting. Longer annealing in a sealed silica tube (6 weeks at 1270 K) followed by quenching led to the high-temperature (HT) phase. HT-ScRuSi adopts the ZrNiAl structure type: P 6 bar 2 m , a = 688.27(9), c = 336.72(5) pm, wR2 = 0.0861, 260 F2 values, 14 variables. The striking structural building units are regular, tricapped trigonal prisms Si1@Ru3Sc6 and Si2@Ru6Sc3. Both polymorphs have been characterized by 29Si and 45Sc MAS-NMR spectroscopy. The local scandium environments in the two polymorphs are easily distinguished by their electric field gradient tensor values, in agreement with theoretically calculated values.

  18. Cyclotron production of {sup 43}Sc for PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

    2015-12-04

    Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

  19. A finitude humana e a saúde pública Human finitude and public health

    Directory of Open Access Journals (Sweden)

    Sergio Rego

    2006-08-01

    Full Text Available A morte é uma questão implícita na prática e na formação dos profissionais da saúde. Há, todavia, uma tendência dos profissionais de saúde de restringir sua discussão aos aspectos meramente técnicos, seja na assistência à saúde, seja nas ações de saúde pública. Este artigo analisa a importância da adoção do cuidado de qualidade no fim de vida como norteador das práticas assistenciais e a necessidade de que o campo da Saúde Pública tome esses cuidados como objeto de reflexão e de pesquisas. Por fim, aponta-se para aspectos relevantes para a formação de profissionais de saúde para que sejam respeitadores das diferenças e comprometidos com o diálogo.Death is an implicit subject in both health practice and health professionals' training. There is a tendency by health professionals to reduce this analysis merely to technical aspects. This paper analyzes the importance of adopting quality care at the end of life as a guide for public health care. We highlight relevant aspects for training health professionals to respect moral differences and to be prepared to discuss their own points of view.

  20. A dimensão ética na educação para a saúde

    Directory of Open Access Journals (Sweden)

    Patrick Paul

    2005-04-01

    Full Text Available A ética, como julgamento de apreciação das condutas positivas e negativas, tanto no que diz respeito ao usuário como ao profissional, coloca de início a problemática do desejo e do conhecimento. A educação para a saúde, através dos três modelos classicamente referidos da saúde positiva, da saúde negativa e da saúde global, vai interrogar de variadas maneiras o posicionamento ético em função dos pontos de vista diferentes fortemente ligados às representações sociais. Além disso, o questionamento ético da saúde inscreve-se também naquele, mais largo, da filosofia da educação entre praxis e poïesis. Mas ele impõe também a aceitação do acidente como imperativo que valoriza o erro, com a introdução da complexidade vindo quebrar o dogma das certezas. Reunir as diferentes facetas da saúde e de sua educação sugere então, finalmente, que tomar cuidado é viver o mais autenticamente possível, com o educar para a saúde significando formar e formar-se para a autenticidade.

  1. Problematizando a institucionalização da educação popular em saúde no SUS

    Directory of Open Access Journals (Sweden)

    Osvaldo Peralta Bonetti

    2014-12-01

    Full Text Available No contexto da implementação da Política Nacional de Educação Popular em Saúde, aprofundam-se a análise e reflexão sobre o processo de institucionalização da Educação Popular em Saúde no Sistema Único de Saúde. Identifica-se e problematiza-se a compreensão dos atores do campo da educação popular sobre o processo de institucionalização, suas potencialidades, riscos e desafios. Configura-se em uma pesquisa qualitativa realizada por meio de entrevistas semiestruturadas e análise bibliográfica. Conclui que a institucionalização da educação popular em saúde configura-se em uma aposta e que seu êxito dependerá do reconhecimento e respeito à historicidade e ao conjunto dos saberes, práticas e lutas do campo popular na saúde.

  2. Um objeto de estudo sobre ensino de enfermagem psiquiátrica e saúde mental

    Directory of Open Access Journals (Sweden)

    Luciane Prado Kantorski

    1998-09-01

    Full Text Available O artigo aborda a construção de um objeto de estudo sobre o ensino de enfermagem psiquiátrica e saúde mental. Apóia-se no referencial teóricometodológico marxista redimensionando conceitos como o ensino - enquanto prática de reprodução e resistência - ideologia/contra-ideologia, atores/sujeitos sociais, saúde mental e reforma psiquiátrica.

  3. Uma reflexão sobre a assistência à saúde do idoso no Brasil

    OpenAIRE

    2007-01-01

    O Brasil se depara com uma demanda por serviços médicos outrora restrita aos países industrializados. Estudo objetivou refletir sobre a assistência à saúde do idoso no Brasil e analisar os fatores envolvidos nas internações e reinternações de idosos nas instituições de saúde. Pesquisa bibliográfica compreendida entre 1990 e 2006, em base de dados LILACS. No Brasil, embora existam problemas em virtude da pobreza e falta de acesso à saúde por muitos, em virtude de difícil acesso, analfabetismo...

  4. Avaliação na atenção especializada em saúde bucal

    OpenAIRE

    Alexandre Raphael Deitos

    2009-01-01

    O objetivo do estudo foi avaliar os Centros de Especialidades Odontológicas (CEO), com vistas ao monitoramento e avaliação da atenção especializada em saúde bucal no Sistema Único de Saúde. Trata-se de um estudo transversal piloto, que utilizou parte do banco de dados de do estudo descritivo realizado pela Coordenação Nacional de Saúde Bucal entre 2008 e 2009. A pesquisa foi aprovada pelo Comitê de Ética em Pesquisa da FOUSP. Os dados foram organizados e analisados no programa STATA 10.0. Par...

  5. Effects of cooling rate on solidification behavior of dilute Al-Sc and Al-Sc-Zr solid solution

    Institute of Scientific and Technical Information of China (English)

    金头男; 聂祚仁; 徐国富; 阮海琼; 杨军军; 付静波; 左铁镛

    2004-01-01

    Six alloys with different compositions of Al-0.1%Sc, Al-0.3%Sc, Al-0.3%Zr, Al-0.1% Sc-0. 1%Zr,Al-0.3%Sc-0.1%Zr and Al-0.3%Sc-0.3%Zr were prepared by casting in a wedge shaped copper mould. The hardness test, microstructure observation, and DSC thermal analysis were applied to fully investigate the solidification behavior of the wedge tip (whose cooling rate is 1 000 K/s) and the top surface (cooling rate 100 K/s) of each casting. The results show that the cast structures in the hypoeutectic region of Al-Sc alloys are slightly affected by cooling rates during the solidification. In the case of hypereutectic alloy of Al-0.3%Sc-0.3%Zr , the cast grains were remarkably refined under the condition of a 100 K/s cooling rate, however, under a 1 000 K/s cooling rate condition,solute atoms contribute nothing to the grain-refinement, due to the eutectic concentration becomes higher. The hardness can be improved to a greater degree by Sc single addition, compared to single Zr addition, but it can be improved even greater when Sc added together with Zr. It is sensitive to cooling rate, the higher the cooling rate, the greater the hardness. By combining the results of TEM examination and DSC analysis, it can be seen that a supersaturated Al solid solution forms during the solidification, and the solubility of Sc in Al solution can be improved by increasing the cooling rate.

  6. Intervenções em saúde pública e seu impacto nas desigualdades sociais em saúde

    Directory of Open Access Journals (Sweden)

    José Leopoldo Ferreira Antunes

    2015-06-01

    Full Text Available Este artigo resume a avaliação de três programas de saúde pública em relação à sua eficácia e impacto sobre as desigualdades sociais na saúde. Foram examinadas a fluoração da água de abastecimento público no contexto brasileiro, a provisão de terapêutica antirretroviral para pacientes com Aids e a vacinação de idosos contra a gripe na cidade de São Paulo. As três intervenções foram consideradas efetivas, na medida em que propiciaram uma redução na carga de doença na população. No entanto, elas tiveram resultados conflitantes quanto ao impacto sobre as desigualdades em saúde. Concluiu-se, por fim, que os programas de saúde pública devem ser implementados com um alcance imediata e efetivamente universal, direcionando recursos adicionais aos grupos com mais necessidades de saúde. Essa estratégia reduziria, ao mesmo tempo, o nível geral de doença na população e as desigualdades na experiência de doenças entre os estratos sociais.

  7. Complexidade em Saúde da Família e formação do futuro profissional de saúde

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    2009-09-01

    Full Text Available As características do Sistema Único de Saúde (SUS e da Estratégia de Saúde da Família (ESF os aproximam do pensamento complexo, termo que não se refere à adjetivação de fenômeno de aspectos múltiplos, e sim ao marco teórico e epistemológico. Indícios de inadequação da formação dos profissionais de saúde para a atuação em Saúde da Família levaram a proposta de levantar a formação desses profissionais para a abordagem ampliada de saúde implicada no SUS/ESF. Foram realizados grupos focais com acadêmicos de Enfermagem, Medicina e Odontologia da Universidade Federal do Amazonas, analisado sob a perspectiva hermenêutica dialética. Os dados apontaram para a formação reducionista/biomédica nas três profissões assim como o foco no trabalho individual, e não em equipe multiprofissional, quadro inadequado ao SUS/ESF, que preconiza atuação profissional focada na complexidade do entorno sócioeconômico e antropológico dos usuários do sistema.

  8. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Nogueira Vera Maria Ribeiro

    2004-01-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  9. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Vera Maria Ribeiro Nogueira

    2004-06-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  10. Paism: um marco na abordagem da saúde reprodutiva no Brasil

    Directory of Open Access Journals (Sweden)

    Maria José Martins Duarte Osis

    Full Text Available O Programa de Assistência Integral à Saúde Mulher (PAISM foi lançado pelo Ministério da Saúde em 1983, sendo anunciado como uma nova e diferenciada abordagem da saúde da mulher. Paradoxalmente, o PAISM constitui-se também na primeira vez em que o Estado brasileiro propôs explicitamente, e implantou, embora de modo parcial, um programa que contemplava a regulação da fecundidade. Isso suscitou suspeitas acerca de possíveis intenções ocultas de controle da natalidade. Porém, analisando brevemente a história desse Programa e seu significado social, conclui-se que o PAISM foi pioneiro, inclusive no cenário mundial, ao propor o atendimento à saúde reprodutiva das mulheres, no âmbito da atenção integral à saúde, e não mais a utilização de ações isoladas em planejamento familiar. Por isso mesmo, os movimentos de mulheres, de imediato, passaram a lutar por sua implementação. Seu conteúdo inclui plenamente a definição de saúde reprodutiva adotada pela Organização Mundial da Saúde em 1988, ampliada e consolidada no Cairo em 1994 e em Beijing em 1995. Conseqüentemente, a adoção do PAISM representou, sem dúvida, um passo significativo em direção ao reconhecimento dos direitos reprodutivos das mulheres, mesmo antes que essa expressão ganhasse os diversos foros internacionais de luta.

  11. Educação em saúde: uma nova abordagem

    Directory of Open Access Journals (Sweden)

    Solange L'Abbate

    1994-12-01

    Full Text Available Este artigo desenvolve reflexão sobre um conjunto de experiências na área de Educação em Saúde, entendida como campo privilegiado de práticas que ocorrem no nível das relações sociais estabelecidas cotidianamente pelos profissionais de saúde, no âmbito institucional, envolvendo os diversos atores presentes. Assumindo que é sobretudo por meio dessas práticas que se presta o atendimento de saúde ao usuário, torna-se necessário colocar à disposição do profissional de saúde. Capacitação didático-pedagógica específica e a possibilidade de participação em estratégias, visando ao desenvolvimento do papel profissional. Nesse sentido, as experiências analisadas apontam para a importância de se dispor de abordagens teórico-metodológicas adequadas, como a do Psicodrama Pedagógico e da Metodologia Arvoredo, mediante as quais tem sido possível instrumentalizar os profissionais interessados em aperfeiçoar-se nesse campo. Ao mesmo tempo, dados os pressupostos das abordagens referidas, tem sido possível demonstrar ser imprescindível adotar postura ética de busca constante da autonomia como pressuposto básico do processo de construção de sujeitos\\cidadãos, sejam eles outros profissionais ou usuários. Entre as possibilidades trazidas por tal abordagem e os limites da atual constituição dos serviços de saúde, situa-se a proposta em pauta.

  12. Educação em saúde: uma nova abordagem

    Directory of Open Access Journals (Sweden)

    L'Abbate Solange

    1994-01-01

    Full Text Available Este artigo desenvolve reflexão sobre um conjunto de experiências na área de Educação em Saúde, entendida como campo privilegiado de práticas que ocorrem no nível das relações sociais estabelecidas cotidianamente pelos profissionais de saúde, no âmbito institucional, envolvendo os diversos atores presentes. Assumindo que é sobretudo por meio dessas práticas que se presta o atendimento de saúde ao usuário, torna-se necessário colocar à disposição do profissional de saúde. Capacitação didático-pedagógica específica e a possibilidade de participação em estratégias, visando ao desenvolvimento do papel profissional. Nesse sentido, as experiências analisadas apontam para a importância de se dispor de abordagens teórico-metodológicas adequadas, como a do Psicodrama Pedagógico e da Metodologia Arvoredo, mediante as quais tem sido possível instrumentalizar os profissionais interessados em aperfeiçoar-se nesse campo. Ao mesmo tempo, dados os pressupostos das abordagens referidas, tem sido possível demonstrar ser imprescindível adotar postura ética de busca constante da autonomia como pressuposto básico do processo de construção de sujeitoscidadãos, sejam eles outros profissionais ou usuários. Entre as possibilidades trazidas por tal abordagem e os limites da atual constituição dos serviços de saúde, situa-se a proposta em pauta.

  13. Saúde organizacional e síndrome de burnout em escolas e hospitais

    Directory of Open Access Journals (Sweden)

    Etienne Andrade de Medeiros Dantas

    2012-04-01

    Full Text Available Estudou-se a prevalência da síndrome de burnout em instituições hospitalares e escolares em conformidade com a saúde organizacional dessas instituições. A pesquisa empírica foi realizada em três escolas públicas de ensino médio e em três hospitais públicos, sendo um geral, um especializado e outro militar. Contou-se com amostra acidental de 168 participantes. Para avaliação da prevalência da síndrome de burnout, aplicaram-se o Inventário de Burnout de Maslach (MBI e uma ficha sociodemográfica. Para análise de saúde organizacional, foram realizadas entrevistas semi-estruturadas com pessoas-chave das organizações, utilizando um roteiro baseado nos fatores-componentes do construto. Os resultados corroboram a expectativa de alta prevalência da síndrome de burnout. Entretanto, não se encontraram diferenças de prevalência entre as instituições participantes, embora os participantes das escolas apresentem escores mais elevados no fator de Diminuição da Realização Pessoal. Em relação à variação da saúde organizacional, observou-se uma precária saúde organizacional em todas as instituições pesquisadas.  No entanto, considerando a alta prevalência da síndrome de burnout, é adequado assinalar que os resultados corroboram a previsão de que um ambiente de saúde organizacional deficiente amplia a probabilidade de desenvolvimento da síndrome pelos trabalhadores.

  14. BASIC ACTIVITIES OF THE HUMAN RESOURCE MANAGEMENT IN ENSURING STAFF FOR S.C. ROMLUX S.A.

    Directory of Open Access Journals (Sweden)

    SECARĂ CARMEN-GABRIELA

    2014-08-01

    Full Text Available Within the analysis conducted, the main activities in the field of human resource management has been assessed, such as: human resource planning; recruitment and selection of staff; assessment of individual professional performances; initial and continuing training; evaluation of human resources management costs; motivation. However, there have also been reviewed with a lower degree of detailing, other issues of interest, such as: human resources assessment; promotion of staff. Following the integration of conclusions of analysis conducted for the business areas listed, it resulted the picture of the most important elements with generalizing value.

  15. STUDY CONCERNING THE ASSESSMENT AND EVALUATION OF HUMAN FACTOR IN S.C. HIDROELECTRICA S.A., CURTEA DE ARGEȘ

    Directory of Open Access Journals (Sweden)

    SECARĂ CARMEN-GABRIELA

    2014-08-01

    Full Text Available The assessment of professional performance is a delicate problem in the organization management. When it comes to training, payment or promotion, all these operations only take place following an assessment. The purpose of the assessment is to assist in making decisions that affect individuals, which decisions should have an objective and fair basis. The need for this activity is dictated by: the expression and sizing of the objectives, setting deviations from the objectives and making the necessary corrections, determining the directions and methods for the refresher training of the staff, decreasing the risks r caused by retaining and promoting incompetent persons, a better assignment of the employees on positions, fair salaries, increasing the competitive capacity of the organization. All these are explicit functions of the performance assessment, but there are also implicit reasons. Assessment is an activity through which employees are motivated, personal contacts are maintained, high-quality work is recognised, and a certain image of the assessed employee is promoted.[2] Knowing then performance achieved involves an understanding of how tasks are fulfilled, the yield at the workplace. Knowing performance offers the assessed person self-confidence, and is also a mobilizing factor that generates a positive attitude towards work.

  16. O papel do enfermeiro de saúde publica: projeções no ensino

    Directory of Open Access Journals (Sweden)

    Bertha Cruz Enders

    1995-09-01

    Full Text Available Analisa-se o papel do enfermeiro em saúde pública no contexto do ensino, como ponto de partida para uma avaliação da prática. Objetivou-se 1 Identificar o papel do enfermeiro em saúde pública projetado nos conteúdos programáticos das disciplinas de saúde pública do Curso de Enfermagem na Universidade Federal do Rio Grande do Norte desde sua implantação em 1974 até 1990 e, 2 Avaliar as concepções projetadas no ensino frente a realidade das práticas dos egressos. Conceptualizações da teoria de papeis nortearam o entendimento do termo "papel" e do processo de internalização do conceito. Utilizou-se uma abordagem qualitativa com triangulação na coleta de dados. Dados foram obtidos em duas fontes: nos conteúdos programáticos do Curso e nas opiniões dos enfermeiros egressos do Curso. Técnicas de análise documental foram aplicadas a 70 programas de disciplinas de Saúde Pública e uma amostra aleatória estratificada de 60 enfermeiros foi entrevistada utilizando um questionário específico. Os dados foram analisados à luz da teoria de papeis para a identificação do conceito. Em seguida, se analisou o conceito com base nas políticas de saúde vigentes da época em estudo. Os resultados demonstram que o papel do enfermeiro em saúde pública projetado nos conteúdos focaliza funções múltiplas, assistenciais educativas e administrativas dentro de uma visão preventiva. O objetivo da enfermagem em saúde pública tem sido a prevenção, dentro de uma prática de assistência primária e mais recentemente, dentro de uma perspectiva de mudança e de transformação das questões sociais e das políticas de saúde. Focaliza o enfermeiro planejador, competente nas técnicas epidemiológicas. A percepção dos egressos é também preventiva e focaliza o papel educador e conscientizador do enfermeiro, embora pouco avanço se observa com relação às questões sociais da população. Existe uma incompatibilidade entre os

  17. The influence of shear-velocity heterogeneity on ScS2/ScS amplitude ratios and estimates of Q in the mantle

    Science.gov (United States)

    Chaves, Carlos A. M.; Ritsema, Jeroen

    2016-08-01

    Regional waveforms of deep-focus Tonga-Fiji earthquakes indicate anomalous traveltime differences (ScS2-ScS) and amplitude ratios (ScS2/ScS) of the phases ScS and ScS2. The correlation between the ScS2-ScS delay time and the ScS2/ScS amplitude ratio suggests that shear wave apparent Q in the mantle below the Tonga-Fiji region is highest when shear wave velocities are lowest. This observation is unexpected if temperature variations were responsible for the seismic anomalies. Using spectral element method waveform simulations for four tomographic models, we demonstrate that focusing and scattering of shear waves by long-wavelength 3-D heterogeneity in the mantle may overwhelm the signal from intrinsic attenuation in long-period ScS2/ScS amplitude ratios. The tomographic models reproduce the trends in recorded ScS2-ScS difference times and ScS2/ScS amplitude ratios. Although they cannot be ruled out, variations in shear wave attenuation (i.e., the quality factor Q) are not necessary to explain the data.

  18. Saúde Mental na Atenção Básica: Sentidos Atribuídos pelos Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Raul Franklin Sarabando de Moura

    Full Text Available Em consideração a normas recentes do Ministério da Saúde, que regulamentam as relações entre a Saúde Mental e a Atenção Básica, esta pesquisa tem por objetivo estudar os sentidos atribuídos pelo ACS à Saúde Mental e suas implicações na prática cotidiana, além de suas percepções sobre as ações do Programa de Residência Multiprofissional em Atenção à Saúde (PRMAS. Trata-se de um estudo qualitativo, segundo o referencial da Hermenêutica de Profundidade,feito através de observação participante e entrevistas semidirigidas. Os resultados alcançados apontam a centralização dos cuidados em Saúde Mental nos CAPS, especialmente através de medicações. Em relação ao PRMAS, percebe-se o papel de matriciamento exercido pela residência, por meio da escuta e acompanhamento do ACS, que encontra situações de sofrimento psíquico em seu cotidiano mas se sente despreparado para lidar com elas. A residência fortalece a integralidade do cuidado, conforme qualifica a atuação do ACS e o orienta em casos difíceis, bem como pode ser um articulador do trabalho, através das iniciativas de aproximação entre os serviços que tem promovido.

  19. A inserção do psicólogo na estratégia de saúde da família e a transição de paradigma em saúde = The insertion of the psychologist in the esf and the health paradigm transition

    Directory of Open Access Journals (Sweden)

    Giacomozzi, Andréia Isabel

    2012-01-01

    Full Text Available Este trabalho discute alguns dos modelos de compreensão do binômio saúde-doença e suas aplicações no Sistema Único de Saúde brasileiro. Para tanto, faz-se uma revisão de estudos sobre a situação da Estratégia de Saúde da Família com relação à sua atuação, destacando-se a predominância de práticas fragmentadas e uma visão de saúde como ausência de doença somente, apesar do preceito de integralidade preconizado pelo SUS. Argumenta-se a favor da inserção do psicólogo na saúde pública como participante das equipes de saúde da família pelo entendimento de que este profissional pode dar uma contribuição importante para a superação do modelo hegemônico em saúde (biomédico por um modelo mais abrangente e integrado, que reconhece a saúde como um fenômeno multidimensional, no qual interagem aspectos biológicos, psicológicos e sociais e caminha para uma compreensão mais holística do processo saúde-doença

  20. Pascal-SC a computer language for scientific computation

    CERN Document Server

    Bohlender, Gerd; von Gudenberg, Jürgen Wolff; Rheinboldt, Werner; Siewiorek, Daniel

    1987-01-01

    Perspectives in Computing, Vol. 17: Pascal-SC: A Computer Language for Scientific Computation focuses on the application of Pascal-SC, a programming language developed as an extension of standard Pascal, in scientific computation. The publication first elaborates on the introduction to Pascal-SC, a review of standard Pascal, and real floating-point arithmetic. Discussions focus on optimal scalar product, standard functions, real expressions, program structure, simple extensions, real floating-point arithmetic, vector and matrix arithmetic, and dynamic arrays. The text then examines functions a

  1. III-V compound SC for optoelectronic devices

    Directory of Open Access Journals (Sweden)

    Sudha Mokkapati

    2009-04-01

    Full Text Available III-V compound semiconductors (SC have played a crucial role in the development of optoelectronic devices for a broad range of applications. Major applications of InP or GaAs based III-V compound SC are devices for optical fiber communications, infrared and visible LEDs/LDs and high efficiency solar cells. GaN based compounds are extremely important for short wavelength light emitters used in solid state lighting systems. We review the important device applications of various III-V compound SC materials.

  2. SC-System of convergence theory and foundations

    Directory of Open Access Journals (Sweden)

    Sergio G. De los Cobos Silva

    2015-08-01

    Full Text Available In this paper a novel system of convergence (SC is presented as well as its fundamentals and computing experience. An implementation using a novel mono-objetive particle swarm optimization (PSO algorithm with three phases (PSO-3P: stabilization, generation with broad-ranging exploration and generation with in-depth exploration, is presented and tested in a diverse benchmark problems. Evidence shows that the three-phase PSO algoritm along with the SC criterion (SC-PSO-3Pcan converge to the global optimum in several difficult test functions for multiobjective optimization problems, constrained optimization problems and unconstrained optimization problems with 2 until 120,000 variables.

  3. Gadolinium scandium germanide, Gd2Sc3Ge4

    Directory of Open Access Journals (Sweden)

    Sumohan Misra

    2009-04-01

    Full Text Available Gd2Sc3Ge4 adopts the orthorhombic Pu5Rh4-type structure. The crystal structure contains six sites in the asymmetric unit: two sites are statistically occupied by rare-earth atoms with Gd:Sc ratios of 0.967 (4:0.033 (4 and 0.031 (3:0.969 (3, one site (.m. symmetry is occupied by Sc atoms, and three distinct sites (two of which with .m. symmetry are occupied by Ge atoms. The rare-earth atoms form two-dimensional slabs with Ge atoms occupying the trigonal-prismatic voids.

  4. The preliminary study of autophagy induction of SA and MeSA by confocal

    Science.gov (United States)

    Yun, Lijuan; Chen, Wenli

    2010-02-01

    Autophagy appears to be a highly conserved process from unicellular to multicellular eukaryotes which contributes to the equilibrium of intracelluar environment. While it would be harmful to the cells when it is excessive by inducing programmed cell death (PCD). It is a protein degradation process in which cells recycle cytoplasmic contents when subjected to environmental stress conditions or during certain stages of development. Previous studies have demonstrated autophagy can be induced during abiotic or biotic stresses. salicylic acid (SA) and methyl salicytic (MeSA) are endogenous signal molecules. We found SA and MeSA can induce autophagy in Arabidopsis thaliana respectively. While autophagy was not induced by SA or MeSA in tobacco suspension cells under the same concentration and period. The differences in stuctures or physiological states may contribute to the results.

  5. SA3654 Component characterization. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Meir, G.W.

    1996-06-01

    AlliedSignal Inc., Federal Manufacturing & Technologies (FM&T), was provided with production capability assurance program (PCAP) funding to develop, characterize, and qualify purchased product components for use on the PRESS-A program. The SA3654, N-Channel, Power MOSFET was identified as a component needing such activity to support PRESS-A. This report presents the characterization activities and results for the SA3654.

  6. SaVi: satellite constellation visualization

    CERN Document Server

    Wood, Lloyd

    2012-01-01

    SaVi, a program for visualizing satellite orbits, movement, and coverage, is maintained at the University of Surrey. This tool has been used for research in academic papers, and by industry companies designing and intending to deploy satellite constellations. It has also proven useful for demonstrating aspects of satellite constellations and their geometry, coverage and movement for educational and teaching purposes. SaVi is introduced and described briefly here.

  7. Infectivity-associated PrP(Sc) and disease duration-associated PrP(Sc) of mouse BSE prions.

    Science.gov (United States)

    Miyazawa, Kohtaro; Okada, Hiroyuki; Masujin, Kentaro; Iwamaru, Yoshifumi; Yokoyama, Takashi

    2015-01-01

    Disease-related prion protein (PrP(Sc)), which is a structural isoform of the host-encoded cellular prion protein, is thought to be a causative agent of transmissible spongiform encephalopathies. However, the specific role of PrP(Sc) in prion pathogenesis and its relationship to infectivity remain controversial. A time-course study of prion-affected mice was conducted, which showed that the prion infectivity was not simply proportional to the amount of PrP(Sc) in the brain. Centrifugation (20,000 ×g) of the brain homogenate showed that most of the PrP(Sc) was precipitated into the pellet, and the supernatant contained only a slight amount of PrP(Sc). Interestingly, mice inoculated with the obtained supernatant showed incubation periods that were approximately 15 d longer than those of mice inoculated with the crude homogenate even though both inocula contained almost the same infectivity. Our results suggest that a small population of fine PrP(Sc) may be responsible for prion infectivity and that large, aggregated PrP(Sc) may contribute to determining prion disease duration.

  8. Representações sociais da educação em saúde pelos profissionais da equipe de saúde da família

    Directory of Open Access Journals (Sweden)

    Maria Flávia Carvalho Gazzinelli

    Full Text Available Este estudo discute a forma como os profissionais da equipe de saúde da família pensam e representam a educação em saúde e a prática educativa que realizam. Os sujeitos da pesquisa (n=248 - médico, enfermeiro, auxiliar de enfermagem e agente comunitário de saúde de 20 unidades básicas de saúde de Belo Horizonte - foram entrevistados mediante a utilização da técnica de evocação livre e da teoria das representações sociais. Solicitou-se aos sujeitos que verbalizassem cinco palavras que lhes ocorressem imediatamente em relação à educação em saúde, classificando-as em positiva ou negativa. Utilizou-se o software Evoc e calculou-se a frequência simples de ocorrência, a média ponderada de ocorrência em função da ordem de evocação e a média das ordens ponderadas do conjunto dos termos evocados. Construiu-se o quadro de quatro casas composto do núcleo central, elementos de contraste e periféricos da representação. Médicos e enfermeiros compartilham conteúdos representacionais entre si, expressando representações sociais similares, ao apresentarem nos possíveis núcleos centrais 'capacitação' e 'prevenção'. Auxiliares de enfermagem e agentes comunitários de saúde se assemelham por meio dos possíveis elementos centrais 'educação' e 'prevenção'. O foco recai na transmissão de orientações com o objetivo de persuadir os indivíduos à adoção de modos de vida saudáveis.

  9. Grupos de pesquisa em história da saúde

    OpenAIRE

    Zytkuewisz,Gabriela Venier

    2011-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Enfermagem Trata-se de um estudo qualitativo, exploratório, descritivo documental que objetiva conhecer os grupos de pesquisa que possuem a linha de pesquisa história da saúde quanto à produção e difusão do conhecimento produzido perante a comunidade acadêmica e científica. A coleta de dados foi realizada no período de dezembro de 2010 a setembro de 2011. Os dados fora...

  10. Caso de estudio. Automatización de Oficinas S.A.

    OpenAIRE

    2006-01-01

    En este caso se presentan las siguientes situaciones : La empresa cuenta con una buena posición e imagen en el negocio de los muebles. Un mercado altamente competitivo. Automatización de Oficinas S.A. posee un producto con altos estándares de calidad. La empresa han presentado una disminución en los márgenes rentabilidad manejados. DESCRIPCION : El caso muestra la situación de la empresa Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización...

  11. Saúde mental como tema transversal no curriculo de enfermagem

    OpenAIRE

    Ana Ruth Macêdo Monteiro

    2003-01-01

    Busca-se com este estudo averiguar a possibilidade do conteúdo de saúde mental ser transversal nas disciplinas dos cursos de graduação em enfermagem, descrevendo a experiência desenvolvida em uma universidade pública e conhecendo a percepção dos acadêmicos sobre essa prática. Participaram da pesquisa 27 alunos. Foi utilizado o questionário. No que diz respeito à inserção da saúde mental em outras disciplinas, 18,5 % considerou ótima, 70,5% boa e 11% como regular. Quanto a sua aplicabilidade 7...

  12. Estresse, coping e estado de saúde entre enfermeiros hospitalares

    Directory of Open Access Journals (Sweden)

    Laura de Azevedo Guido

    2011-12-01

    Full Text Available Estudo quantitativo com o objetivo de identificar estressores, nível de estresse dos enfermeiros, estado geral de saúde e formas de enfrentamento utilizadas pelos enfermeiros no ambiente de trabalho. Os dados foram coletados utilizando-se três instrumentos: formulário para levantamento de atividades diárias; inventário de estratégias de coping; inventário sobre o estado geral de saúde. A população deste estudo foi composta de 143 enfermeiros e a maioria encontra-se com baixo nível de estresse (55,25% e com estado regular de saúde (50,35%. Em relação às formas de enfrentamento, identificou-se resolução de problemas como o fator de maior média. Concluindo, ações educativas devem ser incentivadas, a fim de disponibilizar ferramentas para que o profissional desenvolva estratégias de coping resolutivas em seu dia a dia, minimizando o efeito do estresse no seu estado de saúde e no seu trabalho.

  13. O conceito de saúde The health's concept

    Directory of Open Access Journals (Sweden)

    Marco Segre

    1997-10-01

    Full Text Available Questiona-se a atual definição de saúde da Organização Mundial da Saúde: "situação de perfeito bem-estar físico, mental e social" da pessoa, considerada ultrapassada, primeiramente, por visar a uma perfeição inatingível, atentando-se as próprias características da personalidade. Menciona-se como principal sustentação dessa idéia, a renúncia necessária a parte da liberdade pulsional do homem, em troca da menor insegurança propiciada pelo convívio social. Discute-se a validade da distincão entre soma, psique e sociedade, esposando o conceito de homem "integrado", e registrando situações em que a interação entre os três aspectos citados é absolutamente cristalina. É revista a noção de qualidade de vida sob um vértice antipositivista. Essa priorização e proposta de resgate do subjetivismo, reverte a um questionamento da atual definição de saúde, toda ela embasada em avaliações externas, "objetivas", dessa situação.Objections to the present WHO (World Health Organization definition of HEALTH, as "the state of perfect physical, mental and social well-being", are expressed. It is considered to be anachronistic, first because it aims at perfection which is unaltainelle because of distict personality characteristics. As the main support for this idea, the necessary renunciation of part of man's drive to liberty in exchange for the lesser insecurity provided by social life (Freud, Castoriadis and Mc Dougall, is groted. The validity of distinguishing between "soma", "psyche" and "society" is questioned and the concept of the "integrated man", alluding to Pierre Marty and to Freud himself is adapted, and situations are recalled in which the interaction of the three aspects mentioned above is actually evident. Finally, the notion of the quality of life, in accordance with an antipositivistic taken from Bion, point of view, is discussed, and the concept that reality is that of each human being, is adapted. This

  14. Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy

    KAUST Repository

    Vlach, Martin

    2013-12-01

    The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.

  15. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  16. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  17. Contenha-se, se for capaz

    Directory of Open Access Journals (Sweden)

    Mirna Feitoza Pereira

    2008-11-01

    Full Text Available Em O Instinto da Linguagem, Steven Pinker discorre sobre sua célebre tese: a linguagem não é a mais prodigiosa invenção cultural humana. Ela é uma peça da constituição biológica do cérebro. A linguagem é uma habilidade complexa e especializada, que se desenvolve espontaneamente na criança, sem qualquer esforço consciente ou instrução formal, que se manifesta sem que se perceba sua lógica subjacente, que é qualitativamente a mesma em todo indiví­duo, e que difere de capacidades mais gerais de processamento de informações ou de comportamento inteligente. Para Pinker, a concepção de linguagem como um tipo de instinto transmite a idéia de que as pessoas sabem falar mais ou menos da mesma maneira que as aranhas sabem tecer suas teias. Ele apóia suas idéias em Darwin e Chomsky. Palavras-chave linguagem, gramática universal, evolução Abstract In Language Instinct, Steven Pinker argues about his famous thesis: language is not the most prodigious human cultural invention. It is a distinct piece of the biological constitution of the brain. Language is a complex, specialized skill, which develops spontaneously in the child, without conscious effort or formal instruction. It reveals itself without awareness of its underlying logic, which is qualitatively the same in every individual, and which is distinct from more general abilities of information processing of intelligent behavior. According to Pinker, the conception of language as a kind of instinct conveys the idea that people know how to talk in more or less the same way as spiders know how to spin webs. His thesis is founded in Darwin and Chomsky-s theories. Keywords language, universal grammar, evolution

  18. Ações de saúde na estratégia saúde da família no município goiano na perspectiva da integralidade

    Directory of Open Access Journals (Sweden)

    Fabiana Ribeiro Santana

    2013-06-01

    Full Text Available Objetivou-se com este estudo analisar as ações de saúde desenvolvidas por equipes de saúde da família em um município do sudeste goiano à luz da integralidade. Trata-se de pesquisa exploratória descritiva de abordagem qualitativa. A coleta de dados foi realizada por meio de entrevistas e, após uma análise de conteúdo, elegeram-se três categorias temáticas: Ações dos trabalhadores e articulação entre elas; A ESF não funciona como Estratégia Saúde da Família;Atualização das equipes de saúde da família. Os resultados demonstram a fragmentação das ações e desarticulação entre os trabalhadores, o que dificulta a integralidade. Concluiu-se, assim, que existe uma necessidade de investimentos na educação permanente em saúde, no fortalecimento do controle social, na avaliação participativa no SUS e no aprimoramento de tecnologias de gestão e cuidado.

  19. Proceso de internacionalización de las empresas Compañía Licorera de Nicaragua, S.A. y Kraft Foods Nicaragua, S.A

    Directory of Open Access Journals (Sweden)

    Aurora Margarita Saravia

    2006-08-01

    Full Text Available AUNQUE NICARAGUA ES UN PAÍS SUBDESARROLLADO Y POBRE, fundamenta sus expectativas de crecimiento y desarrollo en la exportación, especialmente desde la firma de diferentes Tratados de Libre Comercio. Sin embargo, son pocas las empresas nacionales que han logrado competir con éxito en los mercados internacionales. Entre ellas, se encuentran la Compañía Licorera de Nicaragua, S.A. y Kraft Foods de Nicaragua, S.A. El éxito del proceso de internacionalización depende de muchos factores, incluyendo la decisión de aventurarse en el extranjero. El punto clave está en aprovechar las ventajas competitivas de cada empresa y enfocarlas para obtener productos y servicios de calidad que son los pilares del éxito. El éxito internacional de estas tres empresas se analiza en este trabajo para dar a conocer su experiencia

  20. Design of SC walls and slabs for impulsive loading

    Energy Technology Data Exchange (ETDEWEB)

    Varma, Amit H. [Purdue Univ., West Lafayette, IN (United States)

    2015-11-11

    Reinforced concrete (RC) structures have historically been the preferred choice for blast resistant structures because of their mass and the ductility provided by steel reinforcement. Steel-plate composite (SC) walls are a viable alternative to RC for protecting the infrastructure against explosive threats. SC structures consist of two steel faceplates with a plain concrete core between them. The steel faceplates are anchored to the concrete using stud anchors and connected to each other using tie bars. SC structures provide mass from the concrete infill and ductility from the continuous external steel faceplates. This dissertation presents findings and recommendations from experimental and analytical investigations of the performance of SC walls subjected to far-field blast loads.

  1. The data acquisition system (DAS) for the improved CERN SC

    CERN Document Server

    Beger, H; Fiebig, A; Schroot, H

    1975-01-01

    A digital data acquisition system (DAS) based on a minicomputer is described which registers the failure sequences in various equipment areas of the CERN synchrocyclotron (henceforward referred to as the SC). The avalanches of failure signals which occur from time to time are tapped from the alarm/security systems, time-resolved to 10 msec and recorded on a printer in order to aid SC failure diagnosis. The mechanisms of the DAS and its relation to the SC equipment are explained in some detail. All programs were constructed at assembler language level for speed and for ease of on-line program maintenance. The alarm sequences recorded have been of considerable help during the running in of the new radiofrequency system. Now that the new SC is operational, the DAS furnishes useful data from several equipment areas to the operators and engineers.

  2. 75 FR 71734 - Outer Continental Shelf (OCS), Scientific Committee (SC)

    Science.gov (United States)

    2010-11-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf (OCS), Scientific Committee (SC) AGENCY: Bureau of Ocean Energy Management, Regulation and Enforcement (BOEMRE),...

  3. Atentando para as singularidades humanas na atenção à saúde por meio do diálogo e acolhimento

    OpenAIRE

    Freitas Medeiros, Hilda Maria; Centro Universitário Franciscano; Pereira, Adriana Dall’ Asta; Centro Universitário Franciscano; Ferreira, Carla Lizandra de Lima; Centro Universitário Franciscano; Marchiori, Mara Regina Caino; Centro Universitário Franciscano; Souza, Martha H. Teixeira de; Centro Universitário Franciscano

    2010-01-01

    Objetivou-se compreender como os trabalhadores de saúde se posicionam frente ao seu principal objeto de trabalho – o usuário – sujeito e autor da sua história de vida. Pesquisa qualitativo-exploratória. Participaram 11 profissionais de enfermagem em Unidade Básica de Saúde, por meio de um instrumento semi-estruturado nos meses de março e abril de 2008. As falas resultaram em dois temas convergentes: Atentando para as singularidades humanas na atenção à saúde; Diálogo e acolhimento como possib...

  4. Percepção da condição de saúde entre mulheres

    Directory of Open Access Journals (Sweden)

    Marli V. Mamede

    1993-06-01

    Full Text Available Trata-se de uma pesquisa qualitativa, que objetivou verificar como um grupo de mulheres de baixa renda identificava sua condição de saúde. Foram entrevistadas 42 mulheres individualmente e a análise feita através do conteúdo de suas falas. Foi possível identificar que o conceito de saúde para esse grupo de mulheres está ligado à atividade física, ao sentido da vida, como também à ausência de doença. A tristeza, dor, desânimo, desconforto e medo de dependência foram os principais motivos alegados pelas mulheres que se percebiam como doentes. Discute-se a importância destes achados na prestação de assistência orientada para a saúde.

  5. Magnetic properties of the Sc-H system

    Energy Technology Data Exchange (ETDEWEB)

    Volkenshtein, N.V.; Galoshina, E.V. (AN SSSR, Sverdlovsk. Ural' skij Nauchnyj Tsentr); Kost, M.E. (AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii); Shubina, T.S. (Ural' skij Gosudarstvennyj Univ., Sverdlovsk (USSR))

    1983-05-01

    The magnetic susceptibility in the ..cap alpha..-phase region of the Sc-H system and in scandium hydrides ScH/sub 2/ is investigated. The temperature dependence of the susceptibility was measured from liquid-helium temperature to room temperature in a magnetic field of 10 kOe. The influence of hydrogenation and of band structure parameters (density of states at the Fermi level, spin-relaxation time, and Fermi energy) on the susceptibility is shown and discussed.

  6. Homogenization of alloys in the system Al-Mg-Sc

    Science.gov (United States)

    Drits, M. E.; Toropova, L. S.; Bykov, Yu. G.

    1983-07-01

    A reduction in homogenizing anneal temperature and a reduction in soaking time leads to an increase in yield point for alloys of the system Al-Mg-Sc. The optimum homogenizing schedule for alloys of this system is heating to 400°C and soaking for up to 10 h. This homogenizing schedule provides an alloy structure of fine coherent ScAl3-phase precipitates and dissolution of excess β-phase precipitates.

  7. O emprego de auxiliares de saúde em áreas de desenvolvimento: alguns conceitos

    Directory of Open Access Journals (Sweden)

    Nilton Tornero

    1978-11-01

    Full Text Available In this paper the author discusses the real meaning of health auxiliary according to World Health Organization criteria. Next he discusses_ the relationship between health auxiliary and primary sanitary aid models, trying to show how the right comprehension of some elements of theses models will be of the highest importance to the definition of the auxiliary's functions. Among such elements he calls attention to the relationships between health services and other services offered to the community by other organizations: the choice of the workable area as pre-requisites to the training of personnel; relationships among the primary health aid and the services of campaign, the preventive and curative medicine and general guidelines for the pacification, management and training of health manpower.No presente trabalho procura-se conceituar o que se entende por auxiliar de saúde segundo critérios da Organização Mundial de Saúde. Discute-se, a seguir, as relações existentes entre o auxiliar de saúde e os modelos de assistência sanitária primária, procurando mostrar como a compreensão correta de alguns elementos destes modelos serão de primordial importância na definição das funções dos auxiliares de saúde. Dentre tais elementos, aborda-se: as relações entre o setor saúde e outros setores da sociedade; a escolha da área programática de atuação como pré-requisito para a preparação do pessoal; relações entre assistência primária e os serviços de campanhas, a medicina preventiva e curativa, e as diretrizes gerais para a planificação, gestão e formação dos recursos humanos.

  8. Uma prática educativa de sensibilização quanto à exposição a radiação ionizante com profissionais de saúde Una práctica educativa de sensibización a la exposición a radiación ionizante con profesionales de salud An educative practice of sensitization to ionizing radiation exposition with health professionals

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Flôr

    2006-06-01

    Full Text Available Este estudo apresenta uma prática assistencial de enfermagem que teve como objetivo a sensibilização dos profissionais de saúde na unidade de terapia neonatal quanto à exposição à radiação ionizante, visando à otimização da proteção radiológica. O Modelo Operário Italiano (MOI foi o referencial teórico e metodológico norteador dessa prática, desenvolvida em um hospital público de Florianópolis-SC com 12 participantes. Os resultados demonstraram que os profissionais de saúde expõem-se às radiações ionizantes, principalmente por desconhecerem as recomendações previstas na legislação.Se trata de una práctica asistencial de enfermería que tuvo por objetivo la sensibilización de los profesionales de salud de la unidad de terapia intensiva neonatal en lo referente a la exposición a radiación ionizante, procurando la optimización de la protección radiológica. El Modelo Obreiro Italiano (MOI fue el referente teórico y metodológico orientador de dicha práctica, realizada con 12 participantes en un hospital público de Florianópolis/SC. Los resultados demuestran que los profesionales de salud se exponen a radiaciones ionizantes principalmente por desconocer las recomendaciones previstas en la legislación.This study present a nursing care practice whose objective is to sensitize health professionals of neonatal intensive care unit about the risk of exposition to ionizing radiation, aiming to optimize the radiological protection. The Operative Italian Model (OIM was the main theoretical and methodological reference which guided this practice, carried out with twelve participants in a public hospital in Florianópolis-SC, Brazil. The results demonstrated that health professionals are exposed to ionizing radiation, especially for not being aware of the recommendations already included in the legislation.

  9. Utilização de serviços de saúde por idosos vivendo na comunidade

    Directory of Open Access Journals (Sweden)

    Calíope Pilger

    Full Text Available O objetivo deste estudo foi analisar o padrão de utilização dos serviços de saúde por idosos cadastrados nos serviços públicos de Guarapuava-PR. Realizou-se inquérito domiciliar com 359 idosos selecionados por meio de amostragem estratificada proporcional. As entrevistas foram aplicadas entre janeiro e abril de 2010 no domicílio do idoso, utilizando-se as seções I e III do questionário BOAS (Brazil Old Age Schedule. Para apreciação aplicou-se análise de associação por meio do teste χ². Os serviços de saúde mais utilizados pelos idosos nos últimos três meses foram à consulta médica (49,6% e os exames clínicos (38,4%. As mulheres utilizaram mais os serviços de saúde (p=0,0240; 55,6% dos idosos relataram não procurar os serviços dentários. Conclui-se que a população idosa é grande usuária dos serviços de saúde e a rede pública do município necessita se organizar frente a uma demanda crescente por procedimentos diagnósticos terapêuticos.

  10. Análise de riscos tecnológicos ambientais: perspectivas para o campo da saúde do trabalhador

    OpenAIRE

    Porto, Marcelo Firpo de Souza; Freitas,Carlos Machado de

    1997-01-01

    O objetivo deste artigo é trazer para o âmbito da saúde pública, particularmente para o campo da Saúde do Trabalhador, questões teóricas e desafios colocados pelos denominados riscos tecnológicos ambientais, os quais se relacionam e ultrapassam o universo dos ambientes de trabalho. Partindo-se dos riscos químicos industriais, demonstra-se a vulnerabilidade das sociedades contemporâneas face aos mesmos e seu agravamento nos países de economia periférica. Em seguida, apresenta-se o escopo das a...

  11. Promoção da saúde e as escolas: como avançar

    Directory of Open Access Journals (Sweden)

    Daniela Gardano Bucharles Mont'Alverne

    2014-05-01

    Full Text Available Nos campos de ação da promoção da saúde, descritos pela Carta de Ottawa em 1986, destaca-se a criação de ambientes favoráveis à saúde(1. Nesta linha de pensamento várias estratégias têm sido utilizadas para se implantar políticas de promoção da saúde, dentre elas, a Escola Promotora da Saúde.No ano de 1995, a Organização Pan-Americana da Saúde, Oficina Regional da Organização Mundial da Saúde (Opas/OMS lançou oficialmente a Iniciativa Regional de Escolas Promotoras de Saúde. Desde então, todos os países da América Latina e do Caribe têm fortalecido suas ações de promoção da saúde na escola revendo as atividades desenvolvidas no campo da saúde escolar(2. Para a escola ser denominada Escola Promotora da Saúde ela deve ter uma visão integral do ser humano, em especial as crianças e os adolescentes, dentro do seu ambiente familiar, comunitário e social. Ela deve desenvolver um ambiente saudável buscando relações construtivas e harmônicas, sendo capaz desta forma de despertar nos participantes aptidões e atitudes para a saúde, promovendo a autonomia, a criatividade e a participação dos alunos, bem como de toda a comunidade escolar(3. Em nenhum outro momento histórico, falou-se tanto em saúde e promoção da saúde como no atual, ou seja, verifica-se a atribuição de promover saúde no ambiente escolar como elemento transformador da realidade. A escola tem papel político fundamental neste contexto, pois é ali que se constrói, destrói ou se perpetua uma ideologia através da transmissão de valores e crenças, além de ser este, um ambiente propício para o desenvolvimento de ações educativas em saúde. É a infância o momento decisivo para a construção e solidificação dos hábitos e atitudes e, em vista disso, a importância do papel da escola como o ambiente potencializador para o desenvolvimento de um trabalho direcionado, sistematizado e permanente. “Através da estratégia de Escola

  12. Theoretical studies of the low-lying states of ScO, ScS, VO, and VS

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Langhoff, Stephen R.

    1986-01-01

    Bonding in the low-lying states of ScO, ScS, VO, and VS is theoretically studied. Excellent agreement is obtained with experimental spectroscopic constants for the low-lying states of ScO and VO. The results for VS and ScS show that the bonding in the oxides and sulfides is similar, but that the smaller electronegativity in S leads to a smaller ionic component in the bonding. The computed D0 of the sulfides are about 86 percent of the corresponding oxides, and the low-lying excited states are lower in the sulfides than in the corresponding oxides. The CPF method is shown to be an accurate and cost-effective method for obtaining reliable spectroscopic constants for these systems.

  13. Effect of homogenizing heatings on the properties of Al-Sc and Al-Mg-Sc alloy systems

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Anastas' eva, G.K.; Nagornichnykh, G.L.

    Effect of annealing on hardness and electric conductivity of cast alloys of Al-Mg-Sc and Al-Sc systems has been studied. Magnesium content in studied alloys was changed in the range of 0-6.5%, scandium content was chosen to be constant -0.4%. It has been revealed that homogenizing heatings of Al-Sc alloys lead to a decomposition of abnormally saturated solid solution during crystallization at temperatures >250 deg C. Maximum hardness values are achieved after annealing at 300 deg C during 1h. Homogenizing of Al-Mg--- Sc alloys at 350 deg C during 24h leads to practically full solubility of a nonequilibrium ..beta..-phase (Mg/sub 2/Al/sub 3/) and also to a decomposition of a solid solution abnormally saturated with scandium. Maximum values of hardness are achieved after annealing at 35O deg C during 0.5-1h.

  14. Educação para a saúde a grupo de obesos

    Directory of Open Access Journals (Sweden)

    Glaci de Oliveira Pinto Vargas

    1983-03-01

    Full Text Available Este trabalho foi realizado por enfermeiras que atuam a nível ambulatorial, num Programa de Adulto, no Serviço de Saúde Pública, de um hospital geral de Porto Alegre, RS. É uma contribuição original de uma pesquisa descritivo analítica, com grupos de clientes obesos, atendidos através de cursos de educação para a saúde. Pretende-se avaliar quatro aspectos sem ordem de prioridade: a interesse da clientela pela educação da saúde, em grupo; b impressão, em relação aso conteúdos desenvolvidos; c redução do peso; d mudança de algum hábito de vida.

  15. O fazer da enfermeira no sistema local de saúde: individual ou coletivo?

    Directory of Open Access Journals (Sweden)

    Marluce Maria Araújo Assis

    1996-09-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca do fazer da enfermeira no Sistema Local de Saúde (SILOS, permitindo compreender (ainda que provisoriamente se o espaço que vem sendo ocupado pela mesma, na "porta de entrada" dos serviços de saúde, tem possibilitado uma construção ideológica de sua ação social, enquanto sujeito coletivo ou individual. Assim, procuramos nos pautar teoricamente no pensamento de Testa (1995 e apontamos o SILOS, enquanto um espaço social de transformação do Sistema de Saúde. Discutimos também, as relações vivenciadas no cotidiano da organização institucional, tentando entender o processo de produção de sujeitos sociais, focalizando a enfermeira nesta construção.

  16. Psicologia da saúde : articulações entre vida e política

    OpenAIRE

    Bernardes,Anita Guazzelli

    2016-01-01

    O objetivo deste artigo é pensar a Psicologia da Saúde a partir de articulações entre vida e política. O foco da discussão está em um exercício que permita considerar vida e política para problematizar a relação entre Psicologia e Saúde, efetuando uma certa torção no pensamento. O campo de análise ampara-se na Psicologia Social, mais especificamente no pós-estruturalismo, em um diálogo com a Filosofia. Pensar com a vida na Psicologia da Saúde é considerar uma orientação, uma figura de pensame...

  17. Bacharel em Saúde Coletiva: um Elo que faltava na Rede

    Directory of Open Access Journals (Sweden)

    Antônio José Costa CARDOSO

    2013-11-01

    Full Text Available O desafio deste último texto é, sem outras referências, fazer “emergir” um (incerto Discurso do Sujeito Coletivo – aqui referido ao conjunto de autores que assina esse número especial da Tempus Actas em Saúde Coletiva, a partir de um diálogo que se pretende articulador das ideias dos diversos autores que trataram da criação dos bacharelados, mercado de trabalho e carreira, identidade e regulamentação da profissão, campos de prática e estágio em Saúde Coletiva, tomando o texto-base Graduação em Saúde Coletiva: conquistas e passos para além do sanitarismo, de Jairnilson Silva Paim e Isabela Cardoso Pinto, como ponto de partida.

  18. Antioxidant Activity of Essential Oil Extracted by SC-CO2 from Seeds of Trachyspermum ammi

    Directory of Open Access Journals (Sweden)

    Aarti Singh

    2017-07-01

    Full Text Available Bcakground: Extracts obtained from natural sources such as plants are of immense importance for humans. Methods: Therefore this study was conducted to obtain essential oil from the seeds of T. ammi by conventional and non-conventional methods. Hydrodistillation (HD, Solvent Extraction (SE, Ultrasonication (US, and Supercritical Carbon-dioxide (SC-CO2 extraction techniques were used to extract essential oil from the powdered seeds of T. ammi. A quality control method for each extracted oil was developed using HPTLC, FTIR, and GC-MS. The optimization process was carried out using fractional factorial design (FFD under which three parameters were considered: pressure (150, 175, and 300 bar, temperature (25, 30, and 40 °C, and CO2 flow rate (5, 10, 15 g/min. Results: The yield of essential oil obtained from the HD, SE, US, and SC-CO2 methods were 1.20%, 1.82%, 2.30%, and 2.64% v/w, respectively. Antioxidant activity was determined by the DPPH and superoxide scavenging methods and the IC50 (Inhibition Concentration values of the T. ammi oil sample were found to be 36.41 and 20.55 µg mL−1, respectively. Conclusion: The present paper reported that different extraction methods lead to different yields of essential oils and the choice of a suitable method is extremely important to obtain more preferred compounds. The yield was higher in the SC-CO2 method and it is a sustainable and green extraction technique. Many important constituents were detected in analytical techniques. Antioxidant activities carried out showed that essential oil extracted from T. ammi seeds possess significant antioxidant activity.

  19. Compensation of native donor doping in ScN: Carrier concentration control and p-type ScN

    Science.gov (United States)

    Saha, Bivas; Garbrecht, Magnus; Perez-Taborda, Jaime A.; Fawey, Mohammed H.; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Hultman, Lars; Sands, Timothy D.

    2017-06-01

    Scandium nitride (ScN) is an emerging indirect bandgap rocksalt semiconductor that has attracted significant attention in recent years for its potential applications in thermoelectric energy conversion devices, as a semiconducting component in epitaxial metal/semiconductor superlattices and as a substrate material for high quality GaN growth. Due to the presence of oxygen impurities and native defects such as nitrogen vacancies, sputter-deposited ScN thin-films are highly degenerate n-type semiconductors with carrier concentrations in the (1-6) × 1020 cm-3 range. In this letter, we show that magnesium nitride (MgxNy) acts as an efficient hole dopant in ScN and reduces the n-type carrier concentration, turning ScN into a p-type semiconductor at high doping levels. Employing a combination of high-resolution X-ray diffraction, transmission electron microscopy, and room temperature optical and temperature dependent electrical measurements, we demonstrate that p-type Sc1-xMgxN thin-film alloys (a) are substitutional solid solutions without MgxNy precipitation, phase segregation, or secondary phase formation within the studied compositional region, (b) exhibit a maximum hole-concentration of 2.2 × 1020 cm-3 and a hole mobility of 21 cm2/Vs, (c) do not show any defect states inside the direct gap of ScN, thus retaining their basic electronic structure, and (d) exhibit alloy scattering dominating hole conduction at high temperatures. These results demonstrate MgxNy doped p-type ScN and compare well with our previous reports on p-type ScN with manganese nitride (MnxNy) doping.

  20. A Generalized Eigensolver based on Smoothed Aggregation (GES-SA) for Initializing Smoothed Aggregation Multigrid (SA)

    Energy Technology Data Exchange (ETDEWEB)

    Brezina, M; Manteuffel, T; McCormick, S; Ruge, J; Sanders, G; Vassilevski, P S

    2007-05-31

    Consider the linear system Ax = b, where A is a large, sparse, real, symmetric, and positive definite matrix and b is a known vector. Solving this system for unknown vector x using a smoothed aggregation multigrid (SA) algorithm requires a characterization of the algebraically smooth error, meaning error that is poorly attenuated by the algorithm's relaxation process. For relaxation processes that are typically used in practice, algebraically smooth error corresponds to the near-nullspace of A. Therefore, having a good approximation to a minimal eigenvector is useful to characterize the algebraically smooth error when forming a linear SA solver. This paper discusses the details of a generalized eigensolver based on smoothed aggregation (GES-SA) that is designed to produce an approximation to a minimal eigenvector of A. GES-SA might be very useful as a standalone eigensolver for applications that desire an approximate minimal eigenvector, but the primary aim here is for GES-SA to produce an initial algebraically smooth component that may be used to either create a black-box SA solver or initiate the adaptive SA ({alpha}SA) process.

  1. O contrato organizativo da ação pública da saúde (COAP: as regiões de saúde no Rio Grande do Sul sob o eixo dos recursos financeiros

    Directory of Open Access Journals (Sweden)

    Luís Fernando Kranz

    2015-12-01

    Full Text Available O financiamento e a regionalização são pontos críticos para a implantação dos Contratos Organizativos da Ação Pública da Saúde (COAP’s. Para operacionalizá-los, os 496 municípios do RS foram divididos em 30 Regiões de Saúde (RS. Objetiva-se quantificar o volume total de Recursos Transferidos para a Saúde (RTS e de Recursos Próprios Aplicados em Saúde (RPAS e estimar o gasto público em saúde por habitante segundo RS. Os dados municipais do SIOPS e do IBGE foram agregados por RS para o período 2008-2011. Os RTS atingiram aproximadamente R$ 1,6 bilhão/ano (86,4% transferidos da União. Os RPAS somaram R$ 2,1 bilhões/ano (57,8% do total aplicado em saúde. Porto Alegre foi a RS que mais aplicou por habitante/ano (R$ 427,36 e Alegrete/Uruguaiana a que menos aplicou (R$ 226,33. As RS apresentam características financeiras bastante distintas quando comparadas entre si e variações expressivas no gasto público em saúde per capita.

  2. PLANTAS HEPATOTÓXICAS PARA BOVINOS NO MUNICÍPIO DE ITAPIRANGA – SC

    Directory of Open Access Journals (Sweden)

    Caroline Hauser

    2012-12-01

    Full Text Available Because of suspected poisoning by phytotoxins in cattle of Itapiranga-SC region, it was observed the need of performing a detailed study on the prevalence of hepatotoxic plants in that town. These plants, or parts of them, are usually present in pastures, preserved forages and grains with which the animals are fed, that makes more likely the accidental intake. When we performed a study in the region, it was noticed the presence of some plants classified as hepatotoxic which were described in the present paper in order to reduce the recurrence of severe organic lesions and thus breeding lost.Em decorrência das suspeitas de intoxicações dos bovinos da região de Itapiranga - SC por fitotoxinas, observou-se a necessidade de realizar um estudo detalhado sobre a predominância de plantas hepatotóxicas neste município. Tais plantas, ou parte delas, estão geralmente presentes nas pastagens, forrageiras conservadas, grãos com os quais os animais são nutridos, o que torna seu consumo acidental ainda mais provável. Realizando um estudo da região constatou se a presença de algumas plantas classificadas como tóxicas, as quais foram descritas no presente trabalho com o intuito de minimizar a recorrência de lesões orgânicas graves e assim, prejuízo nas criações.

  3. Mulheres encarceradas em São Paulo: saúde mental e religiosidade

    Directory of Open Access Journals (Sweden)

    Paulo Augusto Costivelli de Moraes

    2006-01-01

    Full Text Available OBJETIVO: A religião tem um importante papel na vida de indivíduos encarcerados. A saúde mental e a possibilidade de reabilitação parecem ser favorecidas através da religião. Entretanto poucos estudos no Brasil abordaram a saúde mental em população carcerária feminina e a relacionaram com a religiosidade. O objetivo deste estudo é verificar o perfil de saúde mental e a relação entre religião, religiosidade e saúde mental numa amostra de mulheres encarceradas em São Paulo. MÉTODOS: Foram entrevistadas 358 mulheres, detentas da Penitenciária Feminina da Capital (São Paulo-SP. Foi aplicado um questionário amplo que abrangeu dados sociodemográficos e culturais (incluindo a religiosidade, assim como itens sobre saúde mental e perfil criminal. A avaliação psicopatológica foi feita com o General Health Questionnaire (GHQ-12. Análises estatísticas comparando as variáveis com o GHQ-12 foram realizadas. Foi utilizada também a análise de regressão logística multivariada para respostas dicotômicas para as variáveis que possivelmente interagiram com a saúde mental. RESULTADOS: A idade média da amostra foi 30,7 anos ± 8,5. A prevalência de possível caso psiquiátrico foi 26,6%. CONCLUSÕES: Uma maior religiosidade pessoal associou-se a menor freqüência de possível transtorno mental. Não foram encontradas associações entre tipo de crime e saúde mental.

  4. SE-FIT

    Science.gov (United States)

    Chen, Yongkang; Weislogel, Mark; Schaeffer, Ben; Semerjian, Ben; Yang, Lihong; Zimmerli, Gregory

    2012-01-01

    The mathematical theory of capillary surfaces has developed steadily over the centuries, but it was not until the last few decades that new technologies have put a more urgent demand on a substantially more qualitative and quantitative understanding of phenomena relating to capillarity in general. So far, the new theory development successfully predicts the behavior of capillary surfaces for special cases. However, an efficient quantitative mathematical prediction of capillary phenomena related to the shape and stability of geometrically complex equilibrium capillary surfaces remains a significant challenge. As one of many numerical tools, the open-source Surface Evolver (SE) algorithm has played an important role over the last two decades. The current effort was undertaken to provide a front-end to enhance the accessibility of SE for the purposes of design and analysis. Like SE, the new code is open-source and will remain under development for the foreseeable future. The ultimate goal of the current Surface Evolver Fluid Interface Tool (SEFIT) development is to build a fully integrated front-end with a set of graphical user interface (GUI) elements. Such a front-end enables the access to functionalities that are developed along with the GUIs to deal with pre-processing, convergence computation operation, and post-processing. In other words, SE-FIT is not just a GUI front-end, but an integrated environment that can perform sophisticated computational tasks, e.g. importing industry standard file formats and employing parameter sweep functions, which are both lacking in SE, and require minimal interaction by the user. These functions are created using a mixture of Visual Basic and the SE script language. These form the foundation for a high-performance front-end that substantially simplifies use without sacrificing the proven capabilities of SE. The real power of SE-FIT lies in its automated pre-processing, pre-defined geometries, convergence computation operation

  5. A contribuição do Programa Saúde da Família (PSF) para o Sistema Público de Saúde do município de Araraquara

    OpenAIRE

    Aguiar, Cíntia Capelari [UNESP

    2008-01-01

    A partir da década de 80, a política de saúde brasileira passou por um processo de descentralização, proporcionando às esferas subnacionais, estados e municípios, autonomia e responsabilidades acerca da gestão e dos serviços prestados, antes exercidas pela esfera nacional. Na década seguinte, verificam-se a formulação e o surgimento do Sistema Único de Saúde (SUS) e, posteriormente, a proposta do Ministério da Saúde do Programa Saúde da Família (PSF), analisado nesta pesquisa. Certas idéias q...

  6. Organização tecnológica do trabalho em saúde bucal no SUS: uma arqueologia da política nacional de saúde bucal

    Directory of Open Access Journals (Sweden)

    Fabiana Schneider Pires

    2015-03-01

    Full Text Available Este artigo discute a organização tecnológica dos modelos de atenção à saúde bucal à luz da Política Nacional de Saúde Bucal - PNSB. O referencial teórico-metodológico para este estudo estruturou-se em um histórico das políticas de saúde bucal no Brasil, buscando apreender o saber operante que norteou a prática neste campo. A abordagem das políticas de saúde procedeu-se sob teoria de M. Foucault na obra Arqueologia do Saber. Utilizou-se de revisão de documentos normativos do SUS e de publicações do período de 2000 a 2012. Procurou-se desvelar, a partir da organização tecnológica (categoria de análise como tais políticas abordam as necessidades de saúde da população e quais ferramentas, instrumentos e tecnologias são oferecidas para o cuidado em saúde bucal. O SUS busca substituir modelos de organização do trabalho que transformem a prática de assistência odontológica (ineficaz, baixa cobertura, monopolista, baixa resolubilidade, mal distribuída geográfica e socialmente, por modelos voltados à promoção da saúde. O levantamento de artigos sobre a atual PNSB destacou nos serviços um modus operandi calcado na pragmática prática odontológica, plena de conflitos e contradições. Para que as diretrizes da PNSB transformem a prática em saúde bucal com novos arranjos tecnológicos no processo de trabalho, outras formas de vínculo e comprometimento devem ser almejadas. É necessário repensar a tecnologia do cuidado em saúde bucal como possibilidade da atenção com integralidade e de sua legitimação como um dos componentes da saúde em uma expressão ampliada: a da qualidade de vida.

  7. A segunda crítica social da Saúde de Ivan Illich

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2003-02-01

    Full Text Available Na Nêmesis da Medicina, Ivan Illich expôs os elementos essenciais da sua primeira crítica da saúde, afirmando que a ampla industrialização da saúde e medicalização da vida na sociedade moderna faz aparecer diversas formas de iatrogênese ou danos à saúde, como resultado da perda da capacidade de ação autônoma das pessoas perante a enfermidade, a dor e o envelhecimento. Na segunda crítica social da saúde, Illich trata do surgimento de uma nova iatrogênese social, a iatrogênese do corpo, que resulta de uma espécie de obsessão com a saúde corporal e com sua produção através de atividades físicas, dietas etc. em aparente condição de autonomia. Trata-se de um consumismo do corpo saudável, que responde menos à ação dos médicos e mais às informações difundidas pelos meios de comunicação e pelos agentes terapêuticos não-oficiais.

  8. As necessidades de saúde e vulnerabilidades de pessoas com tuberculose segundo as dimensões acesso, vínculo e adesão

    Directory of Open Access Journals (Sweden)

    Paula Hino

    2011-12-01

    Full Text Available Os objetivos foram conhecer a vivência das pessoas com tuberculose e identificar necessidades de saúde e vulnerabilidade frente ao adoecimento, no que diz respeito ao acesso ao tratamento, ao vínculo com a equipe de saúde e à adesão ao tratamento. Trata-se de um estudo qualitativo, desenvolvido em unidades de saúde da família. Entrevistaram-se pessoas em tratamento, utilizando-se o critério de saturação das informações. Na análise dos depoimentos utilizou-se o software Alceste. O diagnóstico tardio reflete a falta de conhecimento sobre a doença e o despreparo de alguns profissionais. O apoio constituiu um determinante no seguimento das pessoas que, sentindo-se acolhidas, foram incentivadas a seguir o esquema terapêutico. As necessidades de saúde relacionaram-se às boas condições de vida, como direito à alimentação, trabalho, moradia, educação, lazer e adoção de hábitos de vida saudáveis. Ressalta-se a valorização da vivência das pessoas em tratamento para apoiar a prática assistencial dos profissionais focada nas necessidades de saúde e vulnerabilidades da população.

  9. Desenvolvimento, complexo industrial da saúde e política industrial

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2006-08-01

    Full Text Available O artigo situa a questão da saúde no contexto do desenvolvimento nacional e da política industrial. Tomou-se a idéia de corte estruturalista, marxista e schumpeteriano, onde a indústria e as inovações constituem os elementos determinantes do dinamismo das economias capitalistas e de sua posição relativa na economia mundial. Todos os países que se desenvolveram e passaram a competir em melhores condições com os países avançados associaram uma indústria forte com uma base endógena de conhecimento, de aprendizado e de inovação. Todavia, na área da saúde essa visão é problemática, uma vez que os interesses empresariais se movem pela lógica econômica do lucro e não para o atendimento das necessidades da saúde. A noção de complexo industrial da saúde constitui uma tentativa e fornecer um referencial teórico que permita articular duas lógicas distintas: a sanitária e a do desenvolvimento econômico. O trabalho procurou mostrar, com base em dados de comércio exterior, como a desconsideração da lógica do desenvolvimento nas políticas de saúde levou a uma situação de vulnerabilidade econômica do setor que pode limitar os objetivos de universalidade, eqüidade e integralidade. Nesse contexto, propõe-se uma ruptura cognitiva e política com as visões antagônicas que colocam, de um lado, as necessidades da saúde e, de outro, da indústria. Um país que pretende chegar a uma condição de desenvolvimento e de independência requer, ao mesmo tempo, indústrias fortes e inovadoras, e um sistema de saúde inclusivo e universal.

  10. O desafio de operacionalizar as ações de vigilância sanitária no âmbito da promoção da saúde e no locus saúde da família

    OpenAIRE

    Gisele O'Dwyer; Maria de Fátima Lobato Tavares; Marismary Horst De Seta

    2007-01-01

    Este artigo propõe uma articulação dos campos de ação da Estratégia Saúde da Família e Vigilância Sanitária. Reflete sobre como conceitos e diretrizes essenciais para o Sistema Único de Saúde (SUS), como integralidade, controle social e promoção da saúde, podem incorporar-se na prática dos profissionais de saúde. A Saúde da Família constitui uma estratégia de enfrentamento de uma nova prática, é um dos campos de realização da integralidade e da promoção da saúde e favorece o controle social. ...

  11. Pesquisa de clima organizacional em empresas de desenvolvimento de software de Blumenau – SC

    Directory of Open Access Journals (Sweden)

    Simone Cristina Aléssio

    2010-08-01

    Full Text Available O objetivo deste trabalho é estudar a influência das variáveis que compõem o Clima Organizacional em ambientes de desenvolvimento de software do município de Blumenau, SC, com o propósito de analisar as relações existentes nestes ambientes de trabalho. Parte-se do pressuposto de que as pessoas são as figuras mais importantes em uma organização, e o modo como se sente é fundamental para o equilíbrio de todos. Por isso, enfoca-se bastante a questão da cultura organizacional, que influencia diretamente o comportamento individual e coletivo dos colaboradores, sendo determinante no Clima Organizacional. Para isso, foi realizada uma pesquisa, levando-se em consideração fatores internos e externos que podem ter influência sobre o Clima Organizacional. Utilizou-se um questionário com 55 perguntas, retiradas do modelo de Carlos Alberto Ferreira Bispo (2006, aplicado em 12 empresas, das 20 selecionadas.

  12. Sentidos da Saúde numa Perspectiva de Gênero: um Estudo com Homens da Cidade de Natal/RN

    Directory of Open Access Journals (Sweden)

    Jáder Ferreira Leite

    Full Text Available Resumo O presente trabalho objetivou investigar os sentidos atribuídos à saúde por homens da cidade de Natal/RN, em dois contextos: uma Unidade Básica de Saúde (UBS de um bairro de classe média e uma Unidade de Saúde da Família (USF de um bairro popular. Metodologicamente, realizamos entrevistas semiestruturadas junto a 24 homens, sendo 12 de cada serviço, com faixa etária de 25 a 59 anos, abordados nas unidades de saúde de cada bairro. A análise dos dados deu-se a partir da perspectiva de Spink (2000, e Spink e Frezza (2000 e Spink e Medrado (2000, no tocante às práticas discursivas e os estudos de gênero. Os dados encontrados acompanham a tendência de estudos já realizados no campo, especialmente ao identificar como as posições sociais de gênero conformam os sentidos que os homens investigados construíram em relação à saúde, atribuindo a esta a importância de proporcionar as condições de exercício de uma masculinidade voltada para o provimento do lar e da família. Houve diferença acerca dos sentidos sobre a resolução de problemas de saúde no tocante aos serviços investigados: a maioria do grupo da UBS apontou para pouca resolutividade, gerando sentidos de ineficácia do serviço. Na USF, os sentidos apresentaram uma positividade em relação ao serviço, que julgamos ter relação com a natureza da Estratégia de Saúde da Família. Finalmente, identificamos como a busca pelos serviços de saúde no nível de atenção básica é limitada, fato que segue os estudos de que os homens buscam os serviços de saúde quando esta se encontra demandando atenção especializada. Concluímos que a PNAISH pode ter uma importante contribuição na medida em que se efetive como política de saúde, sensibilizando a toda a rede de atores e serviços envolvidos na busca por novos sentidos e práticas em torno da relação gênero-saúde.

  13. Mulher, saúde e trabalho no Brasil: desafios para um novo agir

    Directory of Open Access Journals (Sweden)

    Aquino Estela Maria L. de

    1995-01-01

    Full Text Available Apesar do marcante aumento da participação das mulheres no mercado de trabalho, no Brasil, persiste um desconhecimento generalizado sobre os efeitos do trabalho sobre sua saúde. Neste artigo, em revisão da literatura, pretendeu-se identificar questões teóricas e metodológicas na análise das relações entre trabalho e saúde de mulheres a partir de uma perspectiva de gênero. Assinala-se as características da inserção profissional feminina, decorrentes de seu papel na reprodução social, que resultam na necessidade de estratégias variadas de conciliação entre as atividades profissionais e as domésticas. Discute-se as implicações da inserção social das mulheres trabalhadoras para a sua saúde e a necessidade de repensar criticamente teorias e conceitos, estratégias metodológicas, fontes de informação, para dar conta da complexidade e das especificidades das condições de trabalho e de existência das mulheres. A recente atuação das mulheres sindicalistas na defesa do direito ao corpo, à saúde e à feminilidade no ambiente de trabalho não pode prescindir de um novo olhar, que se produz de modo ainda incipiente no espaço acadêmico, por inspiração do movimento social de mulheres. Nesse sentido, apontam-se os desafios para a produção do conhecimento sobre o tema, que desvendem as singularidades da realidade nacional, caracterizada pelo desemprego, o trabalho informal, os baixos salários, a fragilidade das organizações sindicais e sociais, além de relações tradicionais familiares e matrimoniais.

  14. Final Technical Report for Award SC0008613

    Energy Technology Data Exchange (ETDEWEB)

    Knopf, Daniel A. [Stony Brook Univ., NY (United States)

    2017-04-05

    Discovering how aerosol particles, present in the atmosphere in sizes of a few nanometers to hundred micrometers, initiate ice crystal formation represents a great challenge. Atmospheric ice nucleation is important because ice crystals alter the radiative properties of clouds and thus climate, and impact precipitation and thus the hydrological cycle. The difficulty in predicting atmospheric ice formation is attributable at least in part, to the diversity of ice nucleation pathways, the physical and chemical complexity of the ice nucleating particles (INPs), and the relatively small numbers of INPs (compared with all other aerosol particles), sometimes less than one in 100000. These factors in turn makes constraining ice nucleation parameterizations for modeling applications challenging. The majority of airborne particles are known to be organic in nature or contain organic biogenic material. The presence of organic material adds to the complexity of the particles and therefore the predictability of ice nucleation events since the organic species can display different phase states, e.g. liquid or solid, in response to temperature and humidity. The award DE-SC0008613 to PI Prof. Daniel Knopf at Stony Brook University, “Relating the Chemical and Physical Properties of Aerosols to the Water Uptake and Ice Nucleation Potential of Particles Collected During the Carbonaceous Aerosols and Radiative Effects Study (CARES)”, allowed examination of laboratory generated aerosol particles and field-collected particles for their propensity to nucleate ice under typical tropospheric conditions and relate ice nucleation to the physicochemical properties of the particles including their morphology and chemical composition. This in turn allowed for development of ice nucleation parameterizations for implementation in cloud models. The award resulted in 10 peer-reviewed publications and more than 20 seminar and conference presentations. We demonstrated that the rate of immersion

  15. Medialogy (English Information Brochure on the education M.Sc.,Medialogy, 3rd to 10th semester (B.Sc. & M.Sc) - For graduates from higher study programmes such as Multimedia Design and IT Graduates)

    DEFF Research Database (Denmark)

    Nordahl, Rolf

    2005-01-01

    An information brochure, 24 pages, in English which describes the education M.Sc., Medialogy, offered by Aalborg University in Copenhagen and Esbjerg. The brochure describes the 3rd to 10th semester (B.Sc. and M.Sc. degree) of the education. The information is primarily directed toward potential...

  16. Curso “Participação popular, movimentos sociais e direito à saúde”: uma experiência de educação popular em Saúde na Bahia a partir do MobilizaSUS

    Directory of Open Access Journals (Sweden)

    Luciana Chaves

    2014-12-01

    Full Text Available Os Movimentos Sociais de base popular têm tido importante papel na luta pelo direito à saúde e consolidação do SUS. As práticas educativas vivenciadas por estes movimentos referenciados na educação popular em saúde contribuem para o fortalecimento do controle social e da participação popular na saúde. O curso foi construído de forma participativa, entre movimentos sociais, SESAB e ISC/UFBA, tendo como objetivo central fortalecer a atuação dos movimentos sociais na arena política da saúde na Bahia. Realizou-se duas turmas de cinco módulos cada uma, totalizando 60 participantes. As atividades orientaram-se pelos pressupostos da educação popular: diálogo, participação, valorização da experiência, autonomia e reflexão crítica. Possibilitou pensar e construir estratégias para incorporação de demandas dos coletivos na agenda do Estado, constituindo-se enquanto espaço potente de debate sobre a realidade e necessidades de saúde dos povos.

  17. Atlas mundial da saúde

    OpenAIRE

    Barrozo, Ligia Vizeu

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans. O Atlas mondial de la santé faz parte da série Collection Atlas/M...

  18. É como uma família: significados atribuídos a grupos de educação em saúde sobre diabetes por profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Lucas Pereira de Melo

    Full Text Available Resumo O artigo analisa os significados que os profissionais de saúde atribuem aos grupos de educação em saúde para pessoas com diabetes tipo 2. Este estudo etnográfico foi desenvolvido com cinco profissionais de uma Equipe de Saúde da Família Ampliada que atuavam em cinco grupos de educação em saúde sobre diabetes. Para coligir as informações, utilizaram-se observação participante e entrevistas semiestruturadas. Os dados foram analisados por meio da técnica de codificação temática. Emergiram três categorias: (1 é uma forma de educá-los: os grupos como espaço educativo e de acompanhamento clínico; (2 eles sabem que eu vou estar lá: os grupos como recurso para acessar o sistema de saúde; e (3 serve como um grupo de autoajuda: afinal, é um grupo para o quê? Concluiu-se que os grupos estudados eram um híbrido de terapia e apoio que, no devir de seus arranjos, possibilitavam aos informantes (quiçá, para os pacientes construírem outros significados para as normatizações da política de saúde e o dilema da cronicidade. Tal hibridização permitia a criação de saídas próprias às particularidades do trabalho em saúde num contexto de “vida total”.

  19. Repercussões da variabilidade na saúde do enfermeiro intensivista

    Directory of Open Access Journals (Sweden)

    Élissa Jôse Erhardt Rollemberg Cruz

    2008-12-01

    Full Text Available Estudo qualitativo e descritivo, que teve como objeto a influência das situações de variabilidade na saúde do enfermeiro intensivista. Objetivou-se identificar situações de variabilidade e discutir as repercussões da variabilidade na saúde do enfermeiro intensivista. As informações foram coletadas num centro de terapia intensiva (CTI de um hospital da rede privada de saúde no Rio de Janeiro. Os sujeitos foram 13 enfermeiros intensivistas em atuação neste CTI há pelo menos um ano. O instrumento de coleta foi entrevista semi-estruturada, realizada entre Setembro/2006 e Outubro/2006. O método de análise caracterizou-se na análise de conteúdo. O tratamento das informações demonstrou que os enfermeiros conhecem as situações de variabilidade e que estas alteram o processo saúde-doença, resultando em irritabilidade, elevação da pressão arterial, cansaço, dores, tensão muscular e estresse. Entretanto, as ocorrências de algumas são passíveis de serem restringidas. Estratégias de enfrentamento foram apontadas e perpassam desde a sistematização da assistência, até melhores salários, condições de trabalho e o auto-conhecimento. Concluiu-se que os enfermeiros vivenciam em sua rotina laboral muitas situações de variabilidade, implicando na rápida mobilização de suas potencialidades psicofísicas e cognitivas, repercutindo negativamente em sua saúde.

  20. A inserção da vigilância em saúde ambiental no sistema único de saúde

    Directory of Open Access Journals (Sweden)

    Edenilo Baltazar Barreira Filho

    2012-03-01

    Full Text Available A inserção das atividades de vigilância ambiental no SUS apresenta algumas características que se diferenciam das práticas de vigilância epidemiológica. Isto ocorre principalmente em decorrência de que muitos dados sobre a exposição aos fatores ambientais são obtidos fora do setor saúde e a adoção de ações que busquem controlar e/ou prevenir exigem, na grande maioria dos casos, uma compreensãoe articulação intra e intersetorial, pois o setor saúde não é capaz de, sozinho, dar respostas as questões de saúde ambiental.Nos últimos anos vem consolidando-se cada vez mais o campo da saúdeambiental, que compreende a área da saúde pública, afeita ao conhecimento científico, à formulação de políticas públicas e às correspondentes intervenções (ações relacionadas à interação entre a saúde humana e os fatores do meio ambiente natural e antrópico que a determinam, condicionam e influenciam, com vistas a melhorar a qualidade de vida do ser humano sob o ponto de vista dasustentabilidade(1.Conforme entendimento acordado no I Seminário da Política Nacional de Saúde Ambiental, realizado em outubro de 2005, e consolidado na primeira Conferência Nacional de Saúde Ambiental, realizada em dezembro de 2009, compreende-se como uma área de práticas intersetoriais e transdisciplinares voltadas aos reflexos, na saúde humana, das relações ecogeossociais do homem com o ambiente(1.Nesse sentido, o Ministério da Saúde vem implementando em todo o território nacional um Sistema de Vigilância em Saúde Ambiental (SINVISA, buscando o aprimoramento deste “modelo” de atuação e estabelecendo competências nas três esferas de gestão, com o objetivo de consolidar a prática da Saúde Ambiental dentro do SUS.A Instrução Normativa nº 1, de 7 de março de 2005, cria o SINVISA, estabelece a área de atuação, as competências para as três esferas de Gestão do SUS e define a Vigilância em Saúde Ambiental como sendo

  1. O entendimento do direito à saúde: uma abordagem dos usuários do SUS no Distrito Federal

    Directory of Open Access Journals (Sweden)

    Rosa Shirley Silva

    2015-09-01

    Full Text Available O direito à saúde é um direito fundamental, conquistado por meio da participação social que resultou em sua inserção na atual Constituição Federal, e na instituição do SUS. Este estudo objetivou analisar a percepção dos usuários do SUS, no Distrito Federal, sobre o direito à saúde e o impacto desse entendimento na dinâmica da construção do sistema. Foram realizadas entrevistas, com 75 usuários, entre setembro e outubro de 2014. Como roteiro de pesquisa utilizou-se o método qualiquantitativo de abordagem descritiva exploratória. Os dados coletados, através de formulário semiestruturado, foram tratados com sistema planilhas do Microsoft Office Excel versão 2010 e para auxiliar a pergunta aberta utilizou-se a técnica do Discurso do Sujeito Coletivo (DSC. Os tópicos de interesse foram: o conceito de saúde, o SUS, informação em saúde e participação social. Verificou-se, portanto, que a maioria dos usuários do SUS não reconhece a saúde como direito. O entendimento de SUS como política criada para garantir o direito à saúde é substituído pela ideia de concessão do Estado. Aliado à isso, o desconhecimento das leis de saúde, a falta de consciência sanitária e a sensação de resignação e submissão de sua situação de saúde reforçam este pensamento. O impacto desse entendimento na dinâmica da construção do sistema acontece pela baixa capacidade de organização e pouco conhecimento e participação no Conselho de Saúde. Foi possível concluir que o desconhecimento do direito à saúde compromete e enfraquece o processo de desenvolvimento do SUS, que se fundamenta no princípio da participação e controle social.

  2. 76 FR 27954 - Airworthiness Directives; Eurocopter France Model SA-365C, SA-365C1, SA-365C2, SA-365N, SA-365N1...

    Science.gov (United States)

    2011-05-13

    ..., M-30, West Building Ground Floor, Room W12-140, 1200 New Jersey Avenue, SE., Washington, DC 20590. Hand Delivery: U.S. Department of Transportation, Docket Operations, M-30, West Building Ground Floor... star arm end, on helicopters operated in hot climatic conditions and/or tropical and damp...

  3. A Psicologia na Estratégia de Saúde da Família: Vivências da Residência Multiprofissional

    Directory of Open Access Journals (Sweden)

    Pâmela Kurtz Cezar

    Full Text Available Este trabalho é um relato de experiência e tem por objetivo apresentar o processo de inserção da Psicologia em serviços de Estratégia de Saúde da Família numa cidade do interior do Rio Grande do Sul por meio das atividades do Programa de Residência Multiprofissional. Observou-se, durante essa vivência, que tanto os profissionais das equipes de Saúde da Família como os usuários do serviço tinham a expectativa de que a Psicologia desenvolvesse preferencialmente ações clínicas individuais. Entretanto, também foram desenvolvidas ações de maneira interdisciplinar e intersetorial, com intervenções de promoção, prevenção e educação em saúde, além de ações de articulação ensino-serviço e de articulação com serviços da rede de saúde e saúde mental do município e de participação em espaços coletivos, como Conselho Municipal de Saúde e Comissão de Saúde Mental. Conclui-se, desse modo, que, embora a Psicologia tenha ampliado suas possibilidades de atuação na área da saúde pública, ainda permanecem desafios no âmbito da atenção básica à saúde, em especial no que se refere à necessidade de superação do modelo tradicional de atuação do psicólogo, por meio de um trabalho mais compartilhado com outros profissionais da saúde.

  4. A categoria racionalidade médica e uma nova epistemologia em saúde

    Directory of Open Access Journals (Sweden)

    Marilene Cabral do Nascimento

    2013-12-01

    Full Text Available O artigo é um relato analítico da trajetória de 20 anos da categoria racionalidade médica, que emergiu no Campo da Saúde Coletiva, área das Ciências Sociais e Humanas em Saúde, no início da década de 1990, com o objetivo de estudar sistemas médicos complexos e terapêuticas tradicionais, complementares e alternativas. Com base em revisão crítica da literatura, apresentam-se aspectos do contexto cultural, político-institucional e social de seu surgimento, como também suas principais contribuições e desdobramentos nos planos teórico e das políticas e práticas sociais em saúde. Utiliza-se o conceito de epistemologia do sul de Boaventura de Sousa Santos, para a reflexão sobre a contribuição da categoria racionalidade médica à crítica da racionalidade científica pós-moderna e à construção de uma nova epistemologia em saúde.

  5. Sentimentos e percepções da equipe de saúde frente ao paciente terminal

    Directory of Open Access Journals (Sweden)

    Alberto Manuel Quintana

    2006-12-01

    Full Text Available O atendimento a pacientes terminais pelas equipes de saúde, comprovadamente apontado por evidências na literatura, mostra a grande dificuldade que esses profissionais têm em lidar com o tema "morte". O presente estudo objetivou compreender como as equipes de saúde definem e vivenciam o paciente terminal. Para tanto, utilizou-se uma abordagem qualitativa que empregou a pesquisa etnográfica através de observação não-participativa, além de entrevistas semi-estruturadas nas unidades de hemato-oncologia e de infectologia de um hospital público. Os resultados certificaram as dificuldades por parte da equipe em lidar com pacientes terminais, bem como em defini-los como tais e comunicar aos mesmos a sua condição. Dessa forma, percebeu-se a intensa necessidade da realização de um trabalho direto com as equipes de saúde com o intuito de lhes proporcionar um espaço de reflexão e de entendimento, propiciando a continência das emoções suscitadas na equipe de saúde perante a situação da morte.

  6. Direito à saúde: demanda por suplementos no Tribunal de Justiça

    Directory of Open Access Journals (Sweden)

    Leandro Felipe Mufato

    2012-03-01

    Full Text Available Buscou-se compreender como o Tribunal de Justiça de Mato Grosso contribui na efetivação do direito à saúde, ao atuar como mediador na demanda de pessoas e/ou famílias por suplementos. Objetivou conhecer a origem, o motivo, o objeto, o sujeito demandante e a resolutividade das decisões judiciais. Trata-se de estudo qualitativo baseado em pesquisa documental. Das 28 decisões analisadas, 92,8% (26 demandaram compostos alimentares e 7,1% (2, fitas de controle glicêmico. O magistrado acolheu o pedido em 96,5% (27 das decisões, recorrendo estritamente à Constituição Federal, em seu discurso sobre o direito à saúde, e à prescrição médica como prova jurídica. Tais prescrições impõem marcas comerciais em 100% (28 dos casos, e a alergia alimentar pediátrica constitui principal motivo da demanda, 17,8% (5. A maioria dos adoecimentos, considerados condições crônicas de saúde, demanda cuidados continuados e prolongados, frente aos quais o caráter pontual das decisões judiciais pouco contribui para efetivação da equidade e integralidade em saúde.

  7. Marcadores de saúde do homem em um município de pequeno porte

    Directory of Open Access Journals (Sweden)

    Maria Cristina Pinto de Jesus

    2014-12-01

    Full Text Available Objetivo: Identificar marcadores de saúde do homem. Métodos: Pesquisa descritiva, exploratória com abordagem quantitativa realizada em um município de pequeno porte de Minas Gerais. A coleta de dados ocorreu de outubro a dezembro de 2013, utilizando-se 217 formulários estruturados com informações de homens. Resultados: 134 (62% formulários foram preenchidos durante o atendimento na Unidade de Atenção Primária à Saúde e o restante no dia da chamada nutricional realizada pelo município; 58% dos homens apresentaram sobrepeso e obesidade e a prevalência de hipertensão arterial sistêmica e diabetes mellitus foi de 17,5% e 4,6%, respectivamente. As doenças cardiovasculares mostraram-se mais presentes entre os homens, e sua alimentação inclui um grande percentual de alimentos processados. Conclusão: Os marcadores de saúde identificados no homem apontam a necessidade de operacionalização de estratégias que fortaleçam a participação do público masculino nas ações de promoção da saúde.

  8. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    2012-12-01

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.

  9. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.

  10. Perspectivas de região e redes na política de saúde brasileira

    Directory of Open Access Journals (Sweden)

    Mariana Vercesi de Albuquerque

    Full Text Available Regiões e Redes de Atenção à Saúde são estratégias recentes da política de saúde brasileira. Questiona-se: quais concepções de região e redes de saúde informam a política, como se combinam, em que momentos e com quais objetivos? Analisaram-se as perspectivas de região e redes adotadas na política de saúde, no período de 2001 a 2011. Utilizou-se o referencial da geografia humana (geografia crítica e da análise de políticas públicas (institucionalismo histórico, pesquisa bibliográfica, documental e dados secundários. Identificaram-se três fases de indução descompassada dessas estratégias, orientadas por distintas concepções teóricas e políticas e interesses nacionais e internacionais.

  11. Piezoelectric coefficients and spontaneous polarization of ScAlN.

    Science.gov (United States)

    Caro, Miguel A; Zhang, Siyuan; Riekkinen, Tommi; Ylilammi, Markku; Moram, Michelle A; Lopez-Acevedo, Olga; Molarius, Jyrki; Laurila, Tomi

    2015-06-24

    We present a computational study of spontaneous polarization and piezoelectricity in Sc(x)Al(1-x)N alloys in the compositional range from x = 0 to x = 0.5, obtained in the context of density functional theory and the Berry-phase theory of electric polarization using large periodic supercells. We report composition-dependent values of piezoelectric coefficients e(ij), piezoelectric moduli d(ij) and elastic constants C(ij). The theoretical findings are complemented with experimental measurement of e33 for a series of sputtered ScAlN films carried out with a piezoelectric resonator. The rapid increase with Sc content of the piezoelectric response reported in previous studies is confirmed for the available data. A detailed description of the full methodology required to calculate the piezoelectric properties of ScAlN, with application to other complex alloys, is presented. In particular, we find that the large amount of internal strain present in ScAlN and its intricate relation with electric polarization make configurational sampling and the use of large supercells at different compositions necessary in order to accurately derive the piezoelectric response of the material.

  12. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    2010-03-01

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  13. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  14. Formação de recursos humanos em saúde no Brasil: uma revisão integrativa

    Directory of Open Access Journals (Sweden)

    Carine Vendruscolo

    2014-03-01

    Full Text Available A Revisão Integrativa da Literatura analisou temáticas de estudos relacionados à formação de profissionais orientada para o Sistema Único de Saúde, de 2001 a 2012. Para a busca, em outubro de 2012, utilizaram-se os descritores: "Formação de Recursos Humanos" and "Sistema Único de Saúde", em consulta ao portal Biblioteca Virtual em Saúde. Foram encontrados 86 trabalhos, e 30 contemplavam os critérios de inclusão, os quais foram analisados, identificando-se as dimensões temáticas: princípios e diretrizes do SUS como orientadores da formação; necessidades do usuário e dos serviços de saúde; e papel dos diferentes sujeitos e organizações na mudança. Confirma a importância da formação como operadora essencial das mudanças na prática dos trabalhadores da saúde. Recomenda-se a realização de pesquisas com vistas ao fortalecimento dos dispositivos de reorientação da formação e ao aprofundamento do debate.

  15. Impacto da microbiota intestinal na saúde mental

    OpenAIRE

    Landeiro, Joana Almeida Vilão Raposo

    2016-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A microbiota intestinal consiste no conjunto de microrganismos residentes no intestino humano e que é responsável pela execução de diversas funções, sendo essencial para a manutenção da homeostase. Esta encontra-se em comunicação com o sistema nervoso central através do eixo intestino-cérebro, sendo esta comunicação bidirecional. Vários estudos têm revelado que a microbiota intestinal influenc...

  16. A participação do enfermeiro de saúde pública na saúde familiar

    Directory of Open Access Journals (Sweden)

    Zélia Sena Costa

    1986-09-01

    Full Text Available As autoras partem do pressuposto de que o avanço da epidemiologia tem demonstrado que muitas enfermidades estão associadas a determinadas estruturas sociais. Face a um enfoque científico, humanístico e personalizado, o Enfermeiro tem conquistado um papel de destaque junto à família, uma vez que este grupo social se constitui em uma via estratégica para utilização de parâmetros psicossocias tendo em vista a função básica de ajuda e apoio. Considerando que a contribuição do Enfermeiro de Saúde Pública é de vital importância para a melhoria do nível de saúde familiar, concluem que existe uma necessidade premente da aplicação adequada do Processo de Enfermagem a nível familiar, propondo a inserção da concepção - unidade familiar - como princípio básico da Assistência de Enfermagem.

  17. Photosensitive anisotype n-ZnSe/ p-InSe and n-ZnSe/ p-GaSe heterojunctions

    Science.gov (United States)

    Kudrynskyi, Z. R.; Kovalyuk, Z. D.

    2014-08-01

    Anisotype n-ZnSe/ p-InSe and n-ZnSe/ p-GaSe heterojunctions are obtained for the first time. They are grown on layered crystalline GaSe and InSe substrates by annealing in Zn vapor. It is found that these heterojunctions are sensitive to light in the near-infrared and visible spectral ranges.

  18. A literatura se ensina?

    OpenAIRE

    Cerdeira, Teresa Cristina

    2016-01-01

    Não sei se, na verdade, se ensina literatura. Mas qualquer coisa que se parecer com isto – ensinar literatura – tem que nascer de uma vibração conjunta de quem mostra e de quem vê pela primeira vez. Caminhar junto e descobrir sempre que as malhas do texto são infinitas. Venho portanto falar de sala de aula e de seminário, de circulação de saberes e de desejos, de uma atenção ao corpo sensível do texto que deve impactar, comprometer a linearidade da percepção, desalojar os sentidos prévios, en...

  19. Desafios da integralidade: revisitando as concepções sobre o papel do fisioterapeuta na equipe de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Laura Maria Tomazi Neves

    2011-06-01

    Full Text Available A estratégia prioritária nacional na Saúde Coletiva é a Saúde da Família (PSF, no entanto, é incipiente a participação de outros profissionais de saúde na atenção primária, além da Medicina e Enfermagem. O objetivo deste estudo foi realizar uma revisão sistemática da visão acadêmica do papel do fisioterapeuta na equipe de saúde da família (ESF. Foi realizada pesquisa bibliográfica no portal da Biblioteca Virtual em Saúde (BVS/Bireme/OPAS/OMS, de janeiro de 1994 a julho de 2009. A estratégia adotada foi o cruzamento dos seguintes descritores: Programa Saúde da Família, Saúde da Família, Saúde Coletiva, Saúde Pública, Fisioterapia (especialidades, Fisioterapia (técnicas, modalidades de fisioterapia. Dos 51 trabalhos localizados, 14 não estavam disponíveis. O restante foi analisado e sete foram selecionados por contemplarem os critérios de inclusão. Conclui-se que, apesar dos esforços, a fisioterapia ainda não possui uma definição clara em relação a sua atuação no PSF.

  20. Desafios da integralidade: revisitando as concepções sobre o papel do fisioterapeuta na equipe de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Laura Maria Tomazi Neves

    Full Text Available A estratégia prioritária nacional na Saúde Coletiva é a Saúde da Família (PSF, no entanto, é incipiente a participação de outros profissionais de saúde na atenção primária, além da Medicina e Enfermagem. O objetivo deste estudo foi realizar uma revisão sistemática da visão acadêmica do papel do fisioterapeuta na equipe de saúde da família (ESF. Foi realizada pesquisa bibliográfica no portal da Biblioteca Virtual em Saúde (BVS/Bireme/OPAS/OMS, de janeiro de 1994 a julho de 2009. A estratégia adotada foi o cruzamento dos seguintes descritores: Programa Saúde da Família, Saúde da Família, Saúde Coletiva, Saúde Pública, Fisioterapia (especialidades, Fisioterapia (técnicas, modalidades de fisioterapia. Dos 51 trabalhos localizados, 14 não estavam disponíveis. O restante foi analisado e sete foram selecionados por contemplarem os critérios de inclusão. Conclui-se que, apesar dos esforços, a fisioterapia ainda não possui uma definição clara em relação a sua atuação no PSF.

  1. Ensino da saúde coletiva na Faculdade de Medicina do ABC: alguns apontamentos sobre os desafios da Saúde Coletiva na formação médica

    Directory of Open Access Journals (Sweden)

    Nivaldo Carneiro Junior

    2015-12-01

    Full Text Available Introdução: A saúde coletiva, campo de saberes e práticas sobre o processo saúde‑doença‑cuidado, leva às graduações em saúde questões teórico‑metodológicas e tecnologias de intervenções ao exercício profissional. Historicamente, posiciona‑se à margem do projeto político‑pedagógico da formação em saúde, particularmente médica, de modelo biologizante e hospitalocêntrico. De acordo com a Constituição de 1988, Saúde é um Direito Social e o Sistema de Saúde, público e universal. Surgem formulações às políticas educacionais e saúde. É competência do Sistema Único de Saúde (SUS ordenar a formação de recursos humanos. As Diretrizes Curriculares Nacionais para as graduações em saúde apontam perfis profissionais voltados às necessidades de saúde da população, exigindo novas metodologias de ensino‑aprendizagem e cenários de práticas pedagógicas. Nessa perspectiva, o ensino da saúde coletiva emerge com importância singular. Relato de Experiência: A saúde coletiva na Medicina da Faculdade de Medicina do ABC era grade de disciplinas básicas do 2º ano. Um novo currículo modifica essa inserção. Até 2013, disciplina anual, em 3 módulos: epidemiologia, bioestatística e políticas e organização de serviços de saúde. Temas de ciências sociais e humanas desenvolviam‑se no 1º ano, módulo interdisciplinar Bases do Exercício Profissional. A grande concentração, nesse período, das disciplinas de morfologia e fisiologia, aproximações incipientes nos serviços de saúde e baixa exposição aos problemas de adoecimento e cuidado da população desafiavam o ensino‑aprendizagem da saúde coletiva. Conclusão: Desenvolveram‑se estratégias pedagógicas que superassem esse contexto, propiciando experiências cognitivas e habilidades psicomotoras favoráveis à apreensão dos conteúdos da saúde coletiva. Resultados positivos do exame recente do Conselho

  2. Experience with OpenMP for MADX-SC

    Energy Technology Data Exchange (ETDEWEB)

    D' Imperio, Nicholas [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Montag, Christophe [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Yu, Kwangmin [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kapin, Valery [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); McIntosh, Eric [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Renshall, Harry [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Schmidt, Frank [European Organization for Nuclear Research (CERN), Geneva (Switzerland)

    2014-07-01

    MADX-SC allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP.

  3. Experience with OpenMP 1 for MADX-SC

    CERN Document Server

    D’Imperio, N; Yu, K; Kapin, V; McIntosh, E; Renshall, H; Schmidt, F

    2014-01-01

    MADX-SC [1–3] allows the treatment of frozen space charge using beam-beam elements in a thin lattice, i.e. one can take advantage of the standard set-up of MAD-X [4] lattices without the need for specialized codes for the space-charge (SC) evaluation. The idea is to simulate over many turns without the problem of noise as in the PIC 1 SC codes. For the examples under study, like the PS and RHIC, it would be desirable to simulate up to 1 million turns or more. To this end one had to make an effort to optimize the scalar speed and, most importantly, get a speed-up of approximately a factor of 5 using OpenMP [5].

  4. Transport of one SC coil through the village of Meyrin

    CERN Multimedia

    1956-01-01

    In 1952, before CERN was officially founded, two accelerator projects were launched: one for an innovative accelerator to operate at an energy level unequalled at the time, the other for a more standard machine, a Synchro-Cyclotron (SC) to operate at 600 MeV. Design work on the SC was started in 1952 and carried out by teams scattered throughout Europe. Once construction began in 1954, CERN had to arrange road transport for the first of what has since been a long series of spectacular component deliveries, such as those of the machine's two magnetic coils each weighing 60 tonnes and measuring 7.2 metres in diameter. Above, one of them is seen passing through the village of Meyrin. The SC was commissioned in 1957 and was operational for 34 years!

  5. Synthesis and structure of perovskite ScMnO3.

    Science.gov (United States)

    Chen, Haiyan; Yu, Tian; Gao, Peng; Bai, Jianming; Tao, Jing; Tyson, Trevor A; Wang, Liping; Lalancette, Roger

    2013-08-19

    The rare-earth manganites RMnO3 (R = rare earth) are a class of important multiferroics with stable hexagonal structures for small R ion radius (Sc, Lu, Yb, ...). Metastable perovskite phases of these systems possess intriguing electronically driven electrical polarization, but the synthesis of the perovskite phase for the end member ScMnO3 system has proven to be elusive. We report the structure of a new monoclinic P2(1)/n perovskite phase of ScMnO3 synthesized from the hexagonal phase under high-pressure and high-temperature conditions. This extends the small ion region for so-called E-phase electronically driven ferroelectric manganese perovsites.

  6. The {\\sc Majorana Demonstrator} Neutrinoless Double-Beta Decay Experiment

    CERN Document Server

    Abgrall, N; Avignone, F T; Barabash, A S; Bertrand, F E; Boswell, M; Brudanin, V; Busch, M; Caldwell, A S; Chan, Y-D; Christofferson, C D; Combs, D C; Detwiler, J A; Doe, P J; Efremenko, Yu; Egorov, V; Ejiri, H; Elliott, S R; Esterline, J; Fast, J E; Finnerty, P; Fraenkle, F M; Galindo-Uribarri, A; Giovanetti, G K; Goett, J; Green, M P; Gruszko, J; Guiseppe, V E; Gusey, K; Hallin, A L; Hazama, R; Hegai, A; Henning, R; Hoppe, E W; Howard, S; Howe, M A; Keeter, K J; Kidd, M F; Knecht, A; Kochetov, O; Konovalov, S I; Kouzes, R T; LaFerriere, B D; Leon, J; Leviner, L E; Loach, J C; MacMullin, S; Martin, R D; Mertens, S; Mizouni, L; Nomachi, M; Orrell, J L; O'Shaughnessy, C; Overman, N R; Phillips, D G; Poon, A W P; Pushkin, K; Radford, D C; Rielage, K; Robertson, R G H; Ronquest, M C; Schubert, A G; Shanks, B; Shima, T; Shirchenko, M; Snavely, K J; Snyder, N; Steele, D; Strain, J; Suriano, A M; Thompson, J; Timkin, V; Tornow, W; Varner, R L; Vasilyev, S; Vetter, K; Vorren, K; White, B R; Wilkerson, J F; Xu, W; Yakushev, E; Young, A R; Yu, C-H; Yumatov, V

    2013-01-01

    The {\\sc Majorana Demonstrator will search for the neutrinoless double-beta decay of the isotope Ge-76 with a mixed array of enriched and natural germanium detectors. The observation of this rare decay would indicate the neutrino is its own antiparticle, demonstrate that lepton number is not conserved, and provide information on the absolute mass scale of the neutrino. The {\\sc Demonstrator} is being assembled at the 4850-foot level of the Sanford Underground Research Facility in Lead, South Dakota. The array will be situated in a low-background environment and surrounded by passive and active shielding. Here we describe the science goals of the {\\sc Demonstrator} and the details of its design.

  7. Guía de implementación de un sistema integrado de gestión (Enterprise Resource Planning) soportado con un plan de aseguramiento de calidad en la empresa Acerías Nacionales del Ecuador ANDEC S.A., empresa del grupo HOLDINGDINE S.A.

    OpenAIRE

    Carrillo Moya, Verónica Alexandra

    2013-01-01

    166 hojas : ilustraciones, 29 x 21 cm + CD-ROM 5218 En el presente trabajo se detalló una guía de implementación de un Sistema Integrado de Gestión (Enterprise Resource Planning), el mismo que fue soportado con un plan de aseguramiento de calidad, desarrollado en la empresa ACERÍAS NACIONALES DEL ECUADOR S.A. "ANDEC S.A.", ubicada en Guayaquil, Ecuador. Se desarrolló el marco teórico en el cual se fundamentó esta guía de implementación, se mencionaron algunas definiciones de procesos, enf...

  8. Promoção de saúde nas escolas na perspectiva de professores do ensino fundamental

    Directory of Open Access Journals (Sweden)

    Gabriela Maria Cavalcanti Costa

    2013-06-01

    Full Text Available Para caracterizar atividades de Promoção da Saúde desenvolvidas pelos professores do ensino fundamental de três escolas públicas na Paraíba, realizou-se estudo descritivo, de natureza qualitativa, desenvolvido em 2010. Foram entrevistados 32 professores. Os dados foram submetidos à análise de conteúdo e agrupados em categorias temáticas. Emergiram as seguintes categorias: conhecimentos teóricos acerca da promoção da saúde e a prática da promoção da saúde nas escolas, esta segunda ainda encampou as subcategorias: o planejamento das ações de promoção da saúde nas escolas, ações escolares de promoção da saúde, avaliação escolar das ações de promoção da saúde e expectativas dos professores para a execução de ações de promoção da saúde. Dessa forma, a promoção da saúde precisa ser abordada de forma transversal, integrada e intersetorial, com diálogo entre educação e saúde, compondo redes de compromisso e co-responsabilidade para a mobilização de ações. O enfermeiro precisa participar da rede social de apoio.

  9. Caso Ouro Fino Saúde Animal Caso Ouro Fino Saúde Animal Ouro Fino Saúde Animal case

    Directory of Open Access Journals (Sweden)

    Bernardo Hauch Ribeiro de Castro

    2012-04-01

    Full Text Available O Caso Ouro Fino Saúde Animal ilustra uma tomada de decisão, pelos executivos da empresa, sobre a entrada em um novo mercado, de vacinas para bovinos. Diante da necessidade de dar um passo maior em direção ao crescimento sustentável, a empresa não poderia deixar de entrar nesse segmento, que representava mais de metade do mercado brasileiro de produtos veterinários. No entanto, era um passo arriscado. A principal questão do caso é avaliar as alternativas de comprar vacinas de terceiros ou produzir internamente suas próprias vacinas. A empresa do caso é a Ouro Fino Saúde Animal, empresa brasileira de produtos veterinários, instalada no Estado de São Paulo, com faturamento de mais de R$ 100 milhões anuais. Os dois principais personagens deste caso são os diretores financeiro e industrial da empresa. A situação passa-se em 2005. Como instrumento de ensino, o caso foi concebido para o ensino de estratégia em cursos de pós-graduação em administração, levando os alunos a avaliar vantagens e desvantagens de cada uma das alternativas. Como objetivo secundário, o caso propicia alguns elementos para uma estimativa da viabilidade financeira da opção de implantar uma nova unidade produtiva e a possibilidade de refletir sobre uma decisão já tomada, de entrada no novo mercado. Por fim, o caso traz uma série de informações sobre o mercado brasileiro e sobre o mercado mundial de produtos veterinários. É possível, com base nestes dados, trabalhar questões ligadas à segmentação e posicionamento da empresa no setor, ficando a critério do professor este tipo de uso.El Caso Ouro Fino Saúde Animal ilustra una toma de decisiones por los ejecutivos de la empresa, a la entrada en un nuevo mercado de las vacunas para el ganado. Ante la necesidad de dar un paso importante hacia el crecimiento sostenible, Ouro Fino Saúde Animal no podía dejar de entrar, ya que representaba más de la mitad del mercado de productos veterinarios

  10. A contribuição da Psicopatologia Fundamental para a Saúde Mental

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Ceccarelli

    Full Text Available O texto traz reflexões sobre a intersecção da psicopatologia fundamental com a saúde mental. Inicialmente, o autor apresenta uma breve digressão sobre as mudanças no conceito grego de pathos, desde sua origem até o seu uso mais comum: o sentido médico de doença. Discute-se também as origens da psicopatologia como disciplina organizada. Em seguida, apresentam-se os fundamentos histórico-teóricos da psicopatologia fundamental, suas concepções quanto à origem e à organização do aparelho psíquico e suas relações com as outras psicopatologias. Finalmente, o autor discute a aplicabilidade dos princípios norteadores da psicopatologia fundamental às políticas de saúde mental.

  11. As práticas educativas em saúde e a Estratégia Saúde da Família Health education practices and Family Health Strategy

    Directory of Open Access Journals (Sweden)

    Gehysa Guimarães Alves

    2011-01-01

    Full Text Available Este trabalho tem por objetivo refletir sobre a educação em saúde, enfatizando a educação popular em saúde (EPS como proposta metodológica e sua utilização na rede básica de saúde, em especial na Estratégia Saúde da Família. Para tanto, foi realizada revisão bibliográfica sobre educação em saúde, prática educativa nos serviços de saúde e educação popular em saúde. Observou-se que, ainda hoje, as práticas educativas nos serviços de saúde obedecem a metodologias tradicionais, não privilegiando a criação de vínculo entre trabalhadores e população. Para que a educação popular em saúde possa se consolidar como uma prática educativa, deve ser incorporada no cotidiano do trabalho em saúde. Nesse sentido, a formação profissional deve valorizar as ações coletivas promotoras da saúde e desencadear um processo de reflexão crítica nos sujeitos envolvidos nas relações de ensino-aprendizagemThis study evaluated health education, and particularly popular health education, as a methodological approach used in the Brazilian basic healthcare network and in the Family Health Strategy, a family health program of the Brazilian government. The literature on health education, educational practices in healthcare services, and popular health education was reviewed. We found that educational practices in healthcare services follow traditional methods and do not prioritize the establishment of links between healthcare workers and the population. To be consolidated as an educational practice, popular health education should be incorporated into the routine of health-care services. For this purpose, the preparation of healthcare workers should focus on actions to promote collective health and critical reflections on healthcare teaching and learning by all the individuals involved in these processes

  12. Thermoelectric performance of functionalized Sc2C MXenes

    KAUST Repository

    Kumar, S.

    2016-07-05

    Functionalization of the MXene Sc2C, which has the rare property to realize semiconducting states for various functionalizations including O, F, and OH, is studied with respect to the electronic and thermal behavior. The lowest lattice thermal conductivity is obtained for OH functionalization and an additional 30% decrease can be achieved by confining the phonon mean free path to 100 nm. Despite a relatively low Seebeck coefficient, Sc2C(OH)2 is a candidate for intermediate-temperature thermoelectric applications due to compensation by a high electrical conductivity and very low lattice thermal conductivity.

  13. Determination of Sc by Ion-exchanger Colorimetry

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Ion-exchanger colorimetry for scandium in the form of ternary color system "Sc(Ⅲ)-CPA-pc-Ac" was developed. The influences of types and grain sizes of resin, adsorption modes and the acidity on the determination were studied systematically, and the optimum operating conditions and the allowable amounts of foreign ions were determined. In comparison with the ordinary solution colorimetry, both of the sensitivity and the selectivity of this ion-exchanger colorimetry are improved obviously. The preliminary uses of this method to the determination of Sc(Ⅲ) in two synthetic samples were satisfied.

  14. Bayesian narrowband interference mitigation in SC-FDMA

    KAUST Repository

    Ali, Anum

    2015-08-12

    This paper presents a novel narrowband interference (NBI) mitigation scheme for SC-FDMA systems. The proposed scheme exploits the frequency domain sparsity of the unknown NBI signal and adopts a low complexity Bayesian sparse recovery procedure. In practice, however, the sparsity of the NBI is destroyed by a grid mismatch between NBI sources and SC-FDMA system. Towards this end, an accurate grid mismatch model is presented and a sparsifying transform is utilized to restore the sparsity of the unknown signal. Numerical results are presented that depict the suitability of the proposed scheme for NBI mitigation.

  15. Radiation protection Group (SC/RP) desperately seeking...

    CERN Multimedia

    A. Hervé, Y. Donjoux / SC

    2006-01-01

    We are trying to trace two transit permits (passavants), which constitute the customs clearance documentation for two 'AD6'portable radiation detectors. The two permits (No. 1308 and No. 1309) were sent in the same internal mail envelope towards the middle of March 2006 but never reached their final destination. After weeks of searching in vain, we are now appealing for your help. If you have these two permits in your possession, please get in touch with us. Many thanks in advance. A.HERVE - SC/RP- ( 163168 / 70927) Y.DONJOUX - SC/RP - (160105 / 73171)

  16. Studies of the aggregation of RNase Sa

    DEFF Research Database (Denmark)

    Khasa, Harshit; Kramer, Ryan; Maddux, Nathan

    2014-01-01

    Thirty-eight mutants of RNase Sa (ribonuclease from Streptomyces aureofaciens) were examined for their structure, thermal sensitivity, and tendency to aggregate. Although a biphasic correlation was seen between the effect of temperature on structure and the free energy of transfer changes in many...

  17. Ações de saúde mental na Estratégia Saúde da Família: Expectativas de familiares

    Directory of Open Access Journals (Sweden)

    Marcio Wagner Camatta

    2016-06-01

    Full Text Available RESUMO Objetivo: Compreender as expectativas de familiares de usuários com transtorno mental da Estratégia Saúde da Família (ESF, em relação às ações de saúde mental. Métodos: Trata-se de uma pesquisa qualitativa, com utilização do referencial da Sociologia fenomenológica. Foram realizadas entrevistas semiestruturadas com 12 familiares de duas unidades de ESF de Porto Alegre, Rio Grande do Sul, em 2010. Utilizou-se a análise compreensiva para a interpretação das categorias concretas: ter apoio da equipe da ESF; e ter atenção da equipe da ESF. Resultados: Em essência, os familiares têm por expectativas ter um relacionamento social genuíno com a equipe da ESF para compartilharem suas vivências, servindo de suporte para superarem angústias, ansiedades e sentimentos de impotência frente às adversidades de conviver com uma pessoa com transtorno mental. Conclusão: A relação intersubjetiva é um aspecto relevante para o cuidado em saúde mental na ESF, necessitando de maiores investimentos da equipe.

  18. Uma terceira via para a gente aprender as coisas femininas... perspectivas sobre o desenvolvimento de um projeto de promoção de saúde e cidadania de meninas

    Directory of Open Access Journals (Sweden)

    Silvana Nair Leite

    2010-12-01

    Full Text Available O estudo teve como objetivo identificar as percepções de meninas e seus familiares sobre o Programa Univali Mulher. O Univali Mulher visa à promoção da saúde, é voltado para meninas de duas escolas de Itajaí/SC e objetiva prevenir a violência contra a mulher e fortalecer/promover seu empoderamento por meio de um processo dialógico de ensino. Trabalhando com a abordagem qualitativa de pesquisa, os dados foram levantados por três meios distintos (análise de relatórios, observações e entrevistas semiestruturadas. Pode-se extrair que o Programa significa um meio extraclasse de educação que propicia a formação de um grupo com vinculo afetivo, cujas atividades representam um momento expressivo e libertador, porém, regulador de comportamentos "desajustados", não logrando, assim, a plenitude do processo de empoderamento.

  19. Uma terceira via para a gente aprender as coisas femininas... perspectivas sobre o desenvolvimento de um projeto de promoção de saúde e cidadania de meninas

    Directory of Open Access Journals (Sweden)

    Silvana Nair Leite

    Full Text Available O estudo teve como objetivo identificar as percepções de meninas e seus familiares sobre o Programa Univali Mulher. O Univali Mulher visa à promoção da saúde, é voltado para meninas de duas escolas de Itajaí/SC e objetiva prevenir a violência contra a mulher e fortalecer/promover seu empoderamento por meio de um processo dialógico de ensino. Trabalhando com a abordagem qualitativa de pesquisa, os dados foram levantados por três meios distintos (análise de relatórios, observações e entrevistas semiestruturadas. Pode-se extrair que o Programa significa um meio extraclasse de educação que propicia a formação de um grupo com vinculo afetivo, cujas atividades representam um momento expressivo e libertador, porém, regulador de comportamentos "desajustados", não logrando, assim, a plenitude do processo de empoderamento.

  20. Saúde mental e trabalho: levantamento das publicações na SCIELO e PEPSIC

    Directory of Open Access Journals (Sweden)

    Maria Célia Bruno Mundim

    2012-01-01

    Full Text Available Considerando-se a importância do tema saúde do trabalhador, o objetivo deste estudo foi o de fazer um levantamento das publicações acerca da saúde mental e trabalho nos periódicos das bases Scielo e PePSIC, sem limitação de período. Foram selecionados 57 trabalhos, nos quais foram levantados os seguintes aspectos: a temática, o período de publicação, setores pesquisados e regiões de publicação. Os resultados indicaram aumento nas publicações sobre o tema nos últimos seis anos e prevalência das pesquisas teóricas seguidas pela empírica qualitativa. Também se verificou que a temática mais pesquisada é a saúde/doença mental, há predominância de publicações na região sudeste e os setores mais pesquisados são da saúde, saúde mental e policial. Concluiu-se que o interesse pelo tema saúde mental e trabalho vêm aumentando, porém há necessidade de mais estudos sobre intervenções e políticas de saúde do trabalhador. Abstract The aim of this study was to conduct a review of publications on mental health and work in Scielo and PePSIC journals, without limitation of time. 57 articles were selected and analyzed regarding methodology, theme, date of publication, surveyed sectors and regions of publication. The results showed an increase in publications on the subject over the past six years and the prevalence of theoretical research followed by the qualitative empirical papers. Also it was found that the prevailing subject is health/mental illness and there are more publications in the Southeast. The sectors more surveyed are health, mental health and police. In conclusion, the interest in mental health and work has increased, but there is a need for further studies on interventions and policies for worker health.

  1. A saúde no cotidiano de jovens residentes em um bairro popular de Belo Horizonte, MG, Brasil

    Directory of Open Access Journals (Sweden)

    Natália de Cássia Horta

    2011-12-01

    Full Text Available Este estudo teve como objeto a saúde no cotidiano dos jovens considerando que esses não têm suas vivências cotidianas contempladas nas ações de saúde. O objetivo é analisar os modos de vida juvenis apreendendo os significados e sentidos da saúde em seu cotidiano. Trata-se de uma investigação qualitativa, fundamentada na dialética, com base na sociologia da vida cotidiana. Desenvolvida num bairro popular do município de Belo Horizonte, foi estruturada em fase exploratória e interpretativa, tendo como sujeitos dezenove jovens. Por meio da análise hermenêutica e dialética, a tese foi confirmada. As ações de cuidado presentes no cotidiano dos jovens levam em conta os recursos e os aspectos constitutivos da condição juvenil, ainda pouco contemplada nas proposições da área da saúde. No cotidiano dos jovens, tem-se a expressividade dos modos de vida e da condição juvenil na qual a saúde se revela pelo bem-estar e pelas condições básicas para o trilhar da vida. A concepção de saúde prevalente centra-se nos comportamentos e na corporeidade. Para a promoção da saúde juvenil é necessário partir dos modos de vida juvenis e interagir com eles no cotidiano. As ações de cuidado com a saúde têm um espaço de (invisibilidade na vida dos jovens e interagem com suas prioridades na vivência da condição juvenil. Revelou-se a importância da proposição de ações cuidadoras nos microespaços e no território em que se expressa essa condição.

  2. Orientação sobre saúde bucal em um Centro de Saúde Dental health education in a public health centre

    Directory of Open Access Journals (Sweden)

    Roberto Augusto Castellanos

    1977-06-01

    Full Text Available Foi realizado estudo com o fim de verificar qual a orientação sobre saúde bucal dada aos clientes que pela primeira vez compareceram a um centro de saúde. Durante o período de 2 semanas foram observados 25 clientes; o método utilizado foi o da "observação participante''. Os dados necessários para o "diagnóstico educativo" foram colhidos com o auxílio de uma ficha. Da análise destes dados concluiu-se não haver uma adequada orientação com relação à saúde bucal, por parte do pessoal responsável. Sugere-se como "tratamento educativo" revisão das normas em relação à saúde da boca e desenvolvimento de um programa educativo, incidental e planejado, integrado às diferentes atividades realizadas pelo Centro. Propõe-se um conteúdo programático responsabilizando o dentista pelo adestramento do pessoal, execução e avaliação do programa. Ressalta-se a importância do centro de saúde para o desenvolvimento de programas integrados, preventivos, curativos e educativos.This paper deals with a study made with the purpose of observing dental health, education of patients coming for the first time to a Health Center. The study was carried out during two weeks and 25 patients were observed through "Participant Observation". Data for the "Educational Diagnosis" was collected in a card specially designed for it. Results showed that dental health orientation was not given by the staff to patients. An educational programme about dental health is suggested to be integrated with the activities of the various services, being the Dentist responsible for the staff programme coordination and evaluation. Finally the importance of the health center for the development of preventive, curative and educational integrated programmes is emphasized.

  3. Saúde, empoderamento e triangulação Health, empowerment and triangulation

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    2004-08-01

    Full Text Available A saúde no presente artigo é enfocada a partir de três pontos de vista: o ponto de vista do indivíduo, o ponto de vista do sistema produtivo e o ponto de vista técnico. Para o indivíduo, a saúde pode ser vista como uma sensação (de não doença, não dor, etc.; para o sistema produtivo, ela pode ser vista como um valor a ser oferecido num mercado privado e público de bens de saúde e para o técnico, como um poder, o poder de proporcionar saúde. A partir destes três pontos de vista, várias interrelações podem ser pensadas, exemplificando-se aqui quatro delas. Nesta teia de relações, a questão do empoderamento se revela importante, salientando-se, neste contexto, a importância de se considerar o indivíduo e/ou consumidor e/ou usuário como "elo mais fraco" e, portanto, mais carente de uma ação empoderadora.In this article health is focused by three points of view: of the individual, of the productive system and of the technician. For the individual, health is viewed as a sensation (of non-disease, of no-pain, etc; for the productive system, health is viewed as a value to be offered in the private and public market; and for the technician, as a power to provide health. From these three points of view, many interactions can be obtained. In the web of nteractions, empowerment is important, as the individual can be seen as the weakest actor.

  4. Homens e saúde na pauta da Saúde Coletiva Men and health as targets of the Public Health

    Directory of Open Access Journals (Sweden)

    Lília Blima Schraiber

    2005-03-01

    Full Text Available Apresenta-se a temática "homens e saúde" como questão contemporânea da Saúde Coletiva e produto da interface entre as ciências humanas e a saúde: o caráter social do adoecimento; a perspectiva de gênero como forma particular da relação saúde-sociedade; e a promoção da saúde como conceituação positiva Elabora-se a temática em torno de três eixos de aproximação, sob a perspectiva dos exercícios das masculinidades: saúde sexual e reprodutiva; violência e gênero e morbi-mortalidade em homens. São apontadas as contribuições que estes eixos produzem como esforço empírico para realizar a categoria gênero, ao tempo em que revelam novas problemáticas para a área de saúde: a paternidade, o exercício interativo da sexualidade, a violência interpessoal no âmbito da vida privada, a hiper-masculinidade na violência entre homens, o cuidado de si e o cuidar em saúde para os homens. Estas contribuições permitirão não apenas inserir as masculinidades como questão de saúde, mas renovar as formas de tratamento de homens e mulheres no campo da saúde.It shows the thematic "men and health" as a contemporary matter of the Public Health and interface product among human sciences and health: the social view of illness; the gender perspective as a particular form of the relation health-society and the health promotion while positive means of health. It elaborates the thematic around three approach axises, conformed in the relation between men and health from the perspective of exercises of the masculinity: sexual and reproductive health; violence and gender, and morbid-mortality in men. The contributions that these axises produce are mentioned as empiric effort to accomplish the category gender, the time in which they reveal health new problems to the health's area: the paternity, the interactive exercise of the sexuality, the interpersonal violence in life closet scope, the hipper-masculinity in the violence among men, the

  5. Tetrahedron dynamics in the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and the cubic 1/1-approximant Zn6Sc.

    Science.gov (United States)

    Euchner, H; Yamada, T; Rols, S; Ishimasa, T; Kaneko, Y; Ollivier, J; Schober, H; Mihalkovic, M; de Boissieu, M

    2013-03-20

    A comparison of periodic approximants and their quasicrystalline counterparts offers the opportunity to better understand the structure, physical properties and stabilizing mechanisms of these complex phases. We present a combined experimental and molecular dynamics study of the lattice dynamics of the icosahedral quasicrystals i-ZnMgSc and i-ZnAgSc and compare it to recently published results obtained for the cubic 1/1-approximant Zn(6)Sc. Both phases, quasicrystal and approximant, are built up from large atomic clusters which contain a tetrahedral shell at the cluster centre and are packed either quasiperiodically or on a bcc lattice. Using quasielastic neutron scattering and atomic scale simulations, we show that in the quasicrystal the tetrahedra display a dynamics similar to that observed in the 1/1-approximant: the tetrahedra behave as a 'single molecule' and reorient dynamically on a timescale of the order of a few ps. The tetrahedra reorientation is accompanied by a large distortion of the surrounding cluster shells which provide a unique dynamical flexibility to the quasicrystal. However, whereas in the 1/1-approximant the tetrahedron reorientation is observed down to T(c) = 160 K, where a phase transition takes place, in the quasicrystal the tetrahedron dynamics is gradually freezing from 550 to 300 K, similarly to a glassy system.

  6. Articulação das ações e interação dos Agentes Comunitários de Saúde na equipe de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Karen Namie Sakata

    2012-06-01

    Full Text Available O estudo de abordagem qualitativa teve como objetivo compreender as relações sociais entre o Agente Comunitário de Saúde (ACS e a equipe de Saúde da Família (SF, nesse sentido, destaca-se a articulação das ações e a interação entre trabalhadores. Foram realizadas 23 observações participantes e 11 entrevistas semiestruturadas com uma equipe de SF em um município do interior de São Paulo, Brasil. Identificou-se que o ACS, como elo, desenvolve ações operacionais para agilizar o trabalho da equipe. Como laços de ligação, desempenham ações articuladas ao trabalho da equipe, interagindo com os trabalhadores, construindo planos assistenciais em comum, aproximando equipe e comunidade, adequando ações de cuidado às necessidades das pessoas. Na prática comunicativa, ao falarem de si, falam da própria comunidade, pois é seu representante e porta-voz na equipe. Concluiu-se que o Agente Comunitário de Saúde pode ser um trabalhador estratégico se suas ações compreenderem uma dimensão mais política e social do trabalho em saúde.

  7. Oral health conditions among pregnant women attended to at a health care center in Manaus, Amazonas, Brazil = Condições de saúde bucal de gestantes atendidas em uma unidade de saúde em Manaus, Amazonas, Brasil

    Directory of Open Access Journals (Sweden)

    Bressane, Larissa Borges

    2011-01-01

    Conclusões: Diante dos resultados obtidos, pôde-se constatar que as condições de saúde na população de gestantes estudadas foram desfavoráveis; entretanto, a maioria a considerou regular ou boa

  8. A construção do campo da saúde do trabalhador: percurso e dilemas

    Directory of Open Access Journals (Sweden)

    Carlos Minayo-Gomez

    Full Text Available Realiza-se, neste artigo, uma reflexão sobre os fundamentos teóricos e práticos que influenciam e conformam o campo da Saúde do Trabalhador no Brasil, no interior da Saúde Coletiva. Ao analisar as diversas formas de conceber a relação trabalho-saúde, enfatiza-se a pertinência de interpretar essa relação, dada sua natureza complexa e conflitiva, tendo como referência central o processo de trabalho, em consonância com os pressupostos da Medicina Social latino-americana. Com base nesse enfoque, ressalta-se a necessidade de abordagens interdisciplinares que contemplem e extrapolem a articulação de áreas de conhecimento habitualmente adscritas ao âmbito da saúde. Finalmente, apresenta-se um breve diagnóstico da situação atual desse campo, onde questões pendentes unem-se às decorrentes da globalização da economia e, em particular, da reestruturação industrial. À luz desse quadro, coloca-se como desafio ampliar os objetos de estudo e intervenção, abrangendo, entre outras temáticas emergentes, as implicações para a saúde e a vida da população derivadas dos novos padrões de terceirização, da precarização do trabalho, do trabalho informal e do desemprego.

  9. A construção do campo da saúde do trabalhador: percurso e dilemas

    Directory of Open Access Journals (Sweden)

    Minayo-Gomez Carlos

    1997-01-01

    Full Text Available Realiza-se, neste artigo, uma reflexão sobre os fundamentos teóricos e práticos que influenciam e conformam o campo da Saúde do Trabalhador no Brasil, no interior da Saúde Coletiva. Ao analisar as diversas formas de conceber a relação trabalho-saúde, enfatiza-se a pertinência de interpretar essa relação, dada sua natureza complexa e conflitiva, tendo como referência central o processo de trabalho, em consonância com os pressupostos da Medicina Social latino-americana. Com base nesse enfoque, ressalta-se a necessidade de abordagens interdisciplinares que contemplem e extrapolem a articulação de áreas de conhecimento habitualmente adscritas ao âmbito da saúde. Finalmente, apresenta-se um breve diagnóstico da situação atual desse campo, onde questões pendentes unem-se às decorrentes da globalização da economia e, em particular, da reestruturação industrial. À luz desse quadro, coloca-se como desafio ampliar os objetos de estudo e intervenção, abrangendo, entre outras temáticas emergentes, as implicações para a saúde e a vida da população derivadas dos novos padrões de terceirização, da precarização do trabalho, do trabalho informal e do desemprego.

  10. Auto-percepção das condições de saúde da população adulta, Sul do Brasil Auto-percepción de las condiciones de salud de la población adulta, Sur de Brasil Self-rated health conditions of the adult population, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Jefferson Traebert

    2011-08-01

    Full Text Available O objetivo do estudo foi estimar como a população adulta (20 a 59 anos de Joaçaba, SC, avalia sua condição de saúde. Realizou-se um estudo transversal em 2006 envolvendo amostra representativa (n = 707. O questionário levantou condições sociodemográficas, restrição das atividades diárias, realização de consulta médica, internação hospitalar e auto-percepção de saúde. Procedeu-se a análise de regressão logística múltipla hierarquizada. Constatou-se que 74,7% dos indivíduos percebia sua saúde como boa e 3,9% a percebia como ruim/muito ruim. Não estar trabalhando no momento da entrevista e deixar de realizar atividades habituais por problemas de saúde aumentaram significativamente a chance de uma auto-avaliação da condição de saúde como ruim/muito ruim.El objetivo del estudio fue estimar como la población adulta (20 a 59 años de Joacaba, Sur de Brasil, evalúa su condición de salud. Se realizó un estudio transversal en 2006 tomando muestra representativa (n=707. El cuestionario levantó condiciones sociodemográficas, restricción de las actividades diarias, realización de consulta médica, internación hospitalaria y auto-percepción de salud. Se procedió con análisis de regresión logística múltiple jerarquizada. Se constató que 74,7% de los individuos percibía su salud como buena y 3,9% la percibía como mala/muy mala. No estar trabajando en el momento de la investigación y dejar de realizar actividades habituales por problemas de salud aumentaron significativamente el chance de auto-evaluación de la condición de salud como mala/muy mala.The study aimed to estimate how the adult population (20 to 59 years of Joaçaba, Southern Brazil, rates its health status. A cross-sectional study involving a representative sample (n=707 was carried out in 2006. The questionnaire surveyed sociodemographic conditions, restriction on daily activities, medical consultation, hospitalization and self-rated health. A

  11. Educação em saúde e promoção da saúde: impacto na qualidade de vida do idoso

    Directory of Open Access Journals (Sweden)

    Janaina Pinto Janini

    Full Text Available Objetiva-se analisar o impacto das ações de promoção e educação em saúde na busca da qualidade de vida, na autonomia e no autocuidado da pessoa idosa. A coleta de dados deu-se por meio de entrevistas semiestruturadas com 83 idosos, de ambos os sexos, e evidenciaram a importância da intersetorialidade e da realização de ações educativas emancipadoras da população. Ainda assim, faz-se necessário agregar, a esses processos, estratégias de universalização e equalização das informações concedidas aos idosos. Concluiu-se que a educação constitui uma poderosa ferramenta na promoção da saúde, na garantia da autonomia e na qualidade de vida do idoso.

  12. Diferenciais de gênero no impacto do arranjo familiar no status de saúde dos idosos brasileiros

    Directory of Open Access Journals (Sweden)

    Dalia E. Romero

    Full Text Available Analisam-se os diferenciais por gênero na relação do arranjo familiar com o status de saúde de pessoas com 65 anos ou mais, incorporando também fatores socioeconômicos e sociodemográficos. Utilizam-se dados da PNAD de 1998. Foram desenvolvidos diversos modelos de regressão logística para duas variáveis dependentes: auto-avaliação da saúde e declaração de doenças. Os fatores explicativos (área rural/urbana, idade, renda per capita, analfabetismo, arranjo familiar e condição no domicílio foram incorporados seqüencialmente para avaliar as mudanças da inter-relação. Encontrou-se que, embora as mulheres tenham mais desvantagem quanto à declaração de doenças, a auto-avaliação da condição de sua saúde é relativamente similar à dos homens. Os diferenciais de gênero no padrão de arranjo familiar dos idosos são em parte responsáveis pela desvantagem no status de saúde das mulheres. Conclui-se que a formulação de políticas para o melhoramento do status de saúde do idoso deve considerar a existência de importantes diferenças de gênero no padrão da estrutura e arranjo de suas famílias. Existe necessidade de maior disponibilidade de inquéritos para idosos, que permitam aprofundamento na relação entre saúde do idoso, gênero e família.

  13. Formação em Educação Física no Brasil: outros modos de pensar e intervir no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Yara Maria de Carvalho

    2013-06-01

    Full Text Available O que apresentamos traduz um debate no campo da saúde pública/saúde coletiva no Brasil relativo à formação em saúde, especialmente no nível da atenção primária em saúde, mas também resulta de uma intervenção no serviço público de saúde que envolveu estudantes e docente vinculados ao curso de graduação em Educação Física e Esporte da Universidade de São Paulo (USP, que se viram diante do desafio de responder às necessidades de saúde da população experimentando a atuação interprofissional. O Programa de Educação pelo Trabalho para a Saúde (PET-Saúde, uma das iniciativas do governo federal que busca aproximar universidade (estudantes e docentes, serviços de saúde (profissionais da saúde e usuários a fim de problematizar o ensino em saúde, assim como qualificar a atenção e o cuidado em saúde, induziu essa formação diferenciada. Da participação dos estudantes no PET-Saúde, entre 2010 e 2012, ressaltamos o processo de ressignificação do campo e do próprio conceito saúde e a possibilidade de intervir nas necessidades de saúde da população a partir do trabalho em equipe

  14. A saúde escolar na educação: um recorte histórico desta modalidade de políticas no Brasil e Portugal

    OpenAIRE

    2016-01-01

    Esta pesquisa que trata do estudo sobre as aproximações entre as políticas de Saúde e Educação materializadas atualmente no Programa Saúde na Escola, implementado em 2007 e que tem como objetivo central, melhorias nas condições de saúde, aprendizagem e desenvolvimento dos estudantes, por meio de ações nos âmbitos de formação, prevenção e promoção da saúde, realizadas em escolas da rede de educação. O objetivo geral norteador da pesquisa é compreender como se processam as aproximações da saúde...

  15. Oficinas educativas para promoção da saúde de idosas institucionalizadas

    Directory of Open Access Journals (Sweden)

    Roberta Grangeiro de Oliveira

    2013-12-01

    Full Text Available Objetivo: Relatar a experiência de participação em oficinas de educação em saúde para idosas institucionalizadas. Síntese de dados: Realizaram-se ações de educação em saúde através do desenvolvimento de oficinas educativas sobre estilo de vida para 20 idosas de uma instituição filantrópica de um município, durante o mês de outubro de 2011. As oficinas foram dividas em três momentos e realizadas em 2 dias. Procurou-se estabelecer comunicação empática entre as participantes e interação através de dinâmicas, objetivando motivá-las a falar sobre os sentimentos despertados por figuras. Em seguida, abordou-se o estilo de vida saudável, com explicação sobre alimentação e atividade física. Conclusão: A realização de medidas educativas é eficaz para a promoção da saúde, o desenvolvimento de pensamentos críticos e a redução de comportamentos de risco.

  16. Suporte social, promoção de saúde e saúde bucal na população idosa no Brasil

    Directory of Open Access Journals (Sweden)

    Silvânia Suely Caribé de Araújo

    2006-06-01

    Full Text Available O crescente envelhecimento da população mundial, inclusive no Brasil, ressalta a importância de medidas para se lidar com esta situação. No Brasil, a maioria dos idosos é do sexo feminino; vive em domicílios multigeracionais; é referência econômica nos mesmos; possui baixo nível socioeconômico; portadora de, pelo menos, uma doença crônica; independente para realização das atividades da vida diária; não possui dentes, e busca atenção em saúde no SUS. Os idosos brasileiros expostos a situações de vulnerabilidade social estão sujeitos à interferência direta dos determinantes sociais no processo saúde-doença. O Suporte Social inclui políticas e redes de apoio social, que atuam como agente de integração do idoso na sociedade, minimizando os riscos de exclusão social e, conseqüentemente, de danos à sua saúde por meio de medidas de Promoção de Saúde. Este artigo aborda o Suporte Social e alguns de seus aspectos, tais como: tipo e local de residência, transporte e suporte financeiro; em idosos brasileiros e sua relação com a Promoção de Saúde.

  17. Promoção da saúde e participação comunitária em grupos locais organizados

    Directory of Open Access Journals (Sweden)

    Leticia Silveira Cardoso

    2013-12-01

    Full Text Available Objetivou-se conhecer a articulação dos grupos locais organizados com os profissionais da equipe da Estratégia Saúde da Família para a promoção da saúde socioambiental. Utilizou-se a técnica de entrevista semiestruturada gravada com 70 participantes dos 13 grupos investigados, analisadas segundo abordagem qualitativa de conteúdo. A categoria envolvimento comunitário revelou a mobilização profissional e comunitária pela gestão participativa em saúde. O interesse em participar dos grupos locais organizados indica as proposições individuais que se potencializam em coletivo e refletem-se no atendimento das necessidades humanas básicas psicobiológicas e socioambientais.

  18. Atenção Primária à Saúde: elementos de continuidade e mudanças na saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helder Kiyoshi Kashiwakura

    Full Text Available RESUMO A Atenção Primária à Saúde (APS ocupa lugar de destaque na agenda governamental. Os objetos do estudo são o sistema de saúde do Distrito Federal e as iniciativas para reorganização da APS, com objetivo de analisar o comportamento dos gastos em busca de elementos de continuidade e mudanças nessa política, no período de 2005 a 2014. Adotou-se a pesquisa documental com foco em dados do Sistema de Informações sobre Orçamentos Públicos. Partindo do neoinstitucionalismo histórico, os resultados apontam contradição entre o discurso em defesa da APS e a manutenção das elevadas despesas com assistência hospitalar, testemunhando a característica de path dependence.

  19. Educação em saúde com prostitutas de Fortaleza: relato de experiência

    Directory of Open Access Journals (Sweden)

    Maria Leonor Costa de Moraes

    2008-12-01

    Full Text Available As prostitutas, mesmo estando informadas sobre as DST nos seus aspectos clínicos, sentem dificuldade na manutenção do uso do preservativo. Percebe-se que o fator econômico é sentido por elas de forma mais concreta do que a necessidade de cuidar de sua saúde. Assim, realizou-se este estudo com o objetivo de relatar a experiência de educação em saúde com prostitutas atuantes em Fortaleza no ambiente da sala de espera da consulta de Enfermagem em Ginecologia no ano de 2006. Participaram das oficinas 55 mulheres, distribuídas em seis dias. As oficinas foram divididas em cinco momentos: auto-valorização; exame ginecológico; auto-estima; concorrência, competição e autoconfiança; direitos das mulheres e violência contra a mulher. Verificou-se que o trabalho de educação em saúde em grupo de prostitutas viabiliza sentimento de inclusão social, eqüidade e auto-valorização, pois as participantes se identificaram entre si, refletindo a sua circunstância pessoal na condição de trabalho, vida e saúde. Fortaleceram as relações humanas e transformaram alguns conteúdos abordados em aprendizado.

  20. Empresa Doente, Funcionário Estressado: analisando a saúde organizacional como influenciadora do stress no trabalho

    Directory of Open Access Journals (Sweden)

    Monize Sâmara Visentini

    2010-01-01

    Full Text Available Este trabalho investigou a influência da percepção de saúde organizacional sobre o stress no trabalho dos funcionários de restaurantes da cidade de Santa Maria – RS. Para tanto, utilizou-se uma survey com os funcionários de sete restaurantes, três públicos e quatro privados. Realizou-se uma análise fatorial que apresentou cinco fatores para stress no trabalho e quatro fatores de saúde organizacional. Através de uma análise de correlação, confirmou-se a multidimensionalidade desses construtos. Dados esses resultados, para verificar a influência da percepção de saúde organizacional sobre o stress ocupacional, realizou-se uma análise de regressão e foram encontrados cinco modelos válidos que atendem aos pressupostos necessários. Entretanto, esses modelos tiveram baixo poder de explicação, indicando que os fatores de stress ocupacional não são suficientes para explicar a saúde organizacional, devendo ser investigados outros aspectos relativos ao ambiente laboral que interferem na percepção de stress no trabalho.

  1. Educação Permanente em Saúde no Brasil: educação ou gerenciamento permanente?

    Directory of Open Access Journals (Sweden)

    Cristiane Lopes Simão Lemos

    2016-03-01

    Full Text Available Resumo O objetivo do estudo foi analisar a concepção e os fundamentos da Educação Permanente em Saúde (EPS constante da Política Nacional de Educação Permanente em Saúde (PNEPS no Brasil. A metodologia baseou-se na análise de documentos do Ministério da Saúde e de artigos científicos relacionados. Constatou-se que a concepção da EPS na PNEPS transcende um significado pedagógico, respondendo a um processo de reestruturação dos serviços diante das novas demandas do modelo. Justamente no momento em que o trabalho se encontra cada vez mais instável e precarizado, o Ministério da Saúde apresenta um discurso sobre uma gestão inovadora, dando centralidade à questão da EPS. A ideia não é de educação permanente, mas de gerenciamento permanente. Ao contrário de um instrumento de transformação radical, a EPS converte-se em uma ideologia que seduz pela sua aparência de novidade pedagógica.

  2. Promoção de Saúde e a Funcionalidade Humana

    Directory of Open Access Journals (Sweden)

    Ana Cristhina de Oliveira Brasil

    2013-03-01

    Full Text Available Para a elaboração de políticas públicas de saúde no Brasil, dois aspectos devem ser levados em consideração, a saber, a transição demográfica e a transição epidemiológica. Cada vez mais, observa-se um aumento no número de pessoas idosas convivendo com inúmeras incapacidades e, ainda, um perfil epidemiológico. A Pesquisa Nacional por Amostra de Domicílios (PNAD 1998-2003 indica uma distribuição de doenças crônicas que, consequentemente, tem gerado um número expressivo de incapacidades. Essas pessoas com incapacidades necessitam dos serviços de saúde, e os utilizam quando conseguem ter acesso a eles. Contudo, os modelos vigentes de atenção à saúde do idoso ou à saúde das pessoas com deficiência são de alto custo e, em alguns aspectos, não se apresentam eficientes, demandando estratégias de prevenção e equipamentos de saúde destinados à manutenção ou recuperação da saúde de uma população mais envelhecida. Desse modo, a agenda de política pública do Brasil deveria priorizar a manutenção da funcionalidade dos idosos, com monitoramento das condições de saúde, ações preventivas específicas de saúde e educação, e cuidados buscando uma atenção multidimensional e integral, não necessariamente centrada na doença(1.A necessidade de se elaborar políticas e estratégias, em especial de promoção de saúde, com um olhar descentralizado da doença se justifica porque os problemas de saúde advêm não somente de doenças, mas de qualquer outra condição ou circunstância de saúde, tais como agravos, gravidez, envelhecimento, estresse, predisposição genética – todas classificadas pela CID-10, contudo, sem poder mensurar as mudanças de estado relativas à condição de saúde, e muito menos classificar para descrever o contexto em que esses problemas acontecem, o que dificulta e compromete o planejamento e a resolubilidade das ações e dos serviços em saúde, diferentemente dos dados por

  3. As novas tecnologias da informação e o consumismo em saúde

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Vasconcellos-Silva

    2010-08-01

    Full Text Available Uma ampliação dos conceitos de consumo tem se deslocado na direção de processos sociais até agora não contemplados por categorias tradicionais. A presente revisão analisa a aplicação dos conceitos clássicos sobre consumismo às práticas recentemente identificadas no campo da saúde, como o fenômeno da cibercondria. O desafio teórico se refere à dificuldade de extrapolação das perspectivas econômicas do consumismo às questões do auto-cuidado no contexto das tecnologias de informação e comunicação (TICs. Procura-se compreender o fenômeno da mercadorização do cuidar-de-si sob o imperativo da auto-responsabilização em saúde. São identificadas e descritas as novas identidades consumidoras em vista das inauditas questões acerca dos aprimoramentos técnicos a modificar a natureza do auto-cuidado. Conclui-se que a saúde é consumida como vitalidade decomposta em artefatos de comercializar no contexto de uma nova bioeconomia - não mais ligada à idéia de emulação e posse, e sim a novas formas de perceber-se e cuidar-se perante múltiplos riscos e novas definições do que é ser humano.

  4. As novas tecnologias da informação e o consumismo em saúde

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Vasconcellos-Silva

    2010-08-01

    Full Text Available Uma ampliação dos conceitos de consumo tem se deslocado na direção de processos sociais até agora não contemplados por categorias tradicionais. A presente revisão analisa a aplicação dos conceitos clássicos sobre consumismo às práticas recentemente identificadas no campo da saúde, como o fenômeno da cibercondria. O desafio teórico se refere à dificuldade de extrapolação das perspectivas econômicas do consumismo às questões do auto-cuidado no contexto das tecnologias de informação e comunicação (TICs. Procura-se compreender o fenômeno da mercadorização do cuidar-de-si sob o imperativo da auto-responsabilização em saúde. São identificadas e descritas as novas identidades consumidoras em vista das inauditas questões acerca dos aprimoramentos técnicos a modificar a natureza do auto-cuidado. Conclui-se que a saúde é consumida como vitalidade decomposta em artefatos de comercializar no contexto de uma nova bioeconomia - não mais ligada à idéia de emulação e posse, e sim a novas formas de perceber-se e cuidar-se perante múltiplos riscos e novas definições do que é ser humano.

  5. Atos & autores: o lúdico na educação em saúde

    Directory of Open Access Journals (Sweden)

    Eduardo Gomes de Araújo

    1996-09-01

    Full Text Available Uma das formas que o capitalismo encontrou para perpetuar sua ideologia foi fazer da instituição escolar seu aparelho ideológico. Neste espaço disciplinado, não raramente se opõem educadores e educandos, e a prática pedagógica é imputada através de esquemas preestabelecidos e alienantes. Na esfera da saúde, este esquema se repete, pois as concepções de saúde/doença dos profissionais de saúde apontam a população como subordinados e transmitem a educação para a saúde calcada em conselhos e normas para os indivíduos, num processo de culpabilidade por suas doenças. Pretendemos neste trabalho relatar nossa experiência com o Psicodrama Pedagógico de ROMANÃ (1987 no levantamento de demandas referentes a informações sobre Primeiros Socorros entre adolescentes matriculados no Curso de Patrulheirismo da Rocinha(R.J., onde os dados levantados, no ano de 1995, foram sujeitos a uma análise qualitativa do discurso. No decorrer da experiência, percebemos que a utilização de uma metodologia que não exclui o contexto social dos sujeitos da aprendizagem, contribui para que esses compreendam seu papel e compromisso com a transformação individual e coletiva. Esperamos contribuir com a Enfermagem, mostrando possibilidades pedagógicas, humanizantes e criativas para a Educação em saúde.

  6. A judicialização da saúde: breves comentários

    Directory of Open Access Journals (Sweden)

    Sephora Luyza Marchesini Stival

    2016-05-01

    Full Text Available O artigo tem como escopo apresentar a judicialização da saúde, tema que vem tomando espaço nas discussões doutrinárias e jurisprudenciais, onde indivíduos que necessitam de remédios ou tratamentos (simples ou de alto valor, recorrem ao judiciário para terem a concretização do seu direito à saúde. Os magistrados nessas demandas comumente colocam a questão da saúde, como sinônimo de vida, acima de qualquer outra questão, condenando com frequência ao fornecimento de tratamentos/medicamentos, mesmo quando não há a real comprovação dessa necessidade, nem mesmo atentando-se para o dano causado ao coletivo, ao obrigar o Poder Público a gastar uma grande quantia com um só individuo, que já se encontra debilitado. Ocorre que a concessão nessas demandas individuais leva à desarticulação das políticas públicas voltadas para saúde, as quais são propostas e aprovadas pelos Poderes Legislativo e Executivo, valorizando o direito de poucos – os que têm acesso ao judiciário – em detrimento da maioria. Por ser um direito social, o direito à saúde depende das escolhas políticas feitas pelos entes políticos, tendo a sua limitação por questões financeiras ou mesmo técnicas, não cabendo ao Judiciário fazer essas escolhas, nem mesmo impor aos outros Poderes tal fornecimento.

  7. Genome Sequence of Herpes Simplex Virus 1 Strain SC16

    Science.gov (United States)

    Rastrojo, Alberto; López-Muñoz, Alberto Domingo

    2017-01-01

    ABSTRACT Herpes simplex virus 1 (HSV-1), also known as Human herpesvirus 1, is a highly prevalent human neurotropic pathogen that causes a variety of diseases, including lethal encephalitis. Here, we report the genome sequence of the HSV-1 strain SC16. PMID:28126930

  8. Calibration of the DLP-SC-3300-02 probe

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report douments the calibration measurement of the DLP-SC-3300-02 dual-linearly polarized near-field probe. The measurement comprises radiation pattern, diretivity, gain, spetra of spherial wave coefients, polarization charateristis, and complex channel balance at 41 frequencies, as well...

  9. Programmable SC biquad using one single capacitor bank

    OpenAIRE

    Torralba Silgado, Antonio Jesús; Pérez Vega-Leal, Alfredo; García Franquelo, Leopoldo

    2001-01-01

    This paper presents a new technique for programming SC circuits using a single time-multiplexed capacitor bank, achieving a significant reduction in capacitance area. Simulation results of a programmable biquad low pass filter show the validity of the proposed method.

  10. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.

    2005-01-01

    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  11. 78 FR 20369 - South Carolina Disaster #SC-00021

    Science.gov (United States)

    2013-04-04

    ... ADMINISTRATION South Carolina Disaster SC-00021 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of South Carolina dated 03/29/2013. Incident: Windsor Green Condo Complex Fire. Incident Period: 03/16/2013....

  12. 77 FR 14700 - Safety Zones; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-03-13

    ... notice regarding our public dockets in the January 17, 2008, issue of the Federal Register (73 FR 3316... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zones; Swim Around Charleston, Charleston, SC... establish temporary moving safety zones during the Swim Around Charleston, a swimming race occurring on...

  13. 76 FR 38586 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2011-07-01

    ... Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public meeting. But you may... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... establish a temporary moving safety zone during the Swim Around Charleston, a swimming race occurring...

  14. 78 FR 54583 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2013-09-05

    ..., telephone 202-366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston, SC... temporary moving safety zone during the Swim Around Charleston, a swimming race occurring on waters of...

  15. 77 FR 51471 - Safety Zone; Swim Around Charleston, Charleston, SC

    Science.gov (United States)

    2012-08-24

    ... rulemaking (NPRM) entitled Safety Zone; Swim Around Charleston, Charleston, SC in the Federal Register (77 FR...: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Swim Around Charleston, Charleston,...

  16. South Carolina's SC LENDS: Optimizing Libraries, Transforming Lending

    Science.gov (United States)

    Hamby, Rogan; McBride, Ray; Lundberg, Maria

    2011-01-01

    Since SC LENDS started operating in June 2009, more public libraries have come on board. All of this on the back end connects to a Mozilla-based staff client that has distributions for Mac OS X and Microsoft Windows, using SSL encryption to keep communications secure and private between remote libraries and the servers hosted at a high-end…

  17. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The catalogue contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  18. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  19. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    This catalogue contains a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering....

  20. M.Sc. in Civil and Structural Engineering

    DEFF Research Database (Denmark)

    Clausen, Johan

    The report contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short candidate projects as well as regular 3rd semester...... projects at the M.Sc. programme in Civil and Structural Engineering....

  1. 44gSc from metal calcium targets for PET

    DEFF Research Database (Denmark)

    Severin, Gregory; Gagnon, K.; Engle, J. W.

    2012-01-01

    A low-cost and efficient method for producing pre-clinical scale quantities of 44gSc is presented. Production involves proton irradiation of natural unenriched calcium metal followed by rapid separation of radioscandium from the target using hydroxmate functionalized resin.© 2012 American Institu...

  2. O PET-Saúde da Família e a formação de profissionais da saúde: a percepção de estudantes

    Directory of Open Access Journals (Sweden)

    Luciana Margarida de Santana Madruga

    2015-12-01

    Full Text Available Trata-se de estudo com abordagem qualitativa, cujo objetivo foi analisar a contribuição do Programa de Educação pelo Trabalho para a Saúde (PET– Saúde da Família para a formação dos futuros profissionais de saúde de uma universidade pública do Nordeste do Brasil. Foram utilizados dados secundários do instrumento de avaliação semestral do programa, respondido por 67 estudantes dos cursos de: Educação Física, Enfermagem, Fisioterapia, Medicina, Nutrição e Odontologia. Os resultados foram sistematizados em duas categorias de análise: o trabalho interprofissional e a integração ensino-serviço. O estudo evidenciou: a importância do trabalho interprofissional e colaborativo, a integração ensino-serviço-comunidade, e a reflexão das práticas impulsionadas pelo PET-Saúde da Família para a mudança no processo formativo em saúde. Estratégias como essa são essenciais para a formação e o aperfeiçoamento de profissionais para o Sistema Único de Saúde (SUS.

  3. Detección daño estructural empleando el vector de fuerza residual modificado y el algoritmo Simulated Annealing (SA Damage Detection Using the Modified Residual Force Vector and the Simulated Annealing Algorithm (SA

    Directory of Open Access Journals (Sweden)

    Óscar Begambre

    2010-01-01

    Full Text Available En este trabajo, el algoritmo Simulated Annealing (SA es empleado para solucionar el problema inverso de detección de daño en vigas usando información modal contaminada con ruido. La formulación de la función objetivo para el procedimiento de optimización, basado en el SA, está fundamentada en el método de la fuerza residual modificada. El desempeño del SA empleado en este estudio superó el de un algoritmo genético (AG en dos funciones de prueba reportadas en la literatura internacional. El procedimiento de evaluación de integridad aquí propuesto se confirmó y validó numéricamente empleando la teoría de vigas de Euler-Bernoulli y un Modelo de Elementos Finitos (MEF de vigas en voladizo y apoyadas libremente.In this research, the Simulated Annealing Algorithm (SA is employed to solve damage detection problems in beam type structures using noisy polluted modal data. The formulation of the objective function for the SA optimization procedure is based on the modified residual force method. The SA used in this research performs better than the Genetic Algorithm (GA in two difficult benchmark functions. The proposed structural damage-identification scheme is confirmed and assessed using a Finite Element Model (FEM of cantilever and a free-free Euler-Bernoulli beam model

  4. Uma análise crítica da abordagem dos Determinantes Sociais da Saúde a partir da medicina social e saúde coletiva latino-americana

    Directory of Open Access Journals (Sweden)

    Elis Borde

    Full Text Available O enfoque dos Determinantes Sociais da Saúde tem tido ampla difusão e foi aparentemente bem acolhido globalmente. Este artigo assume uma visão crítica desse enfoque, buscando sistematizar as críticas principalmente provenientes de debates no interior da medicina social e saúde coletiva latino-americana, que se articularam ao redor da diferenciação entre Determinantes Sociais da Saúde e a determinação social dos processos saúde-doença. Pretendemos examinar estas diferenças para problematizar a aparente unanimidade retórica em prol da equidade. Ainda que a abordagem dos Determinantes Sociais da Saúde marque um enorme avanço na mobilização pela equidade em saúde, em nossa avaliação ela não consegue ser mais do que um avanço incompleto.

  5. Proposta de metodologia para selecionar indicadores de desigualdade em saúde visando definir prioridades de políticas públicas no Brasil

    Directory of Open Access Journals (Sweden)

    Drachler Maria de Lourdes

    2003-01-01

    Full Text Available Promover a saúde com eqüidade é um grande desafio para os gestores públicos. A magnitude das desigualdades sociais em saúde e os recursos escassos impõem que as prioridades para a gestão pública se fundamentem no conhecimento da situação de saúde e do impacto de políticas, programas, projetos e ações sobre a saúde e seus determinantes. Este artigo apresenta a proposta metodológica de construção e seleção de indicadores de desigualdades em saúde utilizada pela Pesquisa Avaliativa de Desigualdades em Saúde no Rio Grande do Sul (PADS-RS para auxiliar a definição de prioridades para a gestão pública. Os indicadores foram construídos visando avaliar desigualdades em saúde como diferenças na qualidade de vida e capacidades humanas socialmente determinadas. A metodologia baseia-se em princípios de promoção ativa da eqüidade que orientam (1 o Sistema Único de Saúde Brasileiro, (2 as pesquisas avaliativas de desigualdades em saúde realizadas no Reino Unido e (3 o método RAWP (Resources Allocation Working Party de alocação de recursos financeiros públicos em saúde entre regiões e considera as peculiaridades dos sistemas oficiais de informação no Estado e no Brasil.

  6. Caminhada e gastos com saúde em adultos usuários do sistema público de saúde brasileiro: estudo transversal retrospectivo

    Directory of Open Access Journals (Sweden)

    Bruna Camilo Turi

    2015-11-01

    Full Text Available A inatividade física é um dos maiores desafios à saúde pública devido à sua associação com doenças crônicas e ao impacto econômico sobre o sistema público de saúde. Entretanto, a prática de caminhada pode auxiliar a amenizar esses problemas. Objetivo Verificar se existem associações entre prática de caminhada no lazer, presença de fatores de risco e gastos relacionados ao uso de serviços de saúde em usuários do sistema público de saúde brasileiro. Metodologia A amostra foi composta por 963 adultos. A prática de caminhada foi avaliada a partir de questionário de Baecke. Gasto com tratamento/ano foi avaliado pela demanda por serviços registrados nos prontuários clínicos. Resultados Prática de caminhada como atividade física de lazer foi referida por 64,4% dos participantes. Os grupos de maior prática de caminhada apresentaram menores valores para idade, IMC, CC e gastos com medicamentos. Indivíduos inseridos na categoria de maior envolvimento apresentaram 41% menos chances de estarem inserido no grupo de maior gasto total (OR=0.59; IC95% 0.39-0.89. Conclusão Verificou-se que a prática de caminhada como atividade física de lazer foi a mais frequente para a maioria dos usuários do SUS, a qual foi associada a menores gastos com medicamentos e no total.

  7. A promoção da saúde no ensino profissional: desafios na Saúde e a necessidade de alcançar outros setores

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Lobato Tavares

    2016-06-01

    Full Text Available Resumo O artigo discute a natureza dinâmica e complexa da promoção da saúde, o que requer formação profissional que facilite formular e colocar em prática seus princípios teóricos e metodológicos mediante contínua reflexão sobre as contradições dos contextos e a necessidade de enfrentamento dos desafios e expectativas das comunidades nos territórios. Considera também outro desafio que se coloca no trabalho em saúde, que é a mediação/ação intersetorial para implementação do seu conceito ampliado. Assim, demanda uma formação baseada em competências, o que significa um conjunto de atitudes e saberes para viabilizar a capacidade de agir em determinada situação. Apresenta duas experiências de ensino desenvolvidas no Brasil que tem contribuído na formação profissional em saúde, na perspectiva da promoção: a do Programa de Pós-graduação stricto sensu, em Promoção de Saúde da Universidade de Franca e a do Programa de Pós-graduação lato sensu da ENSP/Fiocruz. Em ambas, o uso de metodologias problematizadoras instrumentalizam a construção de capacidades, possibilitando que a teoria se aproxime da prática e proporcione uma formação crítica e reflexiva com rigor científico e relevância temática.

  8. Intervenções Psicossociais para Promoção da Saúde do Homem em Unidade de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Silva Souza

    Full Text Available Este relato de experiência profissional busca contribuir a responder a questão: Como promover a saúde do homem na Atenção Primária à Saúde? São descritas duas estratégias implantadas em uma Unidade de Saúde da Família de Vitória, ES, as "Ações de Sábado" e o "Grupo de Homens". Cada "Ação de Sábado" é realizada trimestralmente, em um sábado pela manhã, com duração de quatro horas, contando com atividades recreativas e de educação em saúde (discussões sobre doenças sexualmente transmissíveis, por exemplo. O "Grupo de Homens" é realizado semanalmente, com duração de 1h15min, com exposições dialogadas (sobre problemas com o álcool, por exemplo e com oficinas terapêuticas. No período de setembro de 2011 a julho de 2013, as intervenções envolveram cerca de 230 homens de classe popular. Os conceitos de clínica ampliada e atitude psicoterapêutica são utilizados para promover a expressão dos usuários e a corresponsabilização com o processo saúde-doença. Dentre os resultados, destacam-se: o aumento da presença masculina na USF, a melhoria do cuidado dirigido a condições crônicas (especialmente hipertensão, diabetes e problemas com o álcool/alcoolismo e o fortalecimento de comportamentos de redução de danos. Conclui-se que as intervenções são proveitosas para abordar desafios relativos à Saúde do Homem.

  9. Da noção de determinação social à de determinantes sociais da saúde

    Directory of Open Access Journals (Sweden)

    Júlia Arêas Garbois

    Full Text Available RESUMO O ensaio aborda criticamente a noção de determinantes sociais da saúde, veiculada oficialmente pela Organização Mundial da Saúde, a partir da discussão sobre sua perspectiva conceitual que difere bastante daquela cunhada por volta dos anos 1970, pela corrente médico-social latino-americana, de determinação social da saúde. A discussão desnuda os preceitos filosóficos que sustentam a noção de determinantes sociais da saúde, a partir dos argumentos fundados na sociologia positivista de Émile Durkheim. Conclui-se que essa noção identifica um 'social' fragmentado, trazendo consequências práticas e políticas e mostrando-se insuficiente para analisar as mudanças sociais da contemporaneidade.

  10. Profissionais de saúde e o aborto: o dito e o não dito em uma capacitação profissional em saúde

    Directory of Open Access Journals (Sweden)

    Adriana Lemos

    2014-04-01

    Full Text Available O estudo objetivou analisar a visão de profissionais de saúde sobre aborto e sua relação com a prática profissional. Essas profissionais participaram de um curso do Programa de Atenção Integral à Saúde da Mulher/Contracepção. Trata-se de estudo descritivo, com abordagem qualitativa e etnográfica, utilizando observação participante, aplicação de questionários e entrevistas com 11 profissionais de saúde. O tema aborto foi abordado, no curso, de forma problematizadora e dialogal, como um problema de saúde pública. De forma geral, o discurso predominante durante o módulo teórico do curso foi pelo posicionamento contrário à prática do aborto via argumentos de natureza religiosa. Entretanto, este posicionamento se relativizou no momento das entrevistas. Ainda que parcialmente, o curso propiciou ao grupo um processo de reflexão sobre sua prática profissional, fator importante para os que estão envolvidos em capacitação de profissionais da saúde.

  11. Origins of non-stoichiometry in compounds: vacancy-ordering in ScS

    Science.gov (United States)

    Hart, Gus L. W.; Zunger, Alex

    2001-03-01

    While most stable compounds have fixed Daltonian ratios of their constituents (e.g., 1:1 ratio in ZnS, NaCl, GaAs), some materials exhibit significant nonstoichiometry even at low temperatures. Examples include some NaCl-structure transition-metal monochalcogenides such as HfS, ZrSe, and YS. The prototype system ScS exhibits this peculiar property of preferring the presence of vacancies (up to 30%) over a purely stoichiometric structure. Moreover, these vacancies order spatially in unusual structures. We consider Sc_1-xBox _xS as a binary alloy (where Box denotes a vacancy) and express the energy E_MBCE(σ) of any of the 2^N configurations σ in a ``mixed-basis cluster expansion'' (MBCE) obtained from ab initio calculations of ~ 30 ordered structures. A ground state search of all possible configurations reveals that indeed an ordered array of vacancies has the lowest energy. We show systematic features in the electronic structure that help explain the preference for vacancies.

  12. Effect of Sc on Precipitation Hardening of AlSi6Mg Alloy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The effect of Sc on precipitation hardening of AlSi6Mg was studied. Zr was previously reported that it increased the effectiveness of Sc in wrought aluminum in many areas so Zr was also used together with Sc in this study.Different levels of Sc and Zr additions were added to AlSi6Mg before casting in the permanent mold. The samples were precipitation hardened at different aging temperatures and for various aging time before testing for tensile strength and hardness. It was found that Sc addition into Al6SiMg can change its response to age hardening. Additions of Sc and Sc with Zr increased both yield strength and hardness for both aging temperatures. In addition, Sc was found to modify eutectic Si to obtain fibrous morphology. This effect of Sc on eutectic silicon modification has never been reported before.

  13. A agência nacional de saúde suplementar - ANS: onze anos de regulação dos planos de saúde

    Directory of Open Access Journals (Sweden)

    Rachel Torres Salvatori

    2012-09-01

    Full Text Available Trata-se de um trabalho com objetivo de apresentar os principais resultados alcançados pela regulação dos planos de saúde exercida pela Agência Nacional de Saúde Suplementar, autarquia instituída para promover o equilíbrio das relações entre operadoras e consumidores, tornando o mercado de planos de saúde mais efi ciente. Como avanços mais significativos oriundos da regulação do setor podem ser citados: as barreiras à entrada e à saída das operadoras no mercado, a ampliação das coberturas assistenciais contratuais, o monitoramento e o controle dos reajustes, a indução a práticas de promoção da saúde e à qualifi cação do setor, e a possibilidade da portabilidade de carências. Como desafios a serem enfrentados, podem ser apontados: o monitoramento da qualidade da assistência prestada, a renúncia fiscal, a existência dos cartões de desconto, a operação de empresas como operadoras de planos de saúde sem o registro na ANS e a adoção de alguns mecanismos nocivos de regulação assistencial pelas operadoras de planos de saúde. ----- The National Agency of Supplementary Health – ANS: eleven years in regulating health insurance plans ----- ABSTRACT ----- This study aims to present the main results achieved in the regulation of health insurance plans through the National Agency of Supplementary Health, an agency set up to promote a balance in the relationship between health insurance plans and their consumers, making the health insurance market more efficient. As examples of the important progress achieved in regulating the sector, the authors emphasize: greater control of the infl ow and outfl ow of service operators in the market; the widening of contractual coverage; monitoring and control of readjustments; encouragement of health promotion practices and increased training in the sector; grace period flexibility. Examples of regulatory gaps however, include: problems monitoring the quality of the care provided

  14. Role of cell death in the propagation of PrP(Sc) in immune cells.

    Science.gov (United States)

    Takahashi, Kenichi; Inoshima, Yasuo; Ishiguro, Naotaka

    2015-03-01

    A number of studies have suggested that macrophages, dendritic cells, and follicular dendritic cells play an important role in the propagation of PrP(Sc). Both accumulation and proteolysis of PrP(Sc) have been demonstrated in peripheral macrophages. Macrophages may act as reservoirs for PrP(Sc) particles if the cells die during transient PrP(Sc) propagation. However, whether cell death plays a role in PrP(Sc) propagation in macrophages remains unclear. In this study, we investigated the possibility of propagation and transmission of PrP(Sc) between dead immune cells and living neural cells. We found that under specific conditions, transient PrP(Sc) propagation occurs in dead cells, indicating that interaction between PrP(C) and PrP(Sc) on plasma membrane lipid rafts might be important for PrP(Sc) propagation. Co-culturing of killed donor PrP(Sc)-infected macrophages with recipient N2a-3 neuroblastoma cells accelerated PrP(Sc) transmission. Our results suggest that cell death may play an important role in PrP(Sc) propagation, whereas transient PrP(Sc) propagation in macrophages has little effect on PrP(Sc) transmission.

  15. Sociodrama com estudantes de enfermagem de saúde pública

    OpenAIRE

    Maria Helena Pessini de Oliveira; Edna Paciência; Flávio Fortes D'Andréa

    1984-01-01

    O presente estudo expõe uma experiência com um grupo de estudantes do quarto ano de enfermagem, Habilitação em Saúde de Ribeirão Preto Pública da Escola USP, no qual por meio da técnica do sociodrama, procurou-se identificar as necessidades e conflitos mais freqüentes vivenciados por este grupo. Foram realizados dois grupos: grupo experimental (sociodrama) e grupo controle (verbal). Como resultado constatou-se er o sociodrama uma técnica facilitadora da expressão de emoções suprimidas ou reca...

  16. Contributos para o desenho da história das tecnologias da saúde

    OpenAIRE

    Lobato, João

    2006-01-01

    A História, quando entendida como uma malha atravessada de factos e momentos, na procura incessante de explicações e de quadros de referência de identidade cultural, torna-se num desafio aliciante e mesmo numa aventura. Aventura, de facto, quando se depara, ainda, com uma ausência total de um modelo sistematizador que nos facilite a busca e a interpretação dos factos e dos momentos que possam desvendar a história das profissões das tecnologias da saúde, como hoje são designadas.

  17. Plan de mercadeo para el ramo de riesgos laborales en JuanSa Seguros

    OpenAIRE

    Jiménez Pizarro, Andrés Felipe; Tamayo Sandoval, Juan Carlos

    2016-01-01

    En este plan de mercadeo se realiza un análisis de la situación actual de la empresa JuanSa Seguros con alcance específico en el producto de riesgos laborales en el mercado corporativo del Valle del Cauca. Este análisis incorpora variables como los clientes, las capacidades actuales de la empresa, la competencia, los colaboradores y el contexto; a continuación se estudia el mercado con la información disponible por la empresa llegando a un segmento objetivo de 170 empresas.

  18. Graduação em Saúde Coletiva: notas para reflexões

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Elias

    2003-08-01

    Full Text Available O trabalho sintetiza a participação do autor em mesa redonda do V Congresso da Rede Unida. Trata do tema emergente sobre graduação em Saúde Coletiva, apresentando como pressuposto sua interdisciplinaridade como área e ressaltando a necessidade de que iniciativas nesse sentido não se restrinjam ao aparelho formador, mas vinculem-se às possibilidades abertas pelo mercado de trabalho por meio do diálogo com gestores de serviços, principalmente do âmbito municipal.

  19. Saúde bucal coletiva: caminhos da odontologia sanitária à bucalidade

    OpenAIRE

    Narvai Paulo Capel

    2006-01-01

    O ensaio aborda o surgimento das primeiras atividades odontológicas sob responsabilidade do poder público no Brasil e sua evolução no século XX, enfatizando a emergência do marco referencial denominado odontologia sanitária. Caracteriza, sumariamente, a odontologia social e preventiva e a odontologia de mercado, indicando as principais publicações que se ocuparam dessas correntes. As características essenciais da saúde bucal coletiva e da bucalidade são apresentadas, tecendo-se considerações ...

  20. Reporte financiero Burkenroad / Latinoamérica – Colombia / Carvajal Empaques S.A.

    OpenAIRE

    Trujillo Aristizábal, Paula

    2016-01-01

    De acuerdo con los resultados obtenidos en la valoración, la recomendación es comprar la acción de Carvajal Empaques S.A., ya que se espera que se valorice en un 16.68% a diciembre 31 de 2016, debido a la progresiva recuperación del flujo de caja después de grandes inversiones hechas en años anteriores para la ampliación de su capacidad instalada, permitiéndoles crecer y suplir la demanda ascendente del mercado de food service, dejando ver también el impacto de las eficiencias operacionales b...

  1. Control Presupuestario de Ventas del departamento de CSA de la empresa KONEKFACE, S.A.

    OpenAIRE

    Álvarez Wilmanski, Carlos

    2005-01-01

    La Dirección de la empresa KONEKFACE, S.A., fabricante de componentes eléctricos y electrónicos para conexionado, decidió hace dos años montar un departamento para suministrar productos considerados “no standart”. Dicha decisión fue tomada por la dirección de la empresa ya que se observó que los clientes eran cada vez más exigentes y demandaban cada vez más flexibilidad a sus productos. Se creó así el departamento de CSA (Customer Specific Assemblies), cuyas siglas significan M...

  2. Burocracia e inserção social: um estudo sobre o Ministério da Saúde na gestão do Sistema Único de Saúde (SUS

    Directory of Open Access Journals (Sweden)

    Luciana Assis Costa

    2013-12-01

    Full Text Available Embora o Sistema Único de Saúde (SUS seja implementado de forma descentralizada, com forte ênfase municipalista, o papel de formulação e coordenação nacional da política de saúde se mantém sob a responsabilidade do Ministério da Saúde, o que demonstra a importância da esfera federal na condução e indução dessa política. Este artigo é uma pesquisa qualitativa, na qual as técnicas de coleta de dados foram entrevistas semiestruturadas e análise documental. O objetivo foi analisar a estrutura do aparato estatal responsável pela formulação e coordenação da política de saúde brasileira após a década de 1990, a partir da configuração da burocracia do Ministério da Saúde (MS e as conexões do órgão com as forças societárias do setor. A perspectiva teórica de análise foi o institucionalismo sociológico, apoiado no modelo de autonomia inserida de Peter Evans (1995, somado ao conceito de isomorfismo de DiMaggio & Powell (1983. Os resultados demonstram que a gestão federal do SUS se encontra distante de um modelo tipo ideal weberiano e os avanços da política de saúde podem, parcialmente, ser explicados pela disseminação de uma forte cultura sanitarista que atuou de forma a compensar a ausência de elementos típicos das burocracias tradicionais na condução da política de saúde.

  3. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  4. Erbium-doped fiber laser passively mode locked with few-layer WSe2/MoSe2 nanosheets.

    Science.gov (United States)

    Mao, Dong; She, Xiaoyang; Du, Bobo; Yang, Dexing; Zhang, Wending; Song, Kun; Cui, Xiaoqi; Jiang, Biqiang; Peng, Tao; Zhao, Jianlin

    2016-03-24

    Few-layer transition-metal dichalcogenide WSe2/MoSe2 nanosheets are fabricated by a liquid exfoliation technique using sodium deoxycholate bile salt as surfactant, and their nonlinear optical properties are investigated based on a balanced twin-detector measurement scheme. It is demonstrated that both types of nanosheets exhibit nonlinear saturable absorption properties at the wavelength of 1.55 μm. By depositing the nanosheets on side polished fiber (SPF) or mixing the nanosheets with polyvinyl alcohol (PVA) solution, SPF-WSe2 saturable absorber (SA), SPF-MoSe2 SA, PVA-WSe2 SA, and PVA-MoSe2 SA are successfully fabricated and further tested in erbium-doped fiber lasers. The SPF-based SA is capable of operating at the high pump regime without damage, and a train of 3252.65 MHz harmonically mode-locked pulses are obtained based on the SPF-WSe2 SA. Soliton mode locking operations are also achieved in the fiber laser separately with other three types of SAs, confirming that the WSe2 and MoSe2 nanosheets could act as cost-effective high-power SAs for ultrafast optics.

  5. Conhecimento e fonte de informações de pessoas surdas sobre saúde e doença

    Directory of Open Access Journals (Sweden)

    Yanik Carla Araújo de Oliveira

    2015-09-01

    Full Text Available Objetivou-se compreender o conhecimento de pessoas surdas em saúde e doença e suas fontes de informações em um estudo descritivo, com abordagem qualitativa, realizado em uma instituição pública de referência, no estado da Paraíba, em atendimento a pessoas com deficiência. Foram realizadas entrevistas individualmente, em língua de sinais, com 11 pessoas surdas escolhidas pelo método de saturação do conteúdo das falas. Os dados foram analisados segundo a análise de conteúdo. Das falas, emergiram as categorias: processo saúde-doença e fontes de informações de saúde. Os surdos entrevistados nesse estudo apresentaram um conhecimento limitado sobre o processo saúde-doença. Os sujeitos valorizam o médico como imprescindível para o processo saúde-doença. Alguns surdos expuseram não conhecer sobre saúde, devido a fontes precárias e pouco eficientes, disponibilizando informações primárias, sem profundidade de conteúdos, e, por isso, reivindicam mais oportunidades.

  6. Rede social de apoio ao desenvolvimento infantil segundo a equipe de saúde da família

    Directory of Open Access Journals (Sweden)

    Ana Paula Dezoti

    2013-09-01

    Full Text Available O objetivo deste estudo foi identificar as redes sociais de apoio às famílias para a promoção do desenvolvimento infantil na perspectiva da equipe Estratégia Saúde da Família. MÉTODOS: Pesquisa qualitativa descritiva. Foram sujeitos doze profissionais de saúde, sendo três de cada categoria profissional: enfermeiro, médico, auxiliar de enfermagem e agente comunitário de saúde que atuam nas unidades de saúde do estudo. Os dados foram coletados por meio de entrevista semiestruturada e analisados segundo análise categorial temática. RESULTADOS: Os resultados evidenciaram três categorias empíricas: Elementos da rede social de apoio; Funções de apoio às famílias; Dificuldades e lacunas na rede social de apoio às famílias. CONCLUSÃO: Considera-se que as redes sociais têm importante papel na vinculação das famílias, fortalecendo seu potencial para o desenvolvimento infantil saudável. Recomenda-se que os profissionais de saúde articulem ações que possam influenciar esses elementos de maneira que promovam o desenvolvimento infantil adequado.

  7. Saberes e práticas de adolescentes sobre saúde: implicações para o estilo de vida e cuidado de si

    Directory of Open Access Journals (Sweden)

    Zaira Andressa Alves de Sousa

    2014-09-01

    Full Text Available Objetivo: Descrever os saberes de adolescentes sobre a saúde e o que fazem para se manterem sadios e promoverem a própria saúde. Métodos: Pesquisa qualitativa, cujo referencial é a Teoria das Representações Sociais. Os sujeitos foram 21 adolescentes, captados pela técnica Bola de Neve. Realizaram-se entrevistas semiestruturadas e aplicou-se a análise de conteúdo temático. Resultados: Os resultados mostram que a saúde é entendida à luz de elementos do paradigma biomédico e da produção social da saúde e as práticas se alinham aos requisitos de cada um desses paradigmas. Conclusão: Conclui-se que os adolescentes têm conhecimentos sobre sua saúde e sobre os problemas que os maus hábitos podem acarretar, estando a questão ligada mais à cultura de tais práticas do que propriamente à informação.

  8. Ações em saúde mental às famílias nos diferentes contextos de trabalho: revisão integrativa

    OpenAIRE

    Marinês Aires; Cristine Moraes Roos; Ana Valéria Furquim Gonçalves; Jacó Fernando Schneider; Agnes Olschowsky

    2010-01-01

    Trata-se de uma revisão integrativa da literatura que objetivou identificar e analisar os estudos nos periódicos de enfermagem que focalizam as ações em Saúde Mental direcionadas às famílias. Para a coleta dos dados foram utilizados os descritores saúde mental, família e enfermagem, nas bases de dados da Literatura Latino-Americano e do Caribe em Ciências da Saúde (LILACS) e Scientific Electronic Library Online (SciELO). Os critérios de inclusão foram: artigos originais publicados em portuguê...

  9. A família, a visita domiciliária e a enfermagem: revisitando o processo de trabalho da enfermagem em saúde coletiva

    OpenAIRE

    2000-01-01

    Tomando a família como Objeto de atenção da enfermagem em saúde coletiva, as autoras discutem as questões conceituais subjacentes ao objeto e à visita domiciliária, contextualizadas no conjunto da produção em saúde no Brasil, destacando-se o Programa de Atenção à Família e a Teoria de Intervenção Práxica da Enfermagem em Saúde Coletiva.

  10. Geoprocessamento, ambiente e saúde: uma união possível?

    Directory of Open Access Journals (Sweden)

    Barcellos Christovam

    1996-01-01

    Full Text Available O uso do geoprocessamento tem permitido a reunião de bancos de dados sócio-econômicos, de saúde e ambientais em bases espaciais. A interpretação dos resultados de associações entre variáveis epidemiológicas e ambientais depende, no entanto, do desenho do sistema de geoprocessamento. A escolha da escala e objeto de análise precede a concepção do sistema, condicionando os possíveis resultados estatísticos e visuais. Esta escala deve ser compatível com o fenômeno que se pretende enfocar, buscando-se uma homogeneidade interna e heterogeneidade externa das unidades de análise escolhidas. A interdependência de processos espaciais, que se refletem na sua configuração social, ambiental e epidemiológica, pode, se não adotada metodologia correta, impedir o estabelecimento de causas para processos simultâneos. O geoprocessamento permite, por outro lado, o entendimento do contexto em que se verificam fatores determinantes de agravos à saúde.

  11. Uma experiência interdisciplinar de psicanalistas com profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Cecilia Luiza Montag Hirchzon

    2004-08-01

    Full Text Available Descreve-se a experiência de cinco grupos de reflexão interdisciplinar de profissionais da saúde sob a coordenação de duas psicanalistas. Os temas discutidos centralizaram-se basicamente sobre a relação paciente - profissional, com ênfase nos seus aspectos subjetivos. As discussões se deram, sobretudo, sobre a reflexão de situações clínicas intermediadas por concepções teóricas. O vínculo do profissional da saúde com seus pacientes, considerado um importante elemento terapêutico, na medida em que envolve conteúdos afetivos, foi objeto de um olhar psicanalítico, trazendo sua contribuição específica na compreensão da intersubjetividade. A variedade das diferentes categorias profissionais norteou a escolha dos participantes e revelou-se um importante fator de troca e mútuo reconhecimento, evidenciando a necessidade de interlocução com formas diversas de conhecimento do humano. A constituição grupal das reuniões, além de favorecer o intercâmbio das diferentes abordagens, possibilitou a identificação de muitos aspectos em comum, assim como propiciou um clima de acolhimento, no qual os profissionais puderam expor suas dificuldades e sentir-se cuidados.

  12. Desafios da atenção básica frente às iniquidades em saúde

    Directory of Open Access Journals (Sweden)

    Lisane Nery Freitas

    2017-02-01

    Full Text Available Desde a declaração de Alma-Ata, o Brasil vem formulando estratégias de reestruturação da assistência no intuito de garantir o acesso universal e equânime aos cuidados básicos de saúde. A implementação da Estratégia de Saúde da Família reconfigura e fortalece as redes locais de saúde, orientando a expansão da cobertura da Atenção Básica. A atuação dos profissionais e sua inserção na comunidade favorece a identificação de situações de iniquidade em saúde. O presente artigo relata a experiência vivenciada por residentes em uma unidade de Estratégia de Saúde da Família, no município de Porto Alegre. A situação da população caracteriza-se pelo conjunto de necessidades e problemas relativos à saúde, as respostas sociais e estruturais e o perfil fenomenológico que o torna aparente. A iniquidade percebida pode ser considerada uma desigualdade injusta, visto que se refere a diferenças desnecessárias e evitáveis. É fundamental a manutenção de uma rede de atenção regionalizada, articulada com base territorial que privilegie as especificidades de cada grupo populacional, juntamente com a pactuação de políticas públicas vigentes na perspectiva da continuidade das ações. A potencialidade do campo da saúde no combate às iniquidades está na intrínseca exigência de políticas e ações intersetoriais inclusivas.

  13. A perspectiva territorial da inovação em saúde: a necessidade de um novo enfoque

    Directory of Open Access Journals (Sweden)

    Laís Silveira Costa

    Full Text Available A inovação ganha um campo de estudo privilegiado na saúde, dado que esta é responsável por parcela importante do investimento nacional em pesquisa e desenvolvimento e possui uma base industrial e de serviços que articula tecnologias portadoras de futuro. Assim, estreita-se o relacionamento entre saúde e desenvolvimento também em função do protagonismo da saúde na geração de inovação. A despeito disso, persiste a fragilidade da base produtiva da saúde, prejudicando tanto a prestação universal de serviços em saúde quanto uma inserção competitiva internacional. Este artigo, que utiliza o arcabouço teórico da Economia Política e dos sistemas de inovação, teve como objetivo identificar variáveis em espaços subnacionais que influenciam a dinâmica de geração de inovação em saúde, a partir de uma abordagem teórica que considera que a inovação é um processo contextualizado e social. Parte do pressuposto de que a fragilidade da base produtiva em saúde persistirá se novas variáveis envolvidas na dinâmica de inovação não forem consideradas.

  14. Saúde bucal no Brasil Oral health in Brazil

    Directory of Open Access Journals (Sweden)

    Vitor Gomes Pinto

    1983-08-01

    Full Text Available Apresenta-se um retrato sobre a saúde bucal no Brasil, com ênfase em informações relativas à situação econômica e epidemiológica, prevenção da cárie dental, recursos humanos, montante de gastos financeiros e estrutura de prestação de serviços. O país mostra quadro típico de uma área em desenvolvimento, com elevada incidência de problemas, crescente oferta de cirurgiões-dentistas e difícil acesso aos serviços ofertados mormente face a barreiras de ordem econômica. Visando expandir cuidados odontológicos e reduzir a incidência dos principais problemas, propõe-se um programa de serviços básicos de âmbito nacional.The oral health situation in Brazil is described, with special emphasis on data relating to the economic and epidemiological situation, caries prevention, human resources, health expenditure and dental care structure. The country presents a picture typical of a developing area, with high disease rates, an increase in the offer of dentists and access to dental care hindered principally by economic barriers. A comprehensive program of basic services in odontology is proposed, with the objective of expanding dental care and reducing the incidence of more prevalent problems.

  15. AUTOMATIZACIÓN DE OFICINAS S.A.

    Directory of Open Access Journals (Sweden)

    Luis Carlos Diaz Osorio

    1998-01-01

    Full Text Available El caso muestra la situación de Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización de muebles y equipos para oficina. A principios de la década pasada, comenzó a comercializar microcomputadoras y elementos de conectividad de redes, manejando grandes márgenes por ser monopolio, aprovechando los beneficios de importación que le otorgaba el ser exportador de muebles. En el momento en que se abren las importaciones, más de doscientas empresas entran a competir en el mercado de los microcomputadores, llegando incluso a manejar márgenes de hasta el 10%. Las ventas de la empresa han bajado a niveles alarmantes, incluso se cree que únicamente compran empresas allegadas a los directivos o personas que no conocen nada del tema de los computadores. La situación puntual es la toma de decisión de las estrategias para ser competitivos o decidir salir del mercado de los PC. La orientación que hemos decidido darle al caso es “fijación de precios”.

  16. Effect of solution treatment on the aging processes of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S. (AN SSSR, Moscow. Inst. Metallurgii); Dutkiewicz, J.; Salawa, J. (Polish Academy of Sciences, Cracow. Inst. for Metal Research)

    1984-10-01

    The kinetics of aging process of two Al-Sc alloys containing 0.2 and 0.5 wt% Sc, respectively was investigated using electrical resistivity and hardness measurements. Transmission electron micrographs of quenched samples show Sc-rich precipitates, especially Al/sub 3/Sc precipitates. The addition of Sc to Al causes the strongest hardening effect during aging in relation to other alloying additions. Cast Al-Sc alloys and water quenched ones from solid solubility range show very similiar age-hardening curves.

  17. Novel red-emission of ternary ZnCdSe semiconductor nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Shu-Ru, E-mail: srchung@nfu.edu.tw [National Formosa University, Graduate Institute of Materials Science and Green Energy Engineering (China); Wang, Kuan-Wen [National Central University, Institute of Materials Science and Engineering (China); Chen, Hong-Shuo; Chen, Hong-Hong [National Formosa University, Graduate Institute of Materials Science and Green Energy Engineering (China)

    2015-02-15

    The effect of chain lengths of fatty acids on the physical properties of CdSe and ZnCdSe semiconductor nanocrystals (NCs) synthesized by the colloidal chemistry procedure is investigated. The fatty acids, lauric acid (LA), and stearic acid (SA), with different lengths of carbon chains, are used to prepare CdSe and ZnCdSe NCs when hexyldecylamine (HDA) is applied as the sole surfactant. For CdSe–SA and ZnCdSe–SA, they have the same emission wavelength at 592 nm and the same particle size of 3.3 nm; however, their quantum yield (QY) is 75 and 16 %, respectively. In contrast, the emission wavelength of CdSe–LA and ZnCdSe–LA NCs is 609 and 615 nm, the particle size is about 3.5 and 4 nm under the same reaction time, and the QY of them are 33 and 59 %, respectively. The X-ray diffraction pattern shows that ZnCdSe NCs all have the wurtzite structure, and their main peaks are located between those of pure CdSe and ZnSe materials. The main phase of ZnCdSe–SA and ZnCdSe–LA is ZnSe and CdSe, respectively, implying that alloyed ZnCdSe NC can be prepared and ZnSe and CdSe phase can be promoted by SA and LA, respectively. Moreover, the QY of red-emission ZnCdSe–LA is higher than 50 %. These results suggest that the growth rate of CdSe as well as ZnCdSe NC can be enhanced by using LA as complex reagent and HDA as sole surfactant. It is expected that the reported effective synthetic strategy can be developed as a very practical, easy and not time-consuming approach to prepare red emissive NCs with high QY and high reproducibility.

  18. 什么是SA8000

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(SOCIAL ACCOUT ABILTY8000的英文简称)是其中最有名的标准之

  19. DAYA SAING KAKAO INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Anggita Tresliyana

    2015-07-01

    Full Text Available Cocoa is one of the major Indonesian agricultural export products. Cocoa international market has great potential regarding world’s consumption growth, therefore Indonesia is expected to take advantage on existing opportunities. The aims of this study were to analyze the competitiveness of Indonesian cocoa beans and processed cocoa trade in the international market as well as the level of competition between cocoa exporting countries. By using Revealed Comparative Advantage (RCA and Spearman Rank Correlation, it showed that Indonesia had a comparative advantage as an cocoa exporter on the international market, the highest for cocoa beans and the lowest for cocoa paste; Indonesia also had a significant correlation to exporting countries in cocoa beans’ market (Ghana and cocoa paste’s market (Netherlands and Malaysia, the correlation suggests that there were high correlation between Indonesia and the exporting country in competing for market share.Keywords: cocoa, comparative advantage, international trade, competitiveness, market share, RCA ABSTRAKKakao merupakan salah satu komoditas pertanian unggulan ekspor Indonesia.  Pasar kakao memiliki potensi yang besar dilihat dari peningkatan konsumsi dunia, sehingga Indonesia diharapkan dapat memanfaatkan peluang yang ada.  Tujuan penelitian ini adalah menganalisis daya saing perdagangan biji kakao dan kakao olahan Indonesia di pasar internasional serta hubungan daya saing antar negara eksportir kakao. Dengan menggunakan Reavealed Comparative Advantage (RCA, dan Korelasi Rank Spearman, hasil analisis menunjukkan bahwa Indonesia memiliki keunggulan komparatif sebagai eksportir biji kakao dan kakao olahan di pasar internasional, tertinggi untuk biji kakao dan terendah untuk kakao pasta;  Indonesia juga memiliki korelasi yang signifikan di beberapa negara untuk pasar biji kakao (Ghana dan kakao pasta (Belanda dan Malaysia, korelasi tersebut menunjukkan bahwa terdapat hubungan daya saing yang cukup

  20. Atmospheric environment for ASTP (SA-210) launch

    Science.gov (United States)

    Johnson, D. L.

    1976-01-01

    A summary is presented of selected atmospheric conditions observed near ASTP/SA-210 launch time on July 15, 1975, at Kennedy Space Center, Florida. Values of ambient pressure, temperature, moisture, ground winds, visual observations (cloud), density, index of refraction, and wind/wind shear aloft are included. A final meteorological data tape for the ASTP launch, consisting of wind and thermodynamic parameters versus altitude, has been constructed.

  1. IkusaSA. Integrated Assessment for Sustainability

    CSIR Research Space (South Africa)

    Scholes, RJ

    2012-10-01

    Full Text Available , have intended and unintended consequences across a range of important issues. The IkusaSA model system comprises: ? A South African national IAM nested within one or more ?state-of-the-art? global IAMs that predict trade, climate change and human.... The desired outcome is a well-functioning interface between sectors and between technical assessments and policy action. WHAT IS AN INTEGRATED ASSESSMENT MODEL (IAM)? An IAM is a numerical simulation of the dynamic interaction between socio...

  2. Detecção de cistos de Giardia spp. e oocistos de Cryptosporidium spp. na água bruta das estações de tratamento no município de Blumenau, SC, Brasil

    Directory of Open Access Journals (Sweden)

    Suelen Cristina Grott

    2016-06-01

    Full Text Available Giardia spp. e Cryptosporidium spp. são protozoários patogênicos de transmissão fecal-oral de veiculação hídrica, que causam vários problemas de saúde, como doenças gastrointestinais associados com consumo de água contaminada. Devido à escassez de dados sobre a ocorrência destes protozoários em águas superficiais no Sul do Brasil, este estudo teve como objetivo analisar a presença de cistos e oocistos na água bruta das estações de tratamento de água no município de Blumenau, SC, Brasil. Para a pesquisa dos protozoários foi utilizada a metodologia de filtração em membranas de ésteres mistos de celulose, seguida por reação de imunofluorescência utilizando o kit Merifluor(r. Para as análises microbiológicas, empregou-se a metodologia do "Standard Methods for the Examination of Water and Wastewater"; para as análises físico-químicas foi utilizada sonda multiparâmetros. Cistos de Giardia spp. foram encontrados em 23,19% das amostras e oocistos de Cryptosporidium spp. em 7,24% do total de amostras analisadas (n=67. Todas as amostras analisadas apresentaram contaminação por Escherichia coli e 11,76% apresentaram valores de turbidez da água bruta acima do recomendado. Nas análises da turbidez da água tratada 23,52% apresentaram valores acima do preconizado pela Portaria 2914/2011. A detecção de protozoários patogênicos na água bruta das estações de tratamento de água aponta para a importância de adoção de medidas preventivas, como a proteção de áreas de mananciais e tratamento adequado do esgoto doméstico objetivando reduzir os riscos de transmissão de protozoários por meio da água de consumo humano na região de Blumenau, SC, Brasil.

  3. MAPEAMENTO DA SUSCEPTIBILIDADE A DESLIZAMENTOS NA BACIA HIDROGRÁFICA DO CAETÉ, ALFREDO WAGNER/SC

    Directory of Open Access Journals (Sweden)

    Leandro Redin Vestena

    2010-01-01

    Full Text Available Este artículo tiene como objetivo identifi car y mapear la susceptibilidad de deslizamientos de tierra en la cuenca hidrográfi ca del municipio de Caeté Alfredo Wagner/SC, región montañosa del Estado de Santa Catarina. Se utilizó el modelo SINMAP (Stability Index Mapping para determinar el indice de estabilidad de taludes por medio de la combinación de un modelo hidrológico con un de estabilidad de taludes. Los resultados obtenidos mostran la presencia de zonas con elevado grado de inestabilidad de las laderas y con grado de estabilidad intermedia, que pueden ser fácilmente alteradas por actividades humanas, principalmente por la eliminación de la cubertura vegetal. El conocimiento previo de las zonas susceptibles a deslizamientos y resbalos subvencionan acciones de prevención y mitigación.

  4. Saúde da Família: o desafio de uma atenção coletiva

    Directory of Open Access Journals (Sweden)

    Suzely Adas Saliba Moimaz

    Full Text Available A estratégia de Saúde da Família, incorporada pelo Ministério da Saúde, em 1994, veio consolidar a política nacional de atenção à saúde que tem como seu principal foco de atuação a família. Nesse modelo, esta instituição passa a ser objeto primário de atenção, compreendida a partir do ambiente onde vive e de sua interação com o mesmo. Nas últimas décadas, a estrutura familiar brasileira vem sofrendo profundas alterações, que influenciam diretamente nas práticas de atenção à saúde. Esse estudo buscou resgatar os conceitos e concepções de família, bem como de suas representações sociais, e ainda revelar e apresentar a importância e a necessidade do uso de instrumentos amplos de abordagem coletiva em saúde como o APGAR, o genograma e o ecomapa, que utilizam a observação do ambiente e do histórico familiar, fatores fundamentais para o diagnóstico da realidade do núcleo familiar, para posterior planejamento das estratégias de ações em saúde. Conclui-se que as atuais estruturas familiares exigem uma capacitação das equipes de saúde, em relação aos aspectos físicos, culturais, biológicos e sociais do âmbito familiar, para a correta utilização dos instrumentos citados, importantes ferramentas para as abordagens coletivas no campo da saúde pública.

  5. "Les traductions" du texte théâtral. Bashir Lazhar entre auteure, traducteurs et professionnels de la mise en scène

    Directory of Open Access Journals (Sweden)

    Fabio Regattin

    2016-01-01

    Full Text Available Abstract – In this article, we will describe the series of textual manipulations that allowed to move from a theatrical text in French, written by a Quebec writer, to its Italian stage reading during a festival held in Rome in October 2011. This passage implied many different manipulation: an interlingual translation (Jakobson from French to Italian was followed by its intralingual revision by the actor and director; lastly, via an intersemiotic translation, the latter written version was read-staged before an audience. Despite the presence of various semiotic systems, despite the passage of the text from an interpreter to another, the act is – in many ways – the same: an act of translation, based on the same mental operations. Each professional (translators, directors, actors translates; each translation has its specificity. Résumé – Dans cet article, nous allons suivre la série de manipulations textuelles qui a permis de passer d’un texte théâtral en français, écrit par une écrivaine québécoise, à sa lecture scénique en italien dans le cadre d’un festival de théâtre qui a eu lieu à Rome, au mois d’octobre de 2011. Ces passages ont été multiples : traduction interlinguistique (Jakobson du français à l’italien ; révision intralinguistique du texte de la part de l’acteur et de la metteuse en scène ; traduction intersémiotique de la version écrite à la lecture-mise en scène face à un public. Malgré la présence de systèmes sémiotiques variés et diversifiés, malgré le passage de la pièce d’un interprète à l’autre, l’acte est un : un acte au sens large traductif, qui s’appuie sur les mêmes opérations mentales. À chaque professionnel (traducteurs, metteurs en scène, acteurs, donc, sa traduction ; à chaque traduction sa spécificité.

  6. ZnSe/ZnSeTe Superlattice Nanotips

    Directory of Open Access Journals (Sweden)

    Young SJ

    2010-01-01

    Full Text Available Abstract The authors report the growth of ZnSe/ZnSeTe superlattice nanotips on oxidized Si(100 substrate. It was found the nanotips exhibit mixture of cubic zinc-blende and hexagonal wurtzite structures. It was also found that photoluminescence intensities observed from the ZnSe/ZnSeTe superlattice nanotips were much larger than that observed from the homogeneous ZnSeTe nanotips. Furthermore, it was found that activation energies for the ZnSe/ZnSeTe superlattice nanotips with well widths of 16, 20, and 24 nm were 76, 46, and 19 meV, respectively.

  7. ZnSe/ZnSeTe Superlattice Nanotips

    Science.gov (United States)

    2010-01-01

    The authors report the growth of ZnSe/ZnSeTe superlattice nanotips on oxidized Si(100) substrate. It was found the nanotips exhibit mixture of cubic zinc-blende and hexagonal wurtzite structures. It was also found that photoluminescence intensities observed from the ZnSe/ZnSeTe superlattice nanotips were much larger than that observed from the homogeneous ZnSeTe nanotips. Furthermore, it was found that activation energies for the ZnSe/ZnSeTe superlattice nanotips with well widths of 16, 20, and 24 nm were 76, 46, and 19 meV, respectively. PMID:20672085

  8. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    2012-06-01

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  9. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  10. Grupo Tutorial e a Saúde Mental no Ensino Médico

    Directory of Open Access Journals (Sweden)

    Marcia Braga Cliquet

    Full Text Available RESUMO Esta pesquisa objetivou investigar a presença de conteúdos de saúde mental no currículo real do ensino médico nos quatro primeiros anos da Faculdade de Ciências Médicas e da Saúde da Pontifícia Universidade Católica de São Paulo. Trata-se de um estudo quantitativo e documental de caráter descritivo que avaliou esses conteúdos nos objetivos de aprendizagem dos problemas utilizados na estratégia de ensino-aprendizagem denominada tutoria nos quatro primeiros anos do curso. Como resultado, menos de 15% dos problemas estudados apresentou conteúdos de saúde mental em seus objetivos de aprendizagem no primeiro, segundo e quarto anos do curso. No terceiro ano, 36% dos problemas apresentaram tais conteúdos. A pesquisa não permite concluir o nível de exploração desses temas, bem como o aprendizado sobre eles, porém diagnostica o empobrecimento da exploração dos temas de saúde mental que permeiam o ensino médico das doenças clínicas e cirúrgicas.

  11. Adolescência e trabalho: significados, dificuldades e repercussões na saúde

    Directory of Open Access Journals (Sweden)

    Cibele Almeida Torres

    2010-12-01

    Full Text Available Foram investigadas experiências de trabalho de adolescentes trabalhadores e as repercussões na saúde. A pesquisa foi desenvolvida em uma escola de Fortaleza, Ceará, em 2008, com dez adolescentes trabalhadores. O estudo foi exploratório, com abordagem qualitativa, tendo o grupo focal e o diário de campo como instrumentos de coleta de dados. A análise dos dados seguiu a análise de conteúdo. Foram respeitados os aspectos legais e éticos. Com o desenvolvimento do estudo, surgiram quatro categorias: características dos sujeitos participantes do estudo; significados das experiências de trabalho para os adolescentes; adolescentes trabalhadores e dificuldades enfrentadas nas situações de trabalho; repercussões da situação de trabalho no campo da saúde dos adolescentes. Percebeu-se que há toda uma conjuntura que leva os adolescentes a serem cercados por vulnerabilidades, sendo fundamental a preparação dos profissionais de saúde para atender tal público, proporcionando uma atenção integral e promovendo a saúde desses adolescentes.

  12. Se il filosofo ha un compito

    Directory of Open Access Journals (Sweden)

    Carmine Di Martino

    2011-01-01

    Full Text Available SA;">Il testo muove da una ricognizione dello “stile” complessivo dell’interrogazione filosofica contemporanea: stile decostruttivo, che si risolve in un’illustrazione del limite istitutivo e costitutivo di ogni dire filosofico (e non solo filosofico. In un secondo tempo del suo intervento, l’autore si chiede se una tale comprensione, puramente “negativa”, di quel limite e della validità della parola che ne discende, non sia essa stessa ideologica, e se non sia possibile frequentare una definizione positiva di tale limite, e una possibilità non soltanto autodecostruttiva della parola filosofica “dopo” Nietzsche, Heidegger, Derrida.

  13. Políticas públicas em saúde, sistema único de saúde e o papel do legislativo municipal: Um estudo sobre os projetos de Lei Ordinária na área da saúde da cidade de Curitiba no período 2008–2011

    Directory of Open Access Journals (Sweden)

    Marta Chaves Vasconcelos

    2016-07-01

    Full Text Available As políticas públicas de saúde institucionalizadas pelo Sistema Único de Saúde (SUS universalizaram os serviços e fortaleceram os conselhos municipais e as administrações públicas municipais para o gerenciamento deste sistema no âmbito local. Esse artigo descreve e avalia os projetos lei ordinária especificamente da área da saúde na cidade de Curitiba no período de 2008 a 2011, com intuito de estabelecer elementos práticos para contribuição deste poder municipal para a consolidação das políticas públicas de saúde no município. Trata-se de uma pesquisa exploratória e aplicada, com uso de fonte de dados secundários e análise quantitativa das informações. Os projetos da área da saúde representam 16,2% do total de projetos lei ordinária, totalizando 96 projetos, esses focam em grande parte da população e fortalecem algumas datas comemorativas. Quanto aos partidos políticos, pode-se observar que há partidos com menor quantidade de vereadores, entretanto propuseram mais projetos lei do que outros partidos políticos com maior número de vereadores. Os resultados demonstram a necessidade de maior integração e participação da sociedade no Conselho Municipal de Saúde e no debate das proposições do Poder Legislativo municipal para fortalecer o papel local no desenvolvimento e aprimoramento da política pública em saúde.

  14. Atendimento aos surdos nos serviços de saúde: acessibilidade e obstáculos

    Directory of Open Access Journals (Sweden)

    Dayane Bevilaqua NEVES

    2016-09-01

    Full Text Available Estudo descritivo com abordagem qualitativa com o objetivo de compreender a acessibilidade aos serviços de saúde entre pessoas surdas, diagnosticando problemas e obstáculos que enfrentam. Participaram nove adultos surdos, que foram entrevistados utilizando a Língua Brasileira de Sinais – LIBRAS, com auxílio de um intérprete. As análises foram realizadas com base na técnica de análise de conteúdo, modalidade temática, da qual emergiram cinco categorias: comunicação, sentimentos, percepção do surdo sobre o atendimento em saúde, acessibilidade aos serviços e falta de autonomia. A análise dos dados revelou que há um número reduzido de profissionais aptos a se comunicar usando a LIBRAS, o que dificulta a comunicação com o profissional de saúde que o atende, agravado pelo fato de que raramente encontram intérpretes para auxiliá-los. Muitos serviços e informações de saúde encontram-se inacessíveis aos surdos dada a deficiência em se estabelecer um processo de comunicação eficiente com o profissional de saúde, acrescido do fato de que a própria sociedade ainda vê o surdo como alguém incapaz de tomar suas próprias decisões em relação à sua saúde e terapia, mantendo-lhes na dependência de outras pessoas.

  15. Autonomia do cuidado: interlocução afetivo-sexual com adolescentes no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Tiago Soares Baumfeld

    Full Text Available Realizou-se, dentro do Programa de Educação pelo Trabalho para a Saúde (PET-Saúde, uma pesquisa-ação em conjunto com o Centro de Saúde e a Escola Municipal de Glaura, um dos distritos de Ouro Preto/MG, reunindo 123 alunos, entre 11 e 19 anos de idade, que participaram de encontros semanais de abril de 2009 a março de 2010. O projeto visava à integração entre ensino e serviço de saúde, ao desenvolvimento da autonomia do cuidado, à construção de vínculos e ao intercâmbio de conhecimento com os adolescentes. Pautou-se na horizontalidade das relações entre os monitores, o preceptor, a tutora e os adolescentes, sob a óptica da visão freiriana de educação popular. Foram realizadas dinâmicas, encenações cômicas e quizzes, tendo a sexualidade como tema principal. Posteriormente, estimulou-se a confecção de ferramentas multiplicadoras pelos adolescentes, como vídeos e peças de teatro, tornando-os protagonistas do processo de ensino-aprendizagem. Este artigo serve como parâmetro para avaliação qualitativa da eficácia do PET-Saúde, além de discutir a relevância do programa para a formação médica, especialmente no que tange as habilidades dos profissionais de saúde para fornecer orientação afetivo-sexual aos adolescentes.

  16. Acidente com material biológico no atendimento pré-hospitalar móvel: realidade para trabalhadores da saúde e não saúde

    OpenAIRE

    2013-01-01

    Estudo analítico transversal, com objetivos de identificar a prevalência e caracterizar os acidentes com material biológico entre profissionais do Atendimento Pré-Hospitalar (APH) e comparar os comportamentos de risco adotados entre os grupos saúde e não saúde que podem influenciar na ocorrência e na gravidade destes acidentes. Dados foram obtidos por meio de questionário aplicado a todos os trabalhadores do APH de Goiânia - GO. Verificou-se alta prevalência de acidentes envolvendo material b...

  17. Saúde pública no Primeiro e Terceiro Mundos: desafios e perspectivas

    Directory of Open Access Journals (Sweden)

    Salzano Francisco Mauro

    2002-01-01

    Full Text Available O direito universal à saúde está bem estabelecido, mas entre declarações de propósitos e a realidade existem abismos difíceis de transpor. O desenvolvimento científico-tecnológico desigual tem acentuado as distâncias entre os padrões de vida, e, portanto, o estado sanitário de populações do Primeiro e Terceiro Mundos. Um dos segmentos mais importantes deste desenvolvimento científico-tecnológico é o que se relaciona à genética e à biologia molecular. Os avanços espetaculares nesta área fazem com que nossas vidas sejam cada vez mais "genetizadas". Procurou-se abordar, aqui, as relações entre essas áreas e a da saúde pública no que se refere a (a doenças infecciosas; (b enfermidades mendelianas; (c aberrações cromossômicas; (d condições multifatoriais; (e mutagênese, teratogênese, carcinogênese; e (f hemoglobinopatias e talassemias. O futuro da saúde pública no país está longe de ser promissor, mas deve-se fazer um esforço para a montagem de programas apropriados neste setor que envolvam inversões apropriadas, tanto na infra-estrutura como na formação de recursos humanos; e tais programas não podem se dar ao luxo de ignorar a genética e a biologia molecular.

  18. Saúde pública no Primeiro e Terceiro Mundos: desafios e perspectivas

    Directory of Open Access Journals (Sweden)

    Francisco Mauro Salzano

    Full Text Available O direito universal à saúde está bem estabelecido, mas entre declarações de propósitos e a realidade existem abismos difíceis de transpor. O desenvolvimento científico-tecnológico desigual tem acentuado as distâncias entre os padrões de vida, e, portanto, o estado sanitário de populações do Primeiro e Terceiro Mundos. Um dos segmentos mais importantes deste desenvolvimento científico-tecnológico é o que se relaciona à genética e à biologia molecular. Os avanços espetaculares nesta área fazem com que nossas vidas sejam cada vez mais "genetizadas". Procurou-se abordar, aqui, as relações entre essas áreas e a da saúde pública no que se refere a (a doenças infecciosas; (b enfermidades mendelianas; (c aberrações cromossômicas; (d condições multifatoriais; (e mutagênese, teratogênese, carcinogênese; e (f hemoglobinopatias e talassemias. O futuro da saúde pública no país está longe de ser promissor, mas deve-se fazer um esforço para a montagem de programas apropriados neste setor que envolvam inversões apropriadas, tanto na infra-estrutura como na formação de recursos humanos; e tais programas não podem se dar ao luxo de ignorar a genética e a biologia molecular.

  19. Aborto induzido na interface da saúde e do direito

    Directory of Open Access Journals (Sweden)

    Iria Raquel Borges Wiese

    2014-06-01

    Full Text Available Objetivou-se investigar as crenças dos profissionais de saúde e de direito sobre o aborto induzido, por meio da pesquisa qualitativa. Para tanto, foram entrevistados 15 profissionais de saúde (médicos ginecologistas/obstetras, enfermeiros e psicólogos e 10 profissionais de direito (promotores de justiça e juízes de direito. As entrevistas foram operacionalizadas com base em categorias determinadas a partir dos sentidos suscitados, processados em uma série de etapas. Dessa forma, os discursos dos participantes foram agrupados em duas categorias: atitude e aspectos jurídicos. A categoria atitude foi composta por crenças contrárias e favoráveis a essa prática, que se centraram na heteronomia e sacralidade da vida. As crenças favoráveis, por sua vez, estiveram ancoradas na perspectiva dos direitos reprodutivos e sexuais, na redução de riscos e danos e na autonomia da mulher sobre seu próprio corpo. Em relação aos aspectos jurídicos, verificou-se que os profissionais de direito apresentaram um posicionamento mais rígido quanto à punição das mulheres que abortam. Embora se tenha uma legislação sobre o assunto e normas técnicas de atenção humanizada ao aborto, as discussões não se encerram no ponto de vista jurídico ou deontológico; ao contrário, abrangem um leque variado de crenças, as quais podem guiar a atuação dos profissionais, tanto no cuidado à saúde da mulher como na interpretação dos seus direitos.

  20. Desafios e perspectivas da Educação Popular em Saúde na constituição da práxis do Agente Comunitário de Saúde

    Directory of Open Access Journals (Sweden)

    Vera Joana Bornstein

    2014-12-01

    Full Text Available O estudo problematiza as práticas do Agente Comunitário de Saúde no Brasil, especialmente no que se refere ao seu exercício como educador no contexto das políticas de saúde e de sua atuação profissional. Para a sua construção, considerou-se a experiência das autoras na formação técnica de Agentes Comunitários de Saúde na EPSJV/Fiocruz e a realização de revisão de literatura sobre o tema. Os resultados encontrados indicam possíveis contradições entre as prescrições legais do trabalho do ACS, as expectativas dos serviços em relação à ação desse trabalhador e a possibilidade de ele se constituir como um educador popular. Por fim, apresenta perspectivas e desafios da Educação Popular em Saúde para as mudanças necessárias e possíveis nas práticas dos ACSs, em direção à efetivação da integralidade, da participação popular e do diálogo com o saber popular no âmbito da Atenção Básica.

  1. A produção do conhecimento da saúde pública sobre a relação homem-saúde: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Romeu Gomes

    Full Text Available O estudo tem como objetivo analisar a produção bibliográfica sobre a relação homem-saúde, no campo da saúde pública. A partir dessa análise, pretende-se problematizar as idéias mais recorrentes nas considerações sobre as especificidades do ser homem no processo saúde-doença. O método consistiu-se numa revisão bibliográfica de artigos de saúde pública, realizada a partir de uma abordagem de pesquisa qualitativa. Sexualidade masculina, masculinidade e reprodução e masculinidade e poder foram os temas encontrados na análise. Concluiu-se que ainda são necessárias investigações sobre as masculinidades relacionadas a gênero, nacionalidade, classe, idade, etnia e orientação sexual.

  2. A produção do conhecimento da saúde pública sobre a relação homem-saúde: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Gomes Romeu

    2006-01-01

    Full Text Available O estudo tem como objetivo analisar a produção bibliográfica sobre a relação homem-saúde, no campo da saúde pública. A partir dessa análise, pretende-se problematizar as idéias mais recorrentes nas considerações sobre as especificidades do ser homem no processo saúde-doença. O método consistiu-se numa revisão bibliográfica de artigos de saúde pública, realizada a partir de uma abordagem de pesquisa qualitativa. Sexualidade masculina, masculinidade e reprodução e masculinidade e poder foram os temas encontrados na análise. Concluiu-se que ainda são necessárias investigações sobre as masculinidades relacionadas a gênero, nacionalidade, classe, idade, etnia e orientação sexual.

  3. De l'impuissance de l'enfance à la revanche par l'écriture : le parcours de Driss Chraïbi et sa représentation du couple

    NARCIS (Netherlands)

    Guinoune, Anne-Marie

    2003-01-01

    A-t-il jamais réussi à accéder au monde d’autrui, ce héros que nous avons vu vieillir au fil des livres ? Oui, avec l’aide de l’écriture, il va arriver à ne plus se retourner sur le passé mais à se projeter dans l’avenir, vers sa fin. Le moment est venu de transmettre l’héritage, celui-ci trouve sa

  4. Uso da avaliação de tecnologias em saúde em processos de análise para incorporação de tecnologias no Sistema Único de Saúde no Ministério da Saúde

    Directory of Open Access Journals (Sweden)

    Hillegonda Maria Dutilh Novaes

    2013-01-01

    Full Text Available As políticas científicas com objetivos de produção de conhecimentos em saúde foram ampliadas nas últimas décadas. No Brasil, o incentivo à pesquisa, desenvolvimento e inovação em saúde constou na Lei Orgânica da Saúde desde 1990, e políticas científicas e tecnológicas para a área da saúde foram propostas a partir de 1994, incluindo políticas de desenvolvimento da avaliação de tecnologias em saúde (ATS, como em outros países. Coloca-se agora a avaliação dos impactos da ATS sobre a gestão e incorporação de tecnologias nos sistemas de saúde. Como estudo de caso para o uso da ATS em processos de incorporação de tecnologias no Brasil foi analisada a participação do Departamento de Ciência e Tecnologia (DECIT do, Ministério da Saúde, na Comissão de Incorporação de Tecnologias do Ministério da Saúde (CITEC, no período 2008-2010. Foram utilizados 103 estudos na CITEC, 80% produzidos pelo DECIT, a maioria sínteses com base na literatura existente, e 80% das tecnologias tinham propósito terapêutico, com tendência de crescimento da produção no período. Está em curso um processo de aprendizado tanto metodológico quanto político para o uso da ATS, mas há necessidade de aprofundar a análise do seu impacto sobre o SUS.

  5. Performance Evaluation Considering Iterations per Phase and SA Temperature in WMN-SA System

    Directory of Open Access Journals (Sweden)

    Shinji Sakamoto

    2014-01-01

    Full Text Available One of the key advantages of Wireless Mesh Networks (WMNs is their importance for providing cost-efficient broadband connectivity. There are issues for achieving the network connectivity and user coverage, which are related with the node placement problem. In this work, we consider Simulated Annealing Algorithm (SA temperature and Iteration per phase for the router node placement problem in WMNs. We want to find the optimal distribution of router nodes in order to provide the best network connectivity and provide the best coverage in a set of Normal distributed clients. From simulation results, we found how to optimize both the size of Giant Component and number of covered mesh clients. When the number of iterations per phase is big, the performance is better in WMN-SA System. From for SA temperature, when SA temperature is 0 and 1, the performance is almost same. When SA temperature is 2 and 3 or more, the performance decrease because there are many kick ups.

  6. Qualidade de vida no serviço público de saúde: as representações sociais de profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Maria da Penha de Lima Coutinho

    Full Text Available Atualmente, o termo “qualidade de vida” vem se tornando parte de interesse crescente para profissionais e pesquisadores dos mais variados espaços do conhecimento humano, especialmente nos serviços de saúde, junto a profissionais e usuários. O objetivo deste artigo é apresentar os resultados de uma investigação sobre as representações sociais dos profissionais da saúde acerca da qualidade de vida e de suas práticas nos serviços públicos. Trata-se de um estudo exploratório desenvolvido na cidade de João Pessoa/PB, ancorado na teoria das representações sociais e instrumentalizado pela entrevista semi-estruturada. Os dados coletados foram processados e analisados pela técnica de análise de conteúdo temática, de Bardin (2002, e mensurados por categorias que revelaram as dimensões objetivas e subjetivas dessa representação. No tocante ao atendimento público, evidenciou-se uma associação direta com as dificuldades e entraves que o serviço público apresenta e com a pequena valorização que recebe da sociedade e de seus órgãos gestores.

  7. Reflexões sobre a saúde bucal no Brasil

    Directory of Open Access Journals (Sweden)

    Anya Pimentel Gomes Fernandes Vieira Meyer

    2013-12-01

    Full Text Available No último século, numerosos avanços em pesquisas e tecnologias biomédicas na área odontológica foram responsáveis por melhorias na saúde e no bem-estar das populações(1. Entretanto, apesar das grandes realizações no âmbito da saúde bucal, muitos problemas ainda permanecem, como a cárie dental, a mais comum das doenças bucais. A prevalência da cárie dentária apresentou uma tendência de declínio nas três últimas décadas do século XX e no início do século XXI, especialmente nos países desenvolvidos, contudo, ainda é considerada uma importante questão de saúde pública mundial, afetando de 60% a 90% das crianças em idade escolar, além da vasta maioria dos adultos(2-4. No levantamento epidemiológico SB Brasil 2010(5, foram observadas melhoras na condição bucal dos brasileiros, porém, ainda é alta a prevalência de cárie. Entre os adolescentes de 15 a 19 anos, por exemplo, a média de dentes afetados foi de 4,25 mais que o dobro do número médio encontrado aos 12 anos. Entre os idosos de 65a 74 anos, o número de dentes cariados, perdidos e obturados (CPO praticamente não se alterou, ficando em 27,5 em 2010, enquanto, em 2003, a média era de 27,8. Em termos internacionais, de acordo com o Ministério da Saúde brasileiro(5,um estudo realizado pela Organização Mundial da Saúde (OMS em 2004 indicou que, nos dados de 188 países, o valor médio do CPO aos 12 anos foi de 1,6, sendonas Américas a média de 2,8, enquanto na Europa ficou em 1,6. Na América do Sul,somente a Venezuela apresentou média de CPO aos 12 anos semelhante à brasileira(2,1. Nos demais países, as médias apresentaram-se mais altas, como na Argentina(3,4, Bolívia (4,7, Colômbia (2,3, Paraguai (2,8 e Peru (3,7. Os achados epidemiológicos de 2010 sobre a saúde bucal no Brasil(5mostraram que o país entrou para o grupo daqueles com baixa prevalência de carie aos 12 anos. Embora os resultados nesse quesito tenham sido animadores, a

  8. AgSbSe{sub 2} and AgSb(S,Se){sub 2} thin films for photovoltaic applications

    Energy Technology Data Exchange (ETDEWEB)

    Garza, J.G. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Shaji, S. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Facultad de Ingenieria Mecanica y Electrica, CIIDIT - Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Rodriguez, A.C.; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Krishnan, B., E-mail: kbindu_k@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Facultad de Ingenieria Mecanica y Electrica, CIIDIT - Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2011-10-01

    Silver antimony selenide (AgSbSe{sub 2}) thin films were prepared by heating sequentially deposited multilayers of antimony sulphide (Sb{sub 2}S{sub 3}), silver selenide (Ag{sub 2}Se), selenium (Se) and silver (Ag). Sb{sub 2}S{sub 3} thin film was prepared from a chemical bath containing SbCl{sub 3} and Na{sub 2}S{sub 2}O{sub 3}, Ag{sub 2}Se from a solution containing AgNO{sub 3} and Na{sub 2}SeSO{sub 3} and Se thin films from an acidified solution of Na{sub 2}SeSO{sub 3}, at room temperature on glass substrates. Ag thin film was deposited by thermal evaporation. The annealing temperature was 350 deg. C in vacuum (10{sup -3} Torr) for 1 h. X-ray diffraction analysis showed that the thin films formed were polycrystalline AgSbSe{sub 2} or AgSb(S,Se){sub 2} depending on selenium content in the precursor films. Morphology and elemental analysis of these films were done using scanning electron microscopy and energy dispersive X-ray spectroscopy. Optical band gap was evaluated from the UV-visible absorption spectra of these films. Electrical characterizations were done using Hall effect and photocurrent measurements. A photovoltaic structure: glass/ITO/CdS/AgSbSe{sub 2}/Al was formed, in which CdS was deposited by chemical bath deposition. J-V characteristics of this structure showed V{sub oc} = 435 mV and J{sub sc} = 0.08 mA/cm{sup 2} under illumination using a tungsten halogen lamp. Preparation of a photovoltaic structure using AgSbSe{sub 2} as an absorber material by a non-toxic selenization process is achieved.

  9. Plan de mejoramiento al sistema integrado de calidad, seguridad y salud ocupacional de la empresa Arotec Colombiana S.A.

    OpenAIRE

    Sarmiento Pedraza, Alba Milena

    2012-01-01

    Arotec Colombiana S.A. es una empresa dedicada a la importación y comercialización de equipos para el control de calidad e investigación. En sus 30 años que tiene de constitución, su actividad ha estado orientada exclusivamente a la importación, promoción y venta de equipos para los sectores públicos y privados. La pérdida de la capacidad de control y mejora contínua del Sistema Integrado de Calidad, Seguridad y Salud Ocupacional de la empresa Arotec Colombiana S.A. se ha considerado como ...

  10. Profissionais de saúde e violência intrafamiliar contra a criança e adolescente

    OpenAIRE

    Nunes, Cristina Brandt; Sarti, Cynthia Andersen [UNIFESP; Ohara, Conceição Vieira da Silva

    2009-01-01

    OBJETIVO: Compreender o modo como os profissionais de saúde abordam as situações envolvidas na violência intrafamiliar contra a criança e o adolescente. MÉTODOS: Pesquisa de natureza qualitativo, na modalidade de estudo de caso, realizado com 30 profissionais de saúde. RESULTADOS: Os profissionais mostraram-se preocupados com a falta de resolução dos problemas. Revelaram que as medidas empreendidas priorizam a punição em lugar do atendimento e que a estrutura de trabalho não lhes permitia exp...

  11. Caracterização epidemiológica dos microrganismos presentes em jalecos dos profissionais de saúde

    OpenAIRE

    Adriana Cristina de Oliveira; Marlene das Dores Medeiros Silva

    2013-01-01

    Estudo transversal cujo objetivo foi determinar as características epidemiológicas de microrganismos presentes nos jalecos de profissionais de saúde em um hospital universitário. A pesquisa foi realizada com profissionais de saúde, por meio da aplicação de um questionário para obtenção de informações quanto ao perfil sociodemográfico e comportamento dos profissionais da unidade de internação em relação aos cuidados com o jaleco. Em seguida, realizou-se a rolagem de swabs nas regiões dos bolso...

  12. Qualidade de vida e saúde mental de mulheres tratadas de carcinoma invasor do colo uterino

    OpenAIRE

    Gabriela Martins de Oliveira e Araujo Caixeta

    2009-01-01

    INTRODUÇÃO: O objetivo principal deste trabalho foi avaliar os níveis de qualidade de vida e saúde mental de mulheres sobreviventes de carcinoma invasor do colo uterino tratadas há mais de dois anos com tratamento cirúrgico histerectomia radical (HR), tratamento não cirúrgico quimioterapia/radioterapia (QT/RT), ou cirurgia mais tratamentos adjuvantes histerectomia radical associada à quimioterapia/radioterapia (HR + QT/RT). Avaliou-se comparativamente a qualidade de vida e a saúde mental d...

  13. O cuidado na saúde e na doença: uma perspectiva gestáltica

    Directory of Open Access Journals (Sweden)

    Karina Okajima Fukumitsu

    2009-04-01

    Full Text Available Este artigo apresenta relações entre a Gestalt-Terapia, cuidado, cura e processos de saúde e doença. O cuidado passa a ser significativo para as pessoas sempre que um encontro genuíno acontece. Considerando que o profissional da saúde é um cuidador, sua relação com o cliente pode ser facilitadora para a instauração de novos sentidos, descobertas existenciais e, eventualmente, um caminho para a cura. Entende-se cura como o processo de retorno ao saudável e ao reconhecimento das potencialidades e possibilidades humanas.

  14. Representação social de profissionais de saúde sobre aspectos emocionais relacionados ao diabetes mellitus

    OpenAIRE

    Camila Rezende Pimentel Ribas

    2013-01-01

    Este estudo teve como objetivo identificar as representações sociais de profissionais de saúde da área de diabetes mellitus sobre aspectos emocionais de pacientes adultos com diabetes mellitus. Trata-se de uma pesquisa descritiva, exploratória, de abordagem qualitativa, cujo referencial teórico adotado foi a teoria das representações sociais. Participaram do estudo 11 profissionais de saúde, de nível superior, sendo cinco enfermeiras, três psicólogos, uma médica, um educador físico e um...

  15. A evolução do setor saúde e a crise da enfermagem Brasileira

    Directory of Open Access Journals (Sweden)

    Ieda Barreira e Castro

    1988-12-01

    Full Text Available O processo de unificação do Setor Saúde no Brasil vem ocorrendo paralelamente a grandes modificações quantitativas e qualitativas na preparação do pessoal de enfermagem. No entanto, essas alterações não se fizeram acompanhar pela ampliação de oportunidades de emprego e de espaço profissipnal nos programas e serviços de saúde. Alguns dos fatores que contribuíram para a configuração dessa situação são levantados e discutidos pela autora.

  16. Território e saúde mental : contribuições conceituais da geografia para o campo psicossocial

    OpenAIRE

    Silva, Aline Basso da; Pinho,Leandro Barbosa de

    2015-01-01

    Este artigo tem como tema o território e saúde mental e discute as contribuições da geografia para o campo psicossocial, pensando o território como o local de cuidado em saúde mental. Historiciza brevemente a ideologia psiquiátrica da produção do comum nos hospícios, apresentando a necessidade de se pensar alternativas de cuidado que reforcem as singularidades dos sujeitos e fora dos muros dos manicômios. Desenvolve o tema do território como local de potência para o cuidado e foco da desinsti...

  17. Uma chama que se apaga: residência de medicina preventiva e social

    Directory of Open Access Journals (Sweden)

    Adriano Massuda

    Full Text Available O processo de extinção da residência de Medicina Preventiva e Social (RMPS constitui um paradoxo diante da necessidade de médicos com especialização em Saúde Coletiva para atuar no Sistema Único de Saúde. O presente artigo realizou uma revisão do processo histórico de construção das RMPS e investigou a estrutura atual dos programas remanescentes a partir da análise dos cenários de prática e das atividades práticas e teóricas desenvolvidas. Ao final foi possível construir uma tipologia em que se identifica o tipo Generalista em Saúde Coletiva, que aborda as três áreas nucleares da Saúde Coletiva; o tipo da Epidemiologia, no qual o foco é exclusivamente essa área; e o tipo da Saúde Comunitária, que se centra na Atenção Primária em Saúde. Do cruzamento do processo histórico de construção com a realidade atual, pode-se inferir que os fatores que têm contribuído para a extinção da RMPS são principalmente a ausência de políticas de Estado para formação na área, bem como o não comprometimento de sujeitos sociais que se relacionam com essa residência, levando à existência de anacrônicas diretrizes orientadoras para formação profissional

  18. A rede social de cuidados de uma criança com necessidade especial de saúde

    Directory of Open Access Journals (Sweden)

    Eliane Tatsch Neves

    2013-06-01

    Full Text Available Pesquisa qualitativa que objetivou descrever a rede social de cuidados de uma criança com necessidade especial de saúde. Os participantes da pesquisa foram os avós de uma criança, sorteados a partir do banco de dados de uma pesquisa. O Método Criativo Sensível foi desenvolvido por meio da Dinâmica de Criatividade e Sensibilidade Mapa Falante posteriormente submetida à Análise de Discurso em sua corrente francesa. Os resultados apontaram que os familiares da criança possuem uma rede social fragmentada e solitária constituída por serviços de saúde de nível secundário e terciário; que a criança dependente de tecnologia é marginalizada no Sistema Único de Saúde, sendo invisíveis na rede primária. Conclui-se que os familiares da criança apoiam-se nos serviços que prestam cuidados a criança, que a rede familial está restrita aos familiares mais próximos. Sugere-se que a enfermagem possibilite a formação de redes e o acesso à assistência em saúde dessas crianças.

  19. Saúde pública, rede básica e o sistema de saúde brasileiro Public health, local health units, and the Brazilian health system

    Directory of Open Access Journals (Sweden)

    Emerson E. Merhy

    1993-06-01

    Full Text Available Este artigo focaliza o desenvolvimento da saúde pública no Brasil com o intuito de analisar os problemas com os quais se depara o processo atual de municipalização dos serviços de saúde. Argumenta-se que a postura neoliberal ou conservadora tornou-se incapaz de articular uma proposta viável para o sistema de saúde. Por outro lado, a proposta reformista concentra sua atenção no sistema de saúde e sua administração, tendo como modelo a postura positivista das ciências naturais e administrativas. Argumenta-se que apenas uma mudança radical no paradigma da medicina, na qual a dimensão coletiva e social predomina sobre a dimensão biológica e individual, permitiria conciliá-la com as necessidades de saúde da população.This article focuses on the development of public health in Brazil, with the aim of analyzing the present process of decentralization of health care. The authors argue that the neoliberal or conservative position is unable to offer a reasonable solution to problems in the health care system. On the other hand, the reformist position concentrates its attention on the health system and its administration, taking as its model a positivistic approach to natural and administrative sciences. The authors further argue that only a radical change in the prevailing medical paradigm and a predominance of social over biological aspects would meet the health needs of the population.

  20. Eqüidade em saúde nos relatórios das conferências nacionais de saúde pós-Constituição Federal brasileira de 1988

    Directory of Open Access Journals (Sweden)

    Marcelo Cardoso Pinheiro

    2005-04-01

    Full Text Available A partir de um posicionamento sobre o conceito de eqüidade e sua aplicação no campo da saúde pública, com base em revisão de literatura, o objetivo deste artigo é discutir o significado atribuído ao uso do termo eqüidade ou variações deste termo nos relatórios das 9ª, 10ª e 11ª Conferências Nacionais de Saúde. Utilizou-se a metodologia qualitativa e a técnica análise de conteúdo para analisar a abordagem da questão da eqüidade nos dois produtos que as Conferências se propõem a formular: a apresentação de um quadro da saúde no país e diretrizes para as políticas públicas de saúde. Verificou-se que houve pouco avanço em relação ao entendimento do tema eqüidade em saúde, com predomínio de um discurso com sentido vago ou excessivamente amplo. As proposições apresentadas foram caracterizadas também como gerais e inespecíficas, uma vez que na maior parte das vezes, não foram definidos grupos sociais a que as propostas se dirigiam ou o problema a ser enfrentado.