Lande gJ factors for even-parity electronic levels in the holmium atom
Stefanska, D.; Werbowy, S.; Krzykowski, A.; Furmann, B.
2018-05-01
In this work the hyperfine structure of the Zeeman splitting for 18 even-parity levels in the holmium atom was investigated. The experimental method applied was laser induced fluorescence in a hollow cathode discharge lamp. 20 spectral lines were investigated involving odd-parity levels from the ground multiplet, for which Lande gJ factors are known with high precision, as the lower levels; this greatly facilitated the evaluation of gJ factors for the upper levels. The gJ values for the even-parity levels considered are reported for the first time. They proved to compare fairly well with the values obtained recently in a semi-empirical analysis for the even-parity level system of Ho I.
Framing the Arctic: Reconsidering Roald Amundsen’s Gjøa Expedition Imagery
Directory of Open Access Journals (Sweden)
Ingeborg Høvik
2015-04-01
Full Text Available In 1906 Roald Amundsen’s Gjøa Expedition returned to Norway after three years in the Arctic. The first to complete a Northwest Passage by sea, the expedition also brought back a substantial amount of ethnographic material concerning the Netsilik Inuit, with whom Amundsen and his crew had been in sustained contact during their stay on King William Island in Nunavut between 1903 and 1905. This material included a large number of photographs, forty-two of which were included as illustrations in his expedition narrative, titled Nordvest-passagen and first released in Norwegian in 1907. Focusing on a selection of published and unpublished photographs from Amundsen’s voyage and their interrelationships, this article examines the degree to which the Gjøa Expedition’s use of photography formed part of a planned project that intersected with anthropological concerns and practices of its time. My purpose is further to demonstrate that there is a discernible change in the representation of indigeneity that occurs when particular photographs were selected and then contextually reframed as illustrations in Nordvest-passagen. On the one hand, the extensive body of photographs taken in the field elaborates the close interaction between crew and Inuit recorded in Amundsen’s personal diary and published narrative, testifying to the existence of an active and dynamic contact zone. In this regard, the original photographs could arguably be read as a dialogic portrayal of the unique individuals Amundsen’s crew met while in the Arctic. On the other hand, a peculiar distancing seems to have taken place as the Gjøa Expedition’s photographs were selected and reproduced as illustrations for Amundsen’s expedition narrative. Likely connected to a desire to match his expedition narrative to existing scientific visual and literary conventions, this shift suggests Amundsen’s attempts through textual and visual means to deny the Netsilik Inuit’s
Sobolewski, Ł. M.; Windholz, L.; Kwela, J.
2017-11-01
Laser Induced Fluorescence Spectroscopy (LIF) and Optogalvanic Spectroscopy (OG) were used for the investigation of the Zeeman hyperfine structures of 26 spectral lines of La I in the wavelength range between 569.7 and 665.4 nm. As a source of free La atoms a hollow cathode discharge lamp was used. The spectra were recorded in the presence of a magnetic field of about 800G produced by a permanent magnet for two linear polarizations of the exciting laser light. As a result of the study, we determined for the first time the Landé gJ- factors of 20 levels of La I. For several other levels the Landé gJ- factors were re-investigated and determined with higher precision.
NARROW-K-BAND OBSERVATIONS OF THE GJ 1214 SYSTEM
Energy Technology Data Exchange (ETDEWEB)
Colón, Knicole D.; Gaidos, Eric, E-mail: colonk@hawaii.edu [Department of Geology and Geophysics, University of Hawaii at Manoa, Honolulu, HI 96822 (United States)
2013-10-10
GJ 1214 is a nearby M dwarf star that hosts a transiting super-Earth-size planet, making this system an excellent target for atmospheric studies. Most studies find that the transmission spectrum of GJ 1214b is flat, which favors either a high mean molecular weight or cloudy/hazy hydrogen (H) rich atmosphere model. Photometry at short wavelengths (<0.7 μm) and in the K band can discriminate the most between these different atmosphere models for GJ 1214b, but current observations do not have sufficiently high precision. We present photometry of seven transits of GJ 1214b through a narrow K-band (2.141 μm) filter with the Wide Field Camera on the 3.8 m United Kingdom Infrared Telescope. Our photometric precision is typically 1.7 × 10{sup –3} (for a single transit), comparable with other ground-based observations of GJ 1214b. We measure a planet-star radius ratio of 0.1158 ± 0.0013, which, along with other studies, also supports a flat transmission spectrum for GJ 1214b. Since this does not exclude a scenario where GJ 1214b has an H-rich envelope with heavy elements that are sequestered below a cloud/haze layer, we compare K-band observations with models of H{sub 2} collision-induced absorption in an atmosphere for a range of temperatures. While we find no evidence for deviation from a flat spectrum (slope s = 0.0016 ± 0.0038), an H{sub 2}-dominated upper atmosphere (<60 mbar) cannot be excluded. More precise observations at <0.7 μm and in the K band, as well as a uniform analysis of all published data, would be useful for establishing more robust limits on atmosphere models for GJ 1214b.
Chaotic Excitation and Tidal Damping in the GJ 876 System
Puranam, Abhijit; Batygin, Konstantin
2018-04-01
The M-dwarf GJ 876 is the closest known star to harbor a multi-planetary system. With three outer planets locked in a chaotic Laplace-type resonance and an appreciably eccentric short-period super-Earth, this system represents a unique exposition of extrasolar planetary dynamics. A key question that concerns the long-term evolution of this system, and the fate of close-in planets in general, is how the significant eccentricity of the inner-most planet is maintained against tidal circularization on timescales comparable to the age of the universe. Here, we employ stochastic secular perturbation theory and N-body simulations to show that the orbit of the inner-most planet is shaped by a delicate balance between extrinsic chaotic forcing and tidal dissipation. As such, the planet’s orbital eccentricity represents an indirect measure of its tidal quality factor. Based on the system’s present-day architecture, we estimate that the extrasolar super-Earth GJ 876 d has a tidal Q ∼ 104–105, a value characteristic of solar system gas giants.
Energy Technology Data Exchange (ETDEWEB)
Charnay, B.; Meadows, V.; Misra, A.; Arney, G. [Astronomy Department, University of Washington, Seattle, WA 98125 (United States); Leconte, J., E-mail: bcharnay@uw.edu [Canadian Institute for Theoretical Astrophysics, 60 St George Street, University of Toronto, Toronto, ON M5S 3H8 (Canada)
2015-11-01
The warm sub-Neptune GJ1214b has a featureless transit spectrum that may be due to the presence of high and thick clouds or haze. Here, we simulate the atmosphere of GJ1214b with a 3D General Circulation Model for cloudy hydrogen-dominated atmospheres, including cloud radiative effects. We show that the atmospheric circulation is strong enough to transport micrometric cloud particles to the upper atmosphere and generally leads to a minimum of cloud at the equator. By scattering stellar light, clouds increase the planetary albedo to 0.4–0.6 and cool the atmosphere below 1 mbar. However, the heating by ZnS clouds leads to the formation of a stratospheric thermal inversion above 10 mbar, with temperatures potentially high enough on the dayside to evaporate KCl clouds. We show that flat transit spectra consistent with Hubble Space Telescope observations are possible if cloud particle radii are around 0.5 μm, and that such clouds should be optically thin at wavelengths >3 μm. Using simulated cloudy atmospheres that fit the observed spectra we generate transit, emission, and reflection spectra and phase curves for GJ1214b. We show that a stratospheric thermal inversion would be readily accessible in near- and mid-infrared atmospheric spectral windows. We find that the amplitude of the thermal phase curves is strongly dependent on metallicity, but only slightly impacted by clouds. Our results suggest that primary and secondary eclipses and phase curves observed by the James Webb Space Telescope in the near- to mid-infrared should provide strong constraints on the nature of GJ1214b's atmosphere and clouds.
Parmentier, Vivien; Stevenson, Kevin; Crossfield, Ian; Morley, Caroline; Fortney, Jonathan; Showman, Adam; Lewis, Nikole; Line, Mike
2017-10-01
GJ436b is a slightly eccentric, Neptune size planet with an equilibrium temperature of approximately 770K, it is the only Neptune size planet with a thermal emission measurement. With the coming JWST GTO observations of it's emission spectrum, GJ436b will become a benchmark object of the population of Neptune-size planets that will be discovered by TESS and characterized by JWST in the coming years. The current set of 19 secondary eclipses observed by Spitzer points toward a metal-rich, well mixed, tidally heated atmosphere in disequilibrium chemistry. However, no self-consistent forward models are currently able to fit the dayside spectrum of the planet, whereas retrieval models lead to solutions that are inconsistent with the observed planet density. Clearly, some piece of the puzzle is missing to understand the atmospheric properties of this planet. Although the coming JWST observations will likely improve our understanding of this planet, it won't be able to break the degeneracies between metallicity, internal flux and energy redistribution. We propose to observe a full phase curve of GJ436b at 3.6 microns. We will obtain a measurement of the nightside flux of GJ436b at 3.6 microns. Combined with the already observed 8 microns phase curve, we will obtain the first low resolution spectrum of the nightside of a Neptune size exoplanet. By comparing the nightside flux at 3.6 and 8 microns, we will be able to place constraints on the tidal heating and the metallicity of GJ436b that will be complimentary to the the dayside spectrum that will be obtained with JWST. As seen with the example of hot Jupiters, for which much more data is available, measurements of the nightside spectrum is fundamental to understand the planet atmosphere as a whole and correctly interpret the dayside emission. As a consequence, the proposed observation is crucial for the interpretation of the coming JWST observations. As a secondary goal, our observation should be able to confirm the
SECRETLY ECCENTRIC: THE GIANT PLANET AND ACTIVITY CYCLE OF GJ 328
International Nuclear Information System (INIS)
Robertson, Paul; Endl, Michael; Cochran, William D.; MacQueen, Phillip J.; Boss, Alan P.
2013-01-01
We announce the discovery of a ∼2 Jupiter-mass planet in an eccentric 11 yr orbit around the K7/M0 dwarf GJ 328. Our result is based on 10 years of radial velocity (RV) data from the Hobby-Eberly and Harlan J. Smith telescopes at McDonald Observatory, and from the Keck Telescope at Mauna Kea. Our analysis of GJ 328's magnetic activity via the Na I D features reveals a long-period stellar activity cycle, which creates an additional signal in the star's RV curve with amplitude 6-10 m s –1 . After correcting for this stellar RV contribution, we see that the orbit of the planet is more eccentric than suggested by the raw RV data. GJ 328b is currently the most massive, longest-period planet discovered around a low-mass dwarf
PWR type overpower tests at 1620 GJ/KGU (18,800 MWD/MTU)
International Nuclear Information System (INIS)
Knudsen, P.; Bagger, C.; Carlsen, H.
1979-01-01
Three PWR type test fuel pins accumulated a burnup of 1620 GJ/kgU at heat loads decreasing from 45 to 28 kW/m (avg. test levels). One pin was ramped to 43 kW/m at 31 W/m/s; after 15 ks the power was increased to 45 kW/m and held constant for 1.9 Ms without failure indication. The other two pins were ramped to 44 kW/m at 23 W/m/s and then to 49 kW/m in a further 1.2 ks; both failed after max. 360 s. The post-irradiation examination revealed large stress-corrosion (SCC) type cladding cracks. Other cracks, down to a few μm deep, were probably early stages of large SCC cracks. Fission gas release in the intact pin was as high as 42% and estimated to be much lower for the two failed pins
ASTROPHYSICAL PARAMETERS AND HABITABLE ZONE OF THE EXOPLANET HOSTING STAR GJ 581
International Nuclear Information System (INIS)
Von Braun, Kaspar; Kane, Stephen R.; Ciardi, David R.; Boyajian, Tabetha S.; McAlister, Harold A.; Henry, Todd J.; Jao, Wei-Chun; Riedel, Adric R.; Van Belle, Gerard T.; Lopez-Morales, Mercedes; Subasavage, John P.; Schaefer, Gail; Ten Brummelaar, Theo A.; Sturmann, Laszlo; Sturmann, Judit; Mazingue, Jude; Turner, Nils H.; Farrington, Chris; Goldfinger, P. J.; Ridgway, Stephen
2011-01-01
GJ 581 is an M dwarf host of a multiplanet system. We use long-baseline interferometric measurements from the CHARA Array, coupled with trigonometric parallax information, to directly determine its physical radius to be 0.299 ± 0.010 R sun . Literature photometry data are used to perform spectral energy distribution fitting in order to determine GJ 581's effective surface temperature T EFF = 3498 ± 56 K and its luminosity L = 0.01205 ± 0.00024 L sun . From these measurements, we recompute the location and extent of the system's habitable zone and conclude that two of the planets orbiting GJ 581, planets d and g, spend all or part of their orbit within or just on the edge of the habitable zone.
An HST/STIS Optical Transmission Spectrum of Warm Neptune GJ 436b
Lothringer, Joshua D.; Benneke, Björn; Crossfield, Ian J. M.; Henry, Gregory W.; Morley, Caroline; Dragomir, Diana; Barman, Travis; Knutson, Heather; Kempton, Eliza; Fortney, Jonathan; McCullough, Peter; Howard, Andrew W.
2018-02-01
GJ 436b is a prime target for understanding warm Neptune exoplanet atmospheres and a target for multiple James Webb Space Telescope (JWST) Guaranteed Time Observation programs. Here, we report the first space-based optical transmission spectrum of the planet using two Hubble Space Telescope (HST) Space Telescope Imaging Spectrograph (STIS) transit observations from 0.53 to 1.03 μm. We find no evidence for alkali absorption features, nor evidence of a scattering slope longward of 0.53 μm. The spectrum is indicative of moderate to high metallicity (∼100–1000× solar), while moderate-metallicity scenarios (∼100× solar) require aerosol opacity. The optical spectrum also rules out some highly scattering haze models. We find an increase in transit depth around 0.8 μm in the transmission spectra of three different sub-Jovian exoplanets (GJ 436b, HAT-P-26b, and GJ 1214b). While most of the data come from STIS, data from three other instruments may indicate this is not an instrumental effect. Only the transit spectrum of GJ 1214b is well fit by a model with stellar plages on the photosphere of the host star. Our photometric monitoring of the host star reveals a stellar rotation rate of 44.1 days and an activity cycle of 7.4 years. Intriguingly, GJ 436 does not become redder as it gets dimmer, which is expected if star spots were dominating the variability. These insights into the nature of the GJ 436 system help refine our expectations for future observations in the era of JWST, whose higher precision and broader wavelength coverage will shed light on the composition and structure of GJ 436b’s atmosphere.
Astrophysical Parameters and Habitable Zone of the Exoplanet Hosting Star GJ 581
von Braun, Kaspar; Boyajian, Tabetha S.; Kane, Stephen R.; van Belle, Gerard T.; Ciardi, David R.; Lόpez-Morales, Mercedes; McAlister, Harold A.; Henry, Todd J.; Jao, Wei-Chun; Riedel, Adric R.; Subasavage, John P.; Schaefer, Gail; ten Brummelaar, Theo A.; Ridgway, Stephen; Sturmann, Laszlo
2011-01-01
GJ 581 is an M dwarf host of a multiplanet system. We use long-baseline interferometric measurements from the CHARA Array, coupled with trigonometric parallax information, to directly determine its physical radius to be $0.299 \\pm 0.010 R_{\\odot}$. Literature photometry data are used to perform spectral energy distribution fitting in order to determine GJ 581's effective surface temperature $T_{\\rm EFF}=3498 \\pm 56$ K and its luminosity $L=0.01205 \\pm 0.00024 L_{\\odot}$. From these measuremen...
Precise Masses & Radii of the Planets Orbiting K2-3 and GJ3470
Kosiarek, Molly; Crossfield, Ian; Hardegree-Ullman, Kevin; Livingston, John; Howard, Andrew; Fulton, Benjamin; Hirsch, Lea; Isaacson, Howard; Petigura, Erik; Sinukoff, Evan; Weiss, Lauren; Knutson, Heather; Bonfils, Xavier; Benneke, Björn; Beichman, Charles; Dressing, Courtney
2018-01-01
We report improved masses, radii, and densities for two planetary systems, K2-3 and GJ3470, derived from a combination of new radial velocity and transit observations. Both stars are nearby, early M dwarfs. K2-3 hosts three super-Earth planets between 1.5 and 2 Earth-radii at orbital periods between 10 and 45 days, while GJ 3470 hosts one 4 Earth-radii planet with a period of 3.3 days. Furthermore, we confirmed GJ3470's rotation period through multi-year ground-based photometry; RV analysis must account for this rotation signature. Due to the planets' low densities (all stars, they are among the best candidates for transmission spectroscopy with JWST and HST in order to characterize their atmospheric compositions.
Barnes, J. R.; Jeffers, S. V.; Haswell, C. A.; Jones, H. R. A.; Shulyak, D.; Pavlenko, Ya. V.; Jenkins, J. S.
2017-10-01
We aim to understand how stellar parameters such as mass and rotation impact the distribution of star-spots on the stellar surface. To this purpose, we have used Doppler imaging to reconstruct the surface brightness distributions of three fully convective M dwarfs with similar rotation rates. We secured high cadence spectral time series observations of the 5.5 au separation binary GJ 65, comprising GJ 65A (M5.5V, Prot = 0.24 d) and GJ 65B (M6V, Prot = 0.23 d). We also present new observations of GJ 791.2A (M4.5V, Prot = 0.31 d). Observations of each star were made on two nights with UVES, covering a wavelength range from 0.64 - 1.03μm. The time series spectra reveal multiple line distortions that we interpret as cool star-spots and which are persistent on both nights suggesting stability on the time-scale of 3 d. Spots are recovered with resolutions down to 8.3° at the equator. The global spot distributions for GJ 791.2A are similar to observations made a year earlier. Similar high latitude and circumpolar spot structure is seen on GJ 791.2A and GJ 65A. However, they are surprisingly absent on GJ 65B, which instead reveals more extensive, larger, spots concentrated at intermediate latitudes. All three stars show small amplitude latitude-dependent rotation that is consistent with solid body rotation. We compare our measurements of differential rotation with previous Doppler imaging studies and discuss the results in the wider context of other observational estimates and recent theoretical predictions.
Gj 832c: A super-Earth in the habitable zone
Energy Technology Data Exchange (ETDEWEB)
Wittenmyer, Robert A.; Horner, Jonathan; Tinney, C. G.; Marshall, J. P.; Bailey, J.; Salter, G. S.; Wright, D. [School of Physics, UNSW Australia, Sydney, NSW 2052 (Australia); Tuomi, Mikko; Jones, H. R. A. [Centre for Astrophysics Research, Science and Technology Research Institute, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Butler, R. P.; Arriagada, P. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road, NW, Washington, DC 20015-1305 (United States); Anglada-Escudé, Guillem [Astronomy Unit, School of Mathematical Sciences, Queen Mary, University of London, London (United Kingdom); Carter, B. D. [Computational Engineering and Science Research Centre, University of Southern Queensland, Toowoomba, Queensland 4350 (Australia); O' Toole, S. J. [Australian Astronomical Observatory, P.O. Box 915, North Ryde, NSW 1670 (Australia); Crane, J. D.; Schectman, S. A.; Thompson, I. [The Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Minniti, D. [Institute of Astrophysics, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Jenkins, J. S.; Diaz, M., E-mail: rob@phys.unsw.edu.au [Departamento de Astronomía, Universidad de Chile, Camino el Observatorio 1515, Casilla 36-D, Las Condes, Santiago (Chile)
2014-08-20
We report the detection of GJ 832c, a super-Earth orbiting near the inner edge of the habitable zone of GJ 832, an M dwarf previously known to host a Jupiter analog in a nearly circular 9.4 yr orbit. The combination of precise radial-velocity measurements from three telescopes reveals the presence of a planet with a period of 35.68 ± 0.03 days and minimum mass (m sin i) of 5.4 ± 1.0 Earth masses. GJ 832c moves on a low-eccentricity orbit (e = 0.18 ± 0.13) toward the inner edge of the habitable zone. However, given the large mass of the planet, it seems likely that it would possess a massive atmosphere, which may well render the planet inhospitable. Indeed, it is perhaps more likely that GJ 832c is a 'super-Venus', featuring significant greenhouse forcing. With an outer giant planet and an interior, potentially rocky planet, the GJ 832 planetary system can be thought of as a miniature version of our own solar system.
Ohno, Kazumasa; Okuzumi, Satoshi
2018-05-01
The ubiquity of clouds in the atmospheres of exoplanets, especially of super-Earths, is one of the outstanding issues for the transmission spectra survey. Understanding the formation process of clouds in super-Earths is necessary to interpret the observed spectra correctly. In this study, we investigate the vertical distributions of particle size and mass density of mineral clouds in super-Earths using a microphysical model that takes into account the vertical transport and growth of cloud particles in a self-consistent manner. We demonstrate that the vertical profiles of mineral clouds significantly vary with the concentration of cloud condensation nuclei and atmospheric metallicity. We find that the height of the cloud top increases with increasing metallicity as long as the metallicity is lower than the threshold. If the metallicity is larger than the threshold, the cloud-top height no longer increases appreciably with metallicity because coalescence yields larger particles of higher settling velocities. We apply our cloud model to GJ1214 b and GJ436 b, for which recent transmission observations suggest the presence of high-altitude opaque clouds. For GJ436 b, we show that KCl particles can ascend high enough to explain the observation. For GJ1214 b, by contrast, the height of KCl clouds predicted from our model is too low to explain its flat transmission spectrum. Clouds made of highly porous KCl particles could explain the observations if the atmosphere is highly metal-rich, and hence the particle microstructure might be a key to interpret the flat spectrum of GJ1214 b.
Energy Technology Data Exchange (ETDEWEB)
Morley, Caroline V. [Department of Astronomy, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States); Knutson, Heather [Division of Geological and Planetary Sciences, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Line, Michael [School of Earth and Space Exploration, Arizona State University, 781 South Terrace Road, Tempe, AZ 85281 (United States); Fortney, Jonathan J.; Teal, Dillon [Department of Astronomy and Astrophysics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Thorngren, Daniel [Department of Physics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Marley, Mark S.; Lupu, Roxana, E-mail: caroline.morley@cfa.harvard.edu [NASA Ames Research Center, Moffett Field, CA 94035 (United States)
2017-02-01
The Neptune-mass GJ 436b is one of the most studied transiting exoplanets with repeated measurements of its thermal emission and transmission spectra. We build on previous studies to answer outstanding questions about this planet, including its potentially high metallicity and tidal heating of its interior. We present new observations of GJ 436b’s thermal emission at 3.6 and 4.5 μ m, which reduce uncertainties in estimates of GJ 436b’s flux at those wavelengths and demonstrate consistency between Spitzer observations spanning more than 7 yr. We analyze the Spitzer thermal emission photometry and Hubble WFC3 transmission spectrum. We use a dual-pronged modeling approach of both self-consistent and retrieval models. We vary the metallicity, intrinsic luminosity from tidal heating, disequilibrium chemistry, and heat redistribution. We also study clouds and photochemical hazes, but do not find strong evidence for either. The self-consistent and retrieval models combine to suggest that GJ 436b has a high atmospheric metallicity, with best fits at or above several hundred times solar metallicity, tidal heating warming its interior with best-fit intrinsic effective temperatures around 300–350 K, and disequilibrium chemistry. High metal enrichments (>600× solar) occur from the accretion of rocky, rather than icy, material. Assuming the interior temperature T {sub int} ∼ 300–350 K, we find a dissipation factor Q ′ ∼ 2 × 10{sup 5}–10{sup 6}, larger than Neptune’s Q ′, implying a long tidal circularization timescale for the orbit. We suggest that Neptune-mass planets may be more diverse than imagined, with metal enhancements spanning several orders of magnitude, to perhaps over 1000× solar metallicity. High-fidelity observations with instruments like the James Webb Space Telescope will be critical for characterizing this diversity.
Energy Technology Data Exchange (ETDEWEB)
Skemer, Andrew J.; Leisenring, Jarron; Bailey, Vanessa; Hinz, Philip; Defrére, Denis; Apai, Dániel; Close, Laird; Eisner, Josh [Steward Observatory, University of Arizona, 933 North Cherry Ave. Tucson, AZ 85721 (United States); Morley, Caroline V.; Fortney, Jonathan [University of California, Santa Cruz, 1156 High St. Santa Cruz, CA 95064 (United States); Zimmerman, Neil T.; Buenzli, Esther; Bonnefoy, Mickael; Biller, Beth; Brandner, Wolfgang [Max Planck Institute for Astronomy, Königstuhl 17, 69117 Heidelberg (Germany); Skrutskie, Michael F. [University of Virginia, 530 McCormick Rd., Charlottesville, VA 22904 (United States); Esposito, Simone [Istituto Nazionale di Astrofisica-Arcetri Astrophysical Observatory, Largo Enrico Fermi 5, 50125, Florence (Italy); Crepp, Justin R. [Notre Dame University, 225 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); De Rosa, Robert J. [Arizona State University, 781 South Terrace Rd, Tempe, AZ 85281 (United States); Desidera, Silvano [Istituto Nazionale di Astrofisica-Padova Astronomical Observatory, Vicolo dell’Osservatorio 5, 35122 Padova (Italy); and others
2016-02-01
As gas giant planets and brown dwarfs radiate away the residual heat from their formation, they cool through a spectral type transition from L to T, which encompasses the dissipation of cloud opacity and the appearance of strong methane absorption. While there are hundreds of known T-type brown dwarfs, the first generation of directly imaged exoplanets were all L type. Recently, Kuzuhara et al. announced the discovery of GJ 504 b, the first T dwarf exoplanet. GJ 504 b provides a unique opportunity to study the atmosphere of a new type of exoplanet with a ∼500 K temperature that bridges the gap between the first directly imaged planets (∼1000 K) and our own solar system's Jupiter (∼130 K). We observed GJ 504 b in three narrow L-band filters (3.71, 3.88, and 4.00 μm), spanning the red end of the broad methane fundamental absorption feature (3.3 μm) as part of the LBTI Exozodi Exoplanet Common Hunt (LEECH) exoplanet imaging survey. By comparing our new photometry and literature photometry with a grid of custom model atmospheres, we were able to fit GJ 504 b's unusual spectral energy distribution for the first time. We find that GJ 504 b is well fit by models with the following parameters: T{sub eff} = 544 ± 10 K, g < 600 m s{sup −2}, [M/H] = 0.60 ± 0.12, cloud opacity parameter of f{sub sed} = 2–5, R = 0.96 ± 0.07 R{sub Jup}, and log(L) = −6.13 ± 0.03 L{sub ⊙}, implying a hot start mass of 3–30 M{sub jup} for a conservative age range of 0.1–6.5 Gyr. Of particular interest, our model fits suggest that GJ 504 b has a superstellar metallicity. Since planet formation can create objects with nonstellar metallicities, while binary star formation cannot, this result suggests that GJ 504 b formed like a planet, not like a binary companion.
Konverents Gjøvikis tuleb juunis / Sirje Virkus
Virkus, Sirje, 1956-
1999-01-01
1.-4. maini toimus Gjøvikis rahvusvahelise konverentsi "Telecommunication in Education and Training : TET 99" ettevalmistuskomisjoni koosolek, mille tööst võttis osa konverentsi programmikomitee liige Sirje Virkus
High-Contrast 3.8 Micron Imaging of the Brown Dwarf/Planet-Mass Companion to GJ 758
Currie, Thayne M.; Bailey, Vanessa; Fabrycky, Daniel; Murray-Clay, Ruth; Rodigas, Timothy; Hinz, Phil
2011-01-01
We present L' band (3.8 Micron) MMT/Clio high-contrast imaging data for the nearby star GJ 758, which was recently reported by Thalmann et al. (2009) to have one - possibly two - faint comoving companions (GJ 7588 and "C", respectively). GJ 758B is detected in two distinct datasets. Additionally, we report a \\textit{possible} detection of the object identified by Thalmann et al as "GJ 758C" in our more sensitive dataset, though it is likely a residual speckle. However, if it is the same object as that reported by Thalmann et al. it cannot be a companion in a bound orbit. GJ 7588 has a H-L' color redder than nearly all known L-T8 dwarfs. 8ased on comparisons with the COND evolutionary models, GJ 7588 has Te approx. 560 K (+150 K, -90 K) and a mass ranging from approx.10-20 Mj if it is approx.1 Gyr old to approx. 25-40 Mj if it is 8.7 Gyr old. GJ 7588 is likely in a highly eccentric orbit, e approx. 0.73 (+0.12,-0.21), with a semimajor axis of approx. 44 AU (+32 AU, -14 AU). Though GJ 7588 is sometimes discussed within the context of exoplanet direct imaging, its mass is likely greater than the deuterium-burning limit and its formation may resemble that of binary stars rather than that of jovian-mass planets.
A System of Three Super Earths Transiting the Late K-Dwarf GJ 9827 at 30 pc
Rodriguez, Joseph E.; Vanderburg, Andrew; Eastman, Jason D.; Mann, Andrew W.; Crossfield, Ian J. M.; Ciardi, David R.; Latham, David W.; Quinn, Samuel N.
2018-02-01
We report the discovery of three small transiting planets orbiting GJ 9827, a bright (K = 7.2) nearby late K-type dwarf star. GJ 9827 hosts a 1.62 ± 0.11 {R}\\oplus super Earth on a 1.2 day period, a {1.269}-0.089+0.087 {R}\\oplus super Earth on a 3.6 day period, and a 2.07 ± 0.14 {R}\\oplus super Earth on a 6.2 day period. The radii of the planets transiting GJ 9827 span the transition between predominantly rocky and gaseous planets, and GJ 9827 b and c fall in or close to the known gap in the radius distribution of small planets between these populations. At a distance of 30 pc, GJ 9827 is the closest exoplanet host discovered by K2 to date, making these planets well-suited for atmospheric studies with the upcoming James Webb Space Telescope. The GJ 9827 system provides a valuable opportunity to characterize interior structure and atmospheric properties of coeval planets spanning the rocky to gaseous transition.
TWO NEARBY SUB-EARTH-SIZED EXOPLANET CANDIDATES IN THE GJ 436 SYSTEM
International Nuclear Information System (INIS)
Stevenson, Kevin B.; Harrington, Joseph; Lust, Nate B.; Blecic, Jasmina; Hardy, Ryan A.; Cubillos, Patricio; Campo, Christopher J.; Lewis, Nikole K.; Montagnier, Guillaume; Moses, Julianne I.; Visscher, Channon
2012-01-01
We report the detection of UCF-1.01, a strong exoplanet candidate with a radius 0.66 ± 0.04 times that of Earth (R ⊕ ). This sub-Earth-sized planet transits the nearby M-dwarf star GJ 436 with a period of 1.365862 ± 8 × 10 –6 days. We also report evidence of a 0.65 ± 0.06 R ⊕ exoplanet candidate (labeled UCF-1.02) orbiting the same star with an undetermined period. Using the Spitzer Space Telescope, we measure the dimming of light as the planets pass in front of their parent star to assess their sizes and orbital parameters. If confirmed today, UCF-1.01 and UCF-1.02 would be designated GJ 436c and GJ 436d, respectively, and would be part of the first multiple-transiting-planet system outside of the Kepler field. Assuming Earth-like densities of 5.515 g cm –3 , we predict both candidates to have similar masses (∼0.28 Earth-masses, M ⊕ , 2.6 Mars-masses) and surface gravities of ∼0.65 g (where g is the gravity on Earth). UCF-1.01's equilibrium temperature (T eq , where emitted and absorbed radiation balance for an equivalent blackbody) is 860 K, making the planet unlikely to harbor life as on Earth. Its weak gravitational field and close proximity to its host star imply that UCF-1.01 is unlikely to have retained its original atmosphere; however, a transient atmosphere is possible if recent impacts or tidal heating were to supply volatiles to the surface. We also present additional observations of GJ 436b during secondary eclipse. The 3.6 μm light curve shows indications of stellar activity, making a reliable secondary eclipse measurement impossible. A second non-detection at 4.5 μm supports our previous work in which we find a methane-deficient and carbon monoxide-rich dayside atmosphere.
Two nearby Sub-Earth-sized Exoplanet Candidates in the GJ 436 System
Stevenson, Kevin B.; Harrington, Joseph; Lust, Nate B.; Lewis, Nikole K.; Montagnier, Guillaume; Moses, Julianne I.; Visscher, Channon; Blecic, Jasmina; Hardy, Ryan A.; Cubillos, Patricio; Campo, Christopher J.
2012-08-01
We report the detection of UCF-1.01, a strong exoplanet candidate with a radius 0.66 ± 0.04 times that of Earth (R ⊕). This sub-Earth-sized planet transits the nearby M-dwarf star GJ 436 with a period of 1.365862 ± 8 × 10-6 days. We also report evidence of a 0.65 ± 0.06 R ⊕ exoplanet candidate (labeled UCF-1.02) orbiting the same star with an undetermined period. Using the Spitzer Space Telescope, we measure the dimming of light as the planets pass in front of their parent star to assess their sizes and orbital parameters. If confirmed today, UCF-1.01 and UCF-1.02 would be designated GJ 436c and GJ 436d, respectively, and would be part of the first multiple-transiting-planet system outside of the Kepler field. Assuming Earth-like densities of 5.515 g cm-3, we predict both candidates to have similar masses (~0.28 Earth-masses, M ⊕, 2.6 Mars-masses) and surface gravities of ~0.65 g (where g is the gravity on Earth). UCF-1.01's equilibrium temperature (T eq, where emitted and absorbed radiation balance for an equivalent blackbody) is 860 K, making the planet unlikely to harbor life as on Earth. Its weak gravitational field and close proximity to its host star imply that UCF-1.01 is unlikely to have retained its original atmosphere; however, a transient atmosphere is possible if recent impacts or tidal heating were to supply volatiles to the surface. We also present additional observations of GJ 436b during secondary eclipse. The 3.6 μm light curve shows indications of stellar activity, making a reliable secondary eclipse measurement impossible. A second non-detection at 4.5 μm supports our previous work in which we find a methane-deficient and carbon monoxide-rich dayside atmosphere.
QUANTITATIVELY ASSESSING THE ROLE OF CLOUDS IN THE TRANSMISSION SPECTRUM OF GJ 1214b
Energy Technology Data Exchange (ETDEWEB)
Morley, Caroline V.; Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Kempton, Eliza M.-R. [Department of Physics, Grinnell College, Grinnell, IA 50112 (United States); Marley, Mark S.; Zahnle, Kevin [NASA Ames Research Center, 245-3, Moffett Field, CA 94035 (United States); Vissher, Channon, E-mail: cmorley@ucolick.org [Southwest Research Institute, Boulder, CO 80302 (United States)
2013-09-20
Recent observations of the super-Earth GJ 1214b show that it has a relatively featureless transmission spectrum. One suggestion is that these observations indicate that the planet's atmosphere is vertically compact, perhaps due to a water-rich composition that yields a large mean molecular weight. Another suggestion is that the atmosphere is hydrogen/helium-rich with clouds that obscure predicted absorption features. Previous models that incorporate clouds have included their effect without a strong physical motivation for their existence. Here, we present model atmospheres of GJ 1214b that include physically motivated clouds of two types. We model the clouds that are present in chemical equilibrium, as has been suggested to occur on brown dwarfs, which include KCl and ZnS for this planet. We also include clouds that form as a result of photochemistry, forming a hydrocarbon haze layer. We use a photochemical kinetics model to understand the vertical distribution and available mass of haze-forming molecules. We model both solar and enhanced-metallicity cloudy models and determine the cloud properties necessary to match observations. In enhanced-metallicity atmospheres, we find that the equilibrium clouds can match the observations of GJ 1214b if they are lofted high into the atmosphere and have a low sedimentation efficiency (f{sub sed} = 0.1). We find that models with a variety of hydrocarbon haze properties can match the observations. Particle sizes from 0.01 to 0.25 μm can match the transmission spectrum with haze-forming efficiencies as low as 1%-5%.
Vekst, metabolisme og ølbrygging med melkesyrebakterier og gjær
Kvam, Guro
2017-01-01
Ølbrygging er et håndverk forbundet med lange tradisjoner, med røtter tilbake til det 12. århundrets Europa. Før dagens mikrobiologiske teknikker ble oppfunnet var all øl spontangjæret med en kompleks sammensetning av ulike gjær- og bakteriestammer. I dag produseres fremdeles enkelte av disse ølsortene under navn som lambic, geuze eller Berliner weisse, og interessen for slike ølsorter har økt betraktelig de siste årene. Mange bryggerier benytter i dag kjente kulturer av gjær og melkesyrebakt...
SPITZER TRANSITS OF THE SUPER-EARTH GJ1214b AND IMPLICATIONS FOR ITS ATMOSPHERE
Energy Technology Data Exchange (ETDEWEB)
Fraine, Jonathan D.; Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Gillon, Michaeel; Jehin, Emmanueel [Institute d' Astrophysique et de Geophysique, Universite de Liege, Liege (Belgium); Demory, Brice-Olivier; Benneke, Bjoern; Seager, Sara [Department of Earth, Atmospheric and Planetary Sciences, and Department of Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Lewis, Nikole K. [Department of Planetary Sciences and Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Knutson, Heather [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Desert, Jean-Michel, E-mail: jfraine@astro.umd.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States)
2013-03-10
We observed the transiting super-Earth exoplanet GJ1214b using warm Spitzer at 4.5 {mu}m wavelength during a 20 day quasi-continuous sequence in 2011 May. The goals of our long observation were to accurately define the infrared transit radius of this nearby super-Earth, to search for the secondary eclipse, and to search for other transiting planets in the habitable zone of GJ1214. We here report results from the transit monitoring of GJ1214b, including a reanalysis of previous transit observations by Desert et al. In total, we analyze 14 transits of GJ1214b at 4.5 {mu}m, 3 transits at 3.6 {mu}m, and 7 new ground-based transits in the I+z band. Our new Spitzer data by themselves eliminate cloudless solar composition atmospheres for GJ1214b, and methane-rich models from Howe and Burrows. Using our new Spitzer measurements to anchor the observed transit radii of GJ1214b at long wavelengths, and adding new measurements in I+z, we evaluate models from Benneke and Seager and Howe and Burrows using a {chi}{sup 2} analysis. We find that the best-fit model exhibits an increase in transit radius at short wavelengths due to Rayleigh scattering. Pure water atmospheres are also possible. However, a flat line (no atmosphere detected) remains among the best of the statistically acceptable models, and better than pure water atmospheres. We explore the effect of systematic differences among results from different observational groups, and we find that the Howe and Burrows tholin-haze model remains the best fit, even when systematic differences among observers are considered.
Jo, Se Yeon; Choi, Eun A; Lee, Jae Joon; Chang, Hae Choon
2015-10-01
The hypocholesterolemic effects of lactic acid bacteria and kimchi have been demonstrated previously. However, the kimchi fermentation process still relies on naturally present microorganisms. To obtain functional kimchi with consistent quality, we validated the capacity of Leuconostoc kimchii GJ2 as a starter culture to control kimchi fermentation. Moreover, cholesterol-lowering effects of starter kimchi as a health-promoting product were explored. Bacteriocin production by Lc. kimchii GJ2 was highly enhanced in the presence of 5% Lactobacillus sakei NJ1 cell fractions. When kimchi was fermented with bacteriocin-enhanced Lc. kimchii GJ2, Lc. kimchii GJ2 became overwhelmingly predominant (98.3%) at the end of fermentation and maintained its dominance (up to 82%) for 84 days. Growing as well as dead cells of Lc. kimchii GJ2 showed high cholesterol assimilation (in vitro). Rats were fed a high-fat and high-cholesterol diet supplemented with starter kimchi. The results showed that feeding of starter kimchi significantly reduced serum total cholesterol, triglyceride and low-density lipoprotein cholesterol levels. Additionally, atherogenic index, cardiac risk factor and triglyceride and total cholesterol levels in liver and epididymal adipose tissue decreased significantly in rats fed starter kimchi. Kimchi fermented with Lc. kimchii GJ2 as a starter culture has efficient cholesterol-lowering effects. © 2014 Society of Chemical Industry.
Introduction. G.J. Hoogewerff, Explorer in Art History
Krul, Wessel; van Egmond, Anna-Maria; Chavannes-Mazel, Claudine A.
2014-01-01
G.J. Hoogewerff (1884-1963) was director of the Netherlands Historical Institute in Rome, professor at the University of Utrecht, and director of the Netherlands Art Historical Institute in Florence. In 2012, it was the 75th anniversary of the publication of his five-volume history of medieval
Lyman-alpha transit observations of the warm rocky exoplanet GJ1132b
Waalkes, William; Berta-Thompson, Zachory K.; Charbonneau, David; Irwin, Jonathan; Newton, Elisabeth; Dittmann, Jason; Bourrier, Vincent; Ehrenreich, David; Kempton, Eliza; Will
2018-06-01
GJ1132b is one of the few known Earth-sized planets, and at 12pc away it is also one of the closest known transiting planets. With an equilibrium temperature of 500 K, this planet is too hot to be habitable but we can use it to learn about the presence and volatile content of rocky planet atmospheres around M dwarf stars. Using Hubble STIS spectra obtained during primary transit, we search for a Lyman-α transit. If we were to observe a deep Lyman-α transit, that would indicate the presence of a neutral hydrogen envelope flowing from GJ1132b. On the other hand, ruling out deep absorption from neutral hydrogen may indicate that this planet has either retained its volatiles or lost them very early in the star’s life. We carry out this analysis by extracting 1D spectra from the STIS pipeline, splitting the time-tagged spectra into higher resolution samples, and producing light curves of the red and blue wings of the Lyman-α line. We fit for the baseline stellar flux and transit depths in order to constrain the characteristics of the cloud of neutral hydrogen gas that may surround the planet. We do not conclusively detect a transit but the results provide an upper limit for the transit depth. We also analyze the stellar variability and Lyman-α spectrum of GJ1132, a slowly-rotating 0.18 solar mass M dwarf with previously uncharacterized UV activity. Understanding the role that UV variability plays in planetary atmospheres and volatile retention is crucial to assess atmospheric evolution and the habitability of cooler rocky planets.
The role of the Cx43 C-terminus in GJ plaque formation and internalization
International Nuclear Information System (INIS)
Wayakanon, Praween; Bhattacharjee, Rajib; Nakahama, Ken-ichi; Morita, Ikuo
2012-01-01
Highlights: ► Cx43-GFP or -DsRed fusion proteins were expressed in HeLa cells. ► Roles of C-terminus were examined using various mutants. ► Gap junction plaque size was dependent on the length of C-terminus. ► C-terminus dependent gap junction plaque internalization was observed. -- Abstract: Connexin 43 (Cx43) is a major gap junction (GJ) protein found in many mammalian cell types. The C-terminal (CT) domain of Cx43 has unique characteristics in terms of amino acid (aa) sequence and its length differs from other connexins. This CT domain can be associated with protein partners to regulate GJ assembly and degradation, which results in the direct control of gap junction intercellular communication (GJIC). However, the essential roles of the CT regions involved in these mechanisms have not been fully elucidated. In this study, we aimed to investigate the specific regions of Cx43CT involved in GJ formation and internalization. Wild type Cx43 (382aa) and 10 CT truncated mutants were stably expressed in HeLa cells as GFP or DsRed tagged proteins. First, we found that the deletion of 235–382aa from Cx43 resulted in failure to make GJ and establish GJIC. Second, the Cx43 with 242–382aa CT deletion could form functional GJs and be internalized as annular gap junctions (AGJs). However, the plaques consisting of Cx43 with CT deletions (Δ242–382aa to Δ271–382aa) were longer than the plaques consisting of Cx43 with CT deletions (Δ302–382aa). Third, co-culture experiments of cells expressing wild type Cx43 (382) with cells expressing Cx43CT mutants revealed that the directions of GJ internalization were dependent on the length of the respective CT. Moreover, a specific region, 325–342aa residues of Cx43, played an important role in the direction of GJ internalization. These results showed the important roles of the Cx43 C-terminus in GJ expression and its turnover.
A SEARCH FOR ADDITIONAL PLANETS IN THE NASA EPOXI OBSERVATIONS OF THE EXOPLANET SYSTEM GJ 436
International Nuclear Information System (INIS)
Ballard, Sarah; Christiansen, Jessie L.; Charbonneau, David; Holman, Matthew J.; Fabrycky, Daniel; Deming, Drake; Barry, Richard K.; Kuchner, Marc J.; Livengood, Timothy A.; Hewagama, Tilak; A'Hearn, Michael F.; Wellnitz, Dennis D.; Sunshine, Jessica M.; Hampton, Don L.; Lisse, Carey M.; Seager, Sara; Veverka, Joseph F.
2010-01-01
We present time series photometry of the M dwarf transiting exoplanet system GJ 436 obtained with the Extrasolar Planet Observation and Characterization (EPOCh) component of the NASA EPOXI mission. We conduct a search of the high-precision time series for additional planets around GJ 436, which could be revealed either directly through their photometric transits or indirectly through the variations these second planets induce on the transits of the previously known planet. In the case of GJ 436, the presence of a second planet is perhaps indicated by the residual orbital eccentricity of the known hot Neptune companion. We find no candidate transits with significance higher than our detection limit. From Monte Carlo tests of the time series, we rule out transiting planets larger than 1.5 R + interior to GJ 436b with 95% confidence and larger than 1.25 R + with 80% confidence. Assuming coplanarity of additional planets with the orbit of GJ 436b, we cannot expect that putative planets with orbital periods longer than about 3.4 days will transit. However, if such a planet were to transit, we would rule out planets larger than 2.0 R + with orbital periods less than 8.5 days with 95% confidence. We also place dynamical constraints on additional bodies in the GJ 436 system, independent of radial velocity measurements. Our analysis should serve as a useful guide for similar analyses of transiting exoplanets for which radial velocity measurements are not available, such as those discovered by the Kepler mission. From the lack of observed secular perturbations, we set upper limits on the mass of a second planet as small as 10 M + in coplanar orbits and 1 M + in non-coplanar orbits close to GJ 436b. We present refined estimates of the system parameters for GJ 436. We find P = 2.64389579 ± 0.00000080 d, R * = 0.437 ± 0.016 R sun , and R p = 3.880 ± 0.147 R + . We also report a sinusoidal modulation in the GJ 436 light curve that we attribute to star spots. This signal is
14 CFR 31.43 - Fitting factor.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fitting factor. 31.43 Section 31.43... STANDARDS: MANNED FREE BALLOONS Design Construction § 31.43 Fitting factor. (a) A fitting factor of at least... structure. This factor applies to all parts of the fitting, the means of attachment, and the bearing on the...
Dosimetry measurements during the commissioning of the GJ-2 electron accelerator
DEFF Research Database (Denmark)
Chosdu, R.; Hilmy, N.; Tobing, R.
1995-01-01
The GJ-2 electron accelerator (made in China, Sanghai) was put into operation at the Centre for Application of Isotopes and Radiation in Jakarta, Indonesia. In the course of the commissioning of the machine its main technical parameters were measured under different operating conditions. The elec......The GJ-2 electron accelerator (made in China, Sanghai) was put into operation at the Centre for Application of Isotopes and Radiation in Jakarta, Indonesia. In the course of the commissioning of the machine its main technical parameters were measured under different operating conditions......, ethanol-chlorobenzene dosimeter solution and FWT-60 film dosimeters. The applicability of polystyrene calorimeters designed for low electron energies at Ris phi National Laboratory was also tested for nominal dose determination....
Mallonn, M.; Herrero, E.; Juvan, I. G.; Essen, C. von; Rosich, A.; Ribas, I.; Granzer, T.; Alexoudi, X.; Strassmeier, K. G.
2018-06-01
Aims: Brightness inhomogeneities in the stellar photosphere (dark spots or bright regions) affect the measurements of the planetary transmission spectrum. To investigate the star spots of the M dwarf GJ 1214, we conducted a multicolor photometric monitoring from 2012 to 2016. Methods: The time-series photometry was analyzed with the light curve inversion tool StarSim. Using the derived stellar surface properties from the light curve inversion, we modeled the impact of the star spots when unocculted by the transiting planet. We compared the photometric variability of GJ 1214 to published results of mid- to late M dwarfs from the MEarth sample. Results: The measured variability shows a periodicity of 125 ± 5 days, which we interpret as the signature of the stellar rotation period. This value overrules previous suggestions of a significantly shorter stellar rotation period. A light curve inversion of the monitoring data yields an estimation of the flux dimming of a permanent spot filling factor not contributing to the photometric variability, a temperature contrast of the spots of 370 K and persistent active longitudes. The derived surface maps over all five seasons were used to estimate the influence of the star spots on the transmission spectrum of the planet from 400 to 2000 nm. The monitoring data presented here do not support a recent interpretation of a measured transmission spectrum of GJ 1214b as to be caused by bright regions in the stellar photosphere. Instead, we list arguments as to why the effect of dark spots likely dominated over bright regions in the period of our monitoring. Furthermore, our photometry proves an increase in variability over at least four years, indicative for a cyclic activity behavior. The age of GJ 1214 is likely between 6 and 10 Gyr. Conclusions: The long-term photometry allows for a correction of unocculted spots. For an active star such as GJ 1214, there remains a degeneracy between occulted spots and the transit parameters used
14 CFR 31.23 - Flight load factor.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight load factor. 31.23 Section 31.23... STANDARDS: MANNED FREE BALLOONS Strength Requirements § 31.23 Flight load factor. In determining limit load, the limit flight load factor must be at least 1.4. ...
Waalkes, William; Berta-Thompson, Zachory; Charbonneau, David; Irwin, Jonathan; Newton, Elisabeth; Dittmann, Jason; Bourrier, Vincent; Ehrenreich, David; Kempton, Eliza
2018-01-01
GJ1132b is one of the few known Earth-sized planets, and at 12 pc away it is also one of the closest known transiting planets. With an equilibrium temperature of 500 K, this planet is too hot to be habitable but we can use it to learn about the presence and volatile content of rocky planet atmospheres around M dwarf stars. Using Hubble STIS spectra during primary transit, we explore the potential for UV transit detections of GJ1132b. If we were to observe a deep Lyman-α transit, that would indicate the presence of a neutral hydrogen envelope flowing from GJ1132b. On the other hand, ruling out deep absorption from neutral hydrogen may indicate that this planet has either retained its volatiles or lost them very early in the star’s life. We carry out this analysis by extracting 1D spectra from the STIS pipeline, splitting the time-tagged spectra into higher resolution samples, and producing light curves of the red and blue wings of the Lyman-α line. We fit for the baseline stellar flux and transit depths in order to constrain the characteristics of the cloud of neutral hydrogen gas that may surround the planet. Our work extends beyond the transit study into an analysis of the stellar variability and Lyman-α spectrum of GJ1132, a slowly-rotating 0.18 MSun M dwarf with previously uncharacterized UV activity. Understanding the role that UV variability plays in planetary atmospheres and volatile retention is crucial to assess atmospheric evolution and the habitability of cooler rocky planets.
14 CFR 31.25 - Factor of safety.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Factor of safety. 31.25 Section 31.25... STANDARDS: MANNED FREE BALLOONS Strength Requirements § 31.25 Factor of safety. (a) Except as specified in paragraphs (b) and (c) of this section, the factor of safety is 1.5. (b) A factor of safety of at least five...
Numerical study of stress distribution and size effect during AZ31 nanoindentation
Czech Academy of Sciences Publication Activity Database
Šiška, Filip; Guo, T.; Stratil, Luděk; Čížek, J.; Barnett, M.
2017-01-01
Roč. 126, JAN (2017), s. 393-399 ISSN 0927-0256 R&D Projects: GA ČR GJ15-21292Y Institutional support: RVO:68081723 Keywords : Crystal plasticity * FEM * Magnesium alloys * Nano indentation * Twinning Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 2.292, year: 2016
HIGH METALLICITY AND NON-EQUILIBRIUM CHEMISTRY IN THE DAYSIDE ATMOSPHERE OF HOT-NEPTUNE GJ 436b
International Nuclear Information System (INIS)
Madhusudhan, N.; Seager, S.
2011-01-01
We present a detailed analysis of the dayside atmosphere of the hot-Neptune GJ 436b, based on recent Spitzer observations. We report statistical constraints on the thermal and chemical properties of the planetary atmosphere, study correlations between the various molecular species, and discuss scenarios of equilibrium and non-equilibrium chemistry in GJ 436b. We model the atmosphere with a one-dimensional line-by-line radiative transfer code with parameterized molecular abundances and temperature structure. We explore the model parameter space with 10 6 models, using a Markov chain Monte Carlo scheme. Our results encompass previous findings, indicating a paucity of methane, an overabundance of CO and CO 2 , and a slight underabundance of H 2 O, as compared to equilibrium chemistry with solar metallicity. The concentrations of the species are highly correlated. Our best-fit, and most plausible, constraints require a CH 4 mixing ratio of 10 -7 to10 -6 , with CO ≥10 -3 , CO 2 ∼10 -6 to10 -4 , and H 2 O ≤10 -4 ; higher CH 4 would require much higher CO and CO 2 . Based on calculations of equilibrium and non-equilibrium chemistry, we find that the observed abundances can potentially be explained by a combination of high metallicity (∼10x solar) and vertical mixing with K zz ∼ 10 6 -10 7 cm 2 s -1 . The inferred metallicity is enhanced over that of the host star which is known to be consistent with solar metallicity. Our constraints rule out a dayside thermal inversion in GJ 436b. We emphasize that the constraints reported in this work depend crucially on the observations in the two Spitzer channels at 3.6 μm and 4.5 μm. Future observations with warm Spitzer and with the James Webb Space Telescope will be extremely important to improve upon the present constraints on the abundances of carbon species in the dayside atmosphere of GJ 436b.
RAYLEIGH SCATTERING IN THE ATMOSPHERE OF THE WARM EXO-NEPTUNE GJ 3470B
International Nuclear Information System (INIS)
Dragomir, Diana; Benneke, Björn; Pearson, Kyle A.; Crossfield, Ian J. M.; Barman, Travis; Eastman, Jason; Biddle, Lauren I.
2015-01-01
GJ 3470b is a warm Neptune-size planet transiting an M dwarf star. Like the handful of other small exoplanets for which transmission spectroscopy has been obtained, GJ 3470b exhibits a flat spectrum in the near- and mid-infrared. Recently, a tentative detection of Rayleigh scattering in its atmosphere has been reported. This signal manifests itself as an observed increase of the planetary radius as a function of decreasing wavelength in the visible. We set out to verify this detection and observed several transits of this planet with the LCOGT network and the Kuiper telescope in four different bands (Sloan g, Sloan i, Harris B, and Harris V). Our analysis reveals a strong Rayleigh scattering slope, thus confirming previous results. This makes GJ 3470b the smallest known exoplanet with a detection of Rayleigh scattering. We find that the most plausible scenario is a hydrogen/helium-dominated atmosphere covered by clouds which obscure absorption features in the infrared and hazes which give rise to scattering in the visible. Our results demonstrate the feasibility of exoplanet atmospheric characterization from the ground, even with meter-class telescopes
RAYLEIGH SCATTERING IN THE ATMOSPHERE OF THE WARM EXO-NEPTUNE GJ 3470B
Energy Technology Data Exchange (ETDEWEB)
Dragomir, Diana [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive Suite 102, Goleta, CA 93117 (United States); Benneke, Björn [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Pearson, Kyle A. [Department of Physics and Astronomy, Northern Arizona University, Flagstaff, AZ 86001 (United States); Crossfield, Ian J. M.; Barman, Travis [Department of Planetary Sciences, Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Eastman, Jason [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Biddle, Lauren I., E-mail: diana@oddjob.uchicago.edu [Gemini Observatory, Northern Operations Center, 670 N. Aohoku Place, Hilo, HI 96720 (United States)
2015-12-01
GJ 3470b is a warm Neptune-size planet transiting an M dwarf star. Like the handful of other small exoplanets for which transmission spectroscopy has been obtained, GJ 3470b exhibits a flat spectrum in the near- and mid-infrared. Recently, a tentative detection of Rayleigh scattering in its atmosphere has been reported. This signal manifests itself as an observed increase of the planetary radius as a function of decreasing wavelength in the visible. We set out to verify this detection and observed several transits of this planet with the LCOGT network and the Kuiper telescope in four different bands (Sloan g, Sloan i, Harris B, and Harris V). Our analysis reveals a strong Rayleigh scattering slope, thus confirming previous results. This makes GJ 3470b the smallest known exoplanet with a detection of Rayleigh scattering. We find that the most plausible scenario is a hydrogen/helium-dominated atmosphere covered by clouds which obscure absorption features in the infrared and hazes which give rise to scattering in the visible. Our results demonstrate the feasibility of exoplanet atmospheric characterization from the ground, even with meter-class telescopes.
Energy Technology Data Exchange (ETDEWEB)
Fontenla, J. M. [NorthWest Research Associates, Boulder, CO 80301 (United States); Linsky, Jeffrey L. [JILA, University of Colorado and NIST, Boulder, CO 80309-0440 (United States); Witbrod, Jesse [University of Colorado Boulder, CO 80309 (United States); France, Kevin [LASP, University of Colorado Boulder, CO 80309-0600 (United States); Buccino, A.; Mauas, Pablo; Vieytes, Mariela [Instituto de Astronomía y Física del Espacio (CONICET-UBA), C.C. 67, Sucursal 28, C1428EHA, Buenos Aires (Argentina); Walkowicz, Lucianne M., E-mail: johnf@digidyna.com, E-mail: jlinsky@jila.colorado.edu, E-mail: jesse.witbrod@colorado.edu, E-mail: kevin.france@lasp.colorado.edu, E-mail: abuccino@iafe.uba.ar, E-mail: pablo@iafe.uba.ar, E-mail: mariela@iafe.uba.ar, E-mail: LWalkowicz@adlerplanetarium.org [The Adler Planetarium, Chicago, IL 60605 (United States)
2016-10-20
Stellar radiation from X-rays to the visible provides the energy that controls the photochemistry and mass loss from exoplanet atmospheres. The important extreme ultraviolet (EUV) region (10–91.2 nm) is inaccessible and should be computed from a reliable stellar model. It is essential to understand the formation regions and physical processes responsible for the various stellar emission features to predict how the spectral energy distribution varies with age and activity levels. We compute a state-of-the-art semi-empirical atmospheric model and the emergent high-resolution synthetic spectrum of the moderately active M2 V star GJ 832 as the first of a series of models for stars with different activity levels. We construct a one-dimensional simple model for the physical structure of the star’s chromosphere, chromosphere-corona transition region, and corona using non-LTE radiative transfer techniques and many molecular lines. The synthesized spectrum for this model fits the continuum and lines across the UV-to-optical spectrum. Particular emphasis is given to the emission lines at wavelengths that are shorter than 300 nm observed with the Hubble Space Telescope , which have important effects on the photochemistry of the exoplanet atmospheres. The FUV line ratios indicate that the transition region of GJ 832 is more biased to hotter material than that of the quiet Sun. The excellent agreement of our computed EUV luminosity with that obtained by two other techniques indicates that our model predicts reliable EUV emission from GJ 832. We find that the unobserved EUV flux of GJ 832, which heats the outer atmospheres of exoplanets and drives their mass loss, is comparable to the active Sun.
International Nuclear Information System (INIS)
Yu Fajun; Zhang Hongqing
2008-01-01
This paper presents a set of multicomponent matrix Lie algebra, which is used to construct a new loop algebra à M . By using the Tu scheme, a Liouville integrable multicomponent equation hierarchy is generated, which possesses the Hamiltonian structure. As its reduction cases, the multicomponent (2+1)-dimensional Glachette–Johnson (GJ) hierarchy is given. Finally, the super-integrable coupling system of multicomponent (2+1)-dimensional GJ hierarchy is established through enlarging the spectral problem
SEARCH FOR RAYLEIGH SCATTERING IN THE ATMOSPHERE OF GJ1214b
International Nuclear Information System (INIS)
De Mooij, E. J. W.; Jayawardhana, R.; Brogi, M.; Snellen, I. A. G.; Hoekstra, H.; Otten, G. P. P. L.; Bekkers, D. H.; Haffert, S. Y.; Van Houdt, J. J.; De Kok, R. J.; Croll, B.
2013-01-01
We investigate the atmosphere of GJ1214b, a transiting super-Earth planet with a low mean density, by measuring its transit depth as a function of wavelength in the blue optical portion of the spectrum. It is thought that this planet is either a mini-Neptune, consisting of a rocky core with a thick, hydrogen-rich atmosphere, or a planet with a composition dominated by water. Most observations favor a water-dominated atmosphere with a small scale-height, however, some observations indicate that GJ1214b could have an extended atmosphere with a cloud layer muting the molecular features. In an atmosphere with a large scale-height, Rayleigh scattering at blue wavelengths is likely to cause a measurable increase in the apparent size of the planet toward the blue. We observed the transit of GJ1214b in the B band with the FOcal Reducing Spectrograph at the Very Large Telescope and in the g band with both ACAM on the William Herschel Telescope (WHT) and the Wide Field Camera at the Isaac Newton Telescope (INT). We find a planet-to-star radius ratio in the B band of 0.1162 ± 0.0017, and in the g band 0.1180 ± 0.0009 and 0.1174 ± 0.0017 for the WHT and INT observations, respectively. These optical data do not show significant deviations from previous measurements at longer wavelengths. In fact, a flat transmission spectrum across all wavelengths best describes the combined observations. When atmospheric models are considered, a small scale-height water-dominated model fits the data best.
A new case of the enigmatic Candidatus Neoehrlichia sp (FU98) in a fox from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Hodžić, A.; Mitková, B.; Modrý, David; Juránková, J.; Frgelecová, L.; Forejtek, P.; Steinbauer, V.; Duscher, G. G.
2017-01-01
Roč. 31, 1 February (2017), s. 59-60 ISSN 0890-8508 Institutional support: RVO:60077344 Keywords : Candidatus Neoehrlichia sp. * 16S rRNA * groEL * blood * red fox * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.403, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Zheng, Ligang [CanmentENERGY, Ottawa, ON (Canada)
2013-07-01
Coal, next to oil, is the second most important energy source due to wide distribution and large quantity. Coal is a very economical fuel about $0.50/GJ-$2.50/GJ (NG usually is $6/GJ-$12/GJ. Currently it is $4.03/GJ for July, 2011 delivery). It is the largest fuel source for power generation: 40% world electricity is generated by coal; its shares are about 80% in China and 50% in the U.S. An extensive coal based energy infrastructure has been built up over the years and is in good service.
A minimum number of autoimmune T cells to induce autoimmunity?
Czech Academy of Sciences Publication Activity Database
Bosch, A.J.T.; Bolinger, B.; Keck, S.; Štěpánek, Ondřej; Ozga, A.J.; Galati-Fournier, V.; Stein, J.V.; Palmer, E.
2017-01-01
Roč. 316, jaro (2017), s. 21-31 ISSN 0008-8749 R&D Projects: GA ČR GJ16-09208Y Institutional support: RVO:68378050 Keywords : T cell * Tolerance * Autoimmunity Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Immunology Impact factor: 3.172, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Kochukhov, Oleg; Lavail, Alexis [Department of Physics and Astronomy, Uppsala University, Box 516, Uppsala SE-75120 (Sweden)
2017-01-20
The nearby M dwarf binary GJ65 AB, also known as BL Cet and UV Cet, is a unique benchmark for investigation of dynamo-driven activity of low-mass stars. Magnetic activity of GJ65 was repeatedly assessed by indirect means, such as studies of flares, photometric variability, X-ray, and radio emission. Here, we present a direct analysis of large-scale and local surface magnetic fields in both components. Interpreting high-resolution circular polarization spectra (sensitive to a large-scale field geometry) we uncovered a remarkable difference of the global stellar field topologies. Despite nearly identical masses and rotation rates, the secondary exhibits an axisymmetric, dipolar-like global field with an average strength of 1.3 kG while the primary has a much weaker, more complex, and non-axisymmetric 0.3 kG field. On the other hand, an analysis of the differential Zeeman intensification (sensitive to the total magnetic flux) shows the two stars having similar magnetic fluxes of 5.2 and 6.7 kG for GJ65 A and B, respectively, although there is evidence that the field strength distribution in GJ65 B is shifted toward a higher field strength compared to GJ65 A. Based on these complementary magnetic field diagnostic results, we suggest that the dissimilar radio and X-ray variability of GJ65 A and B is linked to their different global magnetic field topologies. However, this difference appears to be restricted to the upper atmospheric layers but does not encompass the bulk of the stars and has no influence on the fundamental stellar properties.
Energy Technology Data Exchange (ETDEWEB)
Bowler, Brendan P.; Liu, Michael C. [Institute for Astronomy, University of Hawai' i, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Shkolnik, Evgenya L. [Lowell Observatory, 1400 W. Mars Hill Road, Flagstaff, AZ 86001 (United States); Tamura, Motohide, E-mail: bpbowler@ifa.hawaii.edu [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)
2012-09-01
We present the discovery of a 0.''2 companion to the young M dwarf GJ 3629 as part of our high-contrast adaptive optics imaging search for giant planets around low-mass stars with the Keck-II and Subaru telescopes. Two epochs of imaging confirm that the pair is comoving and reveal signs of orbital motion. The primary exhibits saturated X-ray emission which, together with its UV photometry from GALEX, points to an age younger than {approx}300 Myr. At these ages the companion lies below the hydrogen burning limit with a model-dependent mass of 46 {+-} 16 M{sub Jup} based on the system's photometric distance of 22 {+-} 3 pc. Resolved YJHK photometry of the pair indicates a spectral type of M7 {+-} 2 for GJ 3629 B. With a projected separation of 4.4 {+-} 0.6 AU and an estimated orbital period of 21 {+-} 5 yr, GJ 3629 AB is likely to yield a dynamical mass in the next several years, making it one of only a handful of brown dwarfs to have a measured mass and an age constrained from the stellar primary.
The impact of red noise in radial velocity planet searches: only three planets orbiting GJ 581?
Baluev, Roman V.
2013-03-01
We perform a detailed analysis of the latest HARPS and Keck radial velocity data for the planet-hosting red dwarf GJ 581, which attracted a lot of attention in recent time. We show that these data contain important correlated noise component (`red noise') with the correlation time-scale of the order of 10 d. This red noise imposes a lot of misleading effects while we work in the traditional white-noise model. To eliminate these misleading effects, we propose a maximum-likelihood algorithm equipped by an extended model of the noise structure. We treat the red noise as a Gaussian random process with an exponentially decaying correlation function. Using this method we prove that (i) planets b and c do exist in this system, since they can be independently detected in the HARPS and Keck data, and regardless of the assumed noise models; (ii) planet e can also be confirmed independently by both the data sets, although to reveal it in the Keck data it is mandatory to take the red noise into account; (iii) the recently announced putative planets f and g are likely just illusions of the red noise; (iv) the reality of the planet candidate GJ 581 d is questionable, because it cannot be detected from the Keck data, and its statistical significance in the HARPS data (as well as in the combined data set) drops to a marginal level of ˜2σ, when the red noise is taken into account. Therefore, the current data for GJ 581 really support the existence of no more than four (or maybe even only three) orbiting exoplanets. The planet candidate GJ 581 d requests serious observational verification.
International Nuclear Information System (INIS)
Rivera, Eugenio J.; Laughlin, Gregory; Vogt, Steven S.; Meschiari, Stefano; Butler, R. Paul; Haghighipour, Nader
2010-01-01
Continued radial velocity (RV) monitoring of the nearby M4V red dwarf star GJ 876 with Keck/High Resolution Echelle Spectrograph has revealed the presence of a Uranus-mass fourth planetary companion in the system. The new planet has a mean period of P e = 126.6 days (over the 12.6-year baseline of the RV observations), and a minimum mass of m e sin i e = 12.9 ± 1.7 M + . The detection of the new planet has been enabled by significant improvements to our RV data set for GJ 876. The data have been augmented by 36 new high-precision measurements taken over the past five years. In addition, the precision of all of the Doppler measurements have been significantly improved by the incorporation of a high signal-to-noise template spectrum for GJ 876 into the analysis pipeline. Implementation of the new template spectrum improves the internal rms errors for the velocity measurements taken during 1998-2005 from 4.1 m s -1 to 2.5 m s -1 . Self-consistent, N-body fits to the RV data set show that the four-planet system has an invariable plane with an inclination relative to the plane of the sky of i = 59. 0 5. The fit is not significantly improved by the introduction of a mutual inclination between the planets 'b' and 'c', but the new data do confirm a non-zero eccentricity, e d = 0.207 ± 0.055 for the innermost planet, 'd'. In our best-fit coplanar model, the mass of the new component is m e = 14.6 ± 1.7 M + . Our best-fitting model places the new planet in a three-body resonance with the previously known giant planets (which have mean periods of P c = 30.4 and P b = 61.1 days). The critical argument, ψ Laplace = λ c - 3λ b + 2λ e , for the Laplace resonance librates with an amplitude of Δψ Laplace = 40 0 ± 13 0 about ψ Laplace = 0 0 . Numerical integration indicates that the four-planet system is stable for at least a billion years (at least for the coplanar cases). This resonant configuration of three giant planets orbiting an M dwarf primary differs from the
International Nuclear Information System (INIS)
Berta, Zachory K.; Charbonneau, David; Désert, Jean-Michel; Irwin, Jonathan; Miller-Ricci Kempton, Eliza; Fortney, Jonathan J.; Nutzman, Philip; McCullough, Peter R.; Burke, Christopher J.; Homeier, Derek
2012-01-01
Capitalizing on the observational advantage offered by its tiny M dwarf host, we present Hubble Space Telescope/Wide Field Camera 3 (WFC3) grism measurements of the transmission spectrum of the super-Earth exoplanet GJ1214b. These are the first published WFC3 observations of a transiting exoplanet atmosphere. After correcting for a ramp-like instrumental systematic, we achieve nearly photon-limited precision in these observations, finding the transmission spectrum of GJ1214b to be flat between 1.1 and 1.7 μm. Inconsistent with a cloud-free solar composition atmosphere at 8.2σ, the measured achromatic transit depth most likely implies a large mean molecular weight for GJ1214b's outer envelope. A dense atmosphere rules out bulk compositions for GJ1214b that explain its large radius by the presence of a very low density gas layer surrounding the planet. High-altitude clouds can alternatively explain the flat transmission spectrum, but they would need to be optically thick up to 10 mbar or consist of particles with a range of sizes approaching 1 μm in diameter.
Ludický princip v kontextu otázky po zdařilém životě
Czech Academy of Sciences Publication Activity Database
Koubová, Alice
2016-01-01
Roč. 60, Suppl. 1 (2016), s. 31-40 ISSN 0009-062X R&D Projects: GA ČR(CZ) GJ16-00994Y Institutional support: RVO:67985955 Keywords : well-being * eudaimonia * ludic principle * play * game * ethics of virtues Subject RIV: AA - Philosophy ; Religion Impact factor: 0.242, year: 2016
VizieR Online Data Catalog: Transiting planet GJ 1132 (Southworth+, 2017)
Southworth, J.; Mancini, L.; Madhusudhan, N.; Molliere, P.; Ciceri, S.; Henning, T.
2018-05-01
Light curves of 10 transits of the extrasolar planetary system GJ 1132 are presented. The data were obtained using the MPG 2.2m telescope with GROND imager, and observed simultaneously in the g, r, i, z, J, H and K passbands. The errorbars for each transit have been scaled so the best-fitting model (obtained using the JKTEBOP code) has a reduced chi-squared value of 1.0. (1 data file).
Skemer, Andrew J.; Morley, Caroline V.; Zimmerman, Neil T.; Skrutskie, Michael F.; Leisenring, Jarron; Buenzli, Esther; Bonnefoy, Mickael; Bailey, Vanessa; Hinz, Philip; Defrére, Denis; Esposito, Simone; Apai, Dániel; Biller, Beth; Brandner, Wolfgang; Close, Laird; Crepp, Justin R.; De Rosa, Robert J.; Desidera, Silvano; Eisner, Josh; Fortney, Jonathan; Freedman, Richard; Henning, Thomas; Hofmann, Karl-Heinz; Kopytova, Taisiya; Lupu, Roxana; Maire, Anne-Lise; Males, Jared R.; Marley, Mark; Morzinski, Katie; Oza, Apurva; Patience, Jenny; Rajan, Abhijith; Rieke, George; Schertl, Dieter; Schlieder, Joshua; Stone, Jordan; Su, Kate; Vaz, Amali; Visscher, Channon; Ward-Duong, Kimberly; Weigelt, Gerd; Woodward, Charles E.
2016-02-01
As gas giant planets and brown dwarfs radiate away the residual heat from their formation, they cool through a spectral type transition from L to T, which encompasses the dissipation of cloud opacity and the appearance of strong methane absorption. While there are hundreds of known T-type brown dwarfs, the first generation of directly imaged exoplanets were all L type. Recently, Kuzuhara et al. announced the discovery of GJ 504 b, the first T dwarf exoplanet. GJ 504 b provides a unique opportunity to study the atmosphere of a new type of exoplanet with a ˜500 K temperature that bridges the gap between the first directly imaged planets (˜1000 K) and our own solar system's Jupiter (˜130 K). We observed GJ 504 b in three narrow L-band filters (3.71, 3.88, and 4.00 μm), spanning the red end of the broad methane fundamental absorption feature (3.3 μm) as part of the LBTI Exozodi Exoplanet Common Hunt (LEECH) exoplanet imaging survey. By comparing our new photometry and literature photometry with a grid of custom model atmospheres, we were able to fit GJ 504 b's unusual spectral energy distribution for the first time. We find that GJ 504 b is well fit by models with the following parameters: Teff = 544 ± 10 K, g Germany. LBT Corporation partners are the University of Arizona on behalf of the Arizona university system; Istituto Nazionale di Astrophisica, Italy; LBT Beteiligungsgesellschaft, Germany, representing the Max-Planck Society, the Astrophysical Institute Potsdam, and Heidelberg University; The Ohio State University, and the Research Corporation, on behalf of the University of Notre Dame, University of Minnesota, and University of Virginia.
Energy Technology Data Exchange (ETDEWEB)
Arriagada, Pamela; Minniti, Dante [Department of Astronomy, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Anglada-Escude, Guillem; Butler, R. Paul [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015-1305 (United States); Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian [The Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Wende, Sebastian, E-mail: parriaga@astro.puc.cl [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, D-37077 Goettingen (Germany)
2013-07-01
We report two low-mass companions orbiting the nearby K7 dwarf GJ 221 that have emerged from reanalyzing 4.4 yr of publicly available HARPS spectra complemented with 2 years of high-precision Doppler measurements with Magellan/PFS. The HARPS measurements alone contain the clear signal of a low-mass companion with a period of 125 days and a minimum mass of 53.2 M{sub Circled-Plus} (GJ 221b), falling in a mass range where very few planet candidates have been found (sub-Saturn desert). The addition of 17 PFS observations allows the confident detection of a second low-mass companion (6.5 M{sub Circled-Plus }) in a hot orbit (3.87 day period, GJ 221c). Spectroscopic and photometric calibrations suggest that GJ 221 is slightly depleted ([Fe/H] {approx} -0.1) compared to the Sun, so the presence of two low-mass companions in the system confirms the trend that slightly reduced stellar metallicity does not prevent the formation of planets in the super-Earth to sub-Saturn mass regime.
NeemAzal T/S – toxicity to early-life stages of common carp (Cyprinus carpio L.)
Czech Academy of Sciences Publication Activity Database
Chromcová, L.; Blahová, J.; Živná, D.; Plhalová, L.; Casuscelli di Tocco, F.; Divišová, L.; Prokeš, Miroslav; Faggio, C.; Tichý, F.; Svobodová, Z.
2015-01-01
Roč. 60, č. 1 (2015), s. 23-30 ISSN 0375-8427 Institutional support: RVO:68081766 Keywords : Neemazal T/S * embryo-larval toxicity test * azadirachtin * oxidative stress * histopathology * insecticide Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.560, year: 2015
Interlock system of electron beam machine GJ-2
International Nuclear Information System (INIS)
Marnada, Nada
1999-01-01
As an irradiation installation facility, the electron beam machine (EBM) irradiation facility which use radionuclide as radiation source. There are three safety aspects to be considered in the facility i.e the safeties for human, machines, and samples to be irradiated. The safety aspect for human is to the radiation hazard and the safety aspect for machine and sample is to the damage as the result of operating failure. In the EBM GJ-2 (made in China) twelve interlock system parameter are installed to keep all of the safety aspects. Each interlock system consist transducer that controls a certain switch, a magnetic relay, and visible and audible interlock indicators to improve the reliability of interlock systems a method called redundancy method is applied to the systems of operation of high voltage. (author)
Direct Imaging of a Cold Jovian Exoplanet in Orbit around the Sun-Like Star GJ 504
Kuzuhara, M.; Tamura, M.; Kudo, T.; Janson, M; Kandori, R.; Brandt, T. D.; Thalmann, C.; Spiegel, D.; Biller, B.; Carson, J.;
2013-01-01
Several exoplanets have recently been imaged at wide separations of >10 AU from their parent stars. These span a limited range of ages ( 0.5 mag), implying thick cloud covers. Furthermore, substantial model uncertainties exist at these young ages due to the unknown initial conditions at formation, which can lead to an order of magnitude of uncertainty in the modeled planet mass. Here, we report the direct imaging discovery of a Jovian exoplanet around the Sun-like star GJ 504, detected as part of the SEEDS survey. The system is older than all other known directly-imaged planets; as a result, its estimated mass remains in the planetary regime independent of uncertainties related to choices of initial conditions in the exoplanet modeling. Using the most common exoplanet cooling model, and given the system age of 160(+350/-60) Myr, GJ 504 b has an estimated mass of 4(+4.5/-1.0) Jupiter masses, among the lowest of directly imaged planets. Its projected separation of 43.5 AU exceeds the typical outer boundary of approx.. 30 AU predicted for the core accretion mechanism. GJ 504 b is also significantly cooler (510(+30/-20) K)) and has a bluer color (J - H = -0.23 mag) than previously imaged exoplanets, suggesting a largely cloud-free atmosphere accessible to spectroscopic characterization. Thus, it has the potential of providing novel insights into the origins of giant planets, as well as their atmospheric properties.
Feroz, F.; Hobson, M. P.
2014-02-01
GJ667C is the least massive component of a triple star system which lies at a distance of about 6.8 pc (22.1 light-year) from the Earth. GJ667C has received much attention recently due to the claims that it hosts up to seven planets including three super-Earths inside the habitable zone. We present a Bayesian technique for the analysis of radial velocity (RV) data sets in the presence of correlated noise component (`red noise'), with unknown parameters. We also introduce hyper-parameters in our model in order to deal statistically with under- or overestimated error bars on measured RVs as well as inconsistencies between different data sets. By applying this method to the RV data set of GJ667C, we show that this data set contains a significant correlated (red) noise component with correlation time-scale for HARPS data of the order of 9 d. Our analysis shows that the data only provide strong evidence for the presence of two planets: GJ667Cb and c with periods 7.19 and 28.13 d, respectively, with some hints towards the presence of a third signal with period 91 d. The planetary nature of this third signal is not clear and additional RV observations are required for its confirmation. Previous claims of the detection of additional planets in this system are due the erroneous assumption of white noise. Using the standard white noise assumption, our method leads to the detection of up to five signals in this system. We also find that with the red noise model, the measurement uncertainties from HARPS for this system are underestimated at the level of ˜50 per cent.
THEORETICAL TRANSIT SPECTRA FOR GJ 1214b AND OTHER 'SUPER-EARTHS'
Energy Technology Data Exchange (ETDEWEB)
Howe, Alex R.; Burrows, Adam S., E-mail: arhowe@astro.princeton.edu, E-mail: burrows@astro.princeton.edu [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States)
2012-09-10
We present new calculations of transit spectra of super-Earths that allow for atmospheres with arbitrary proportions of common molecular species and haze. We test this method with generic spectra, reproducing the expected systematics and absorption features, then apply it to the nearby super-Earth GJ 1214b, which has produced conflicting observational data, leaving the questions of a hydrogen-rich versus hydrogen-poor atmosphere and the water content of the atmosphere ambiguous. We present representative transit spectra for a range of classes of atmosphere models for GJ 1214b. Our analysis supports a hydrogen-rich atmosphere with a cloud or haze layer, although a hydrogen-poor model with {approx}<10% water is not ruled out. Several classes of models are ruled out, however, including hydrogen-rich atmospheres with no haze, hydrogen-rich atmospheres with a haze of {approx}0.01 {mu}m tholin particles, and hydrogen-poor atmospheres with major sources of absorption other than water. We propose an observational test to distinguish hydrogen-rich from hydrogen-poor atmospheres. Finally, we provide a library of theoretical transit spectra for super-Earths with a broad range of parameters to facilitate future comparison with anticipated data.
International Nuclear Information System (INIS)
Demory, Brice-Olivier; Seager, Sara; Torres, Guillermo; Neves, Vasco; Santos, Nuno; Rogers, Leslie; Gillon, Michaël; Horch, Elliott; Sullivan, Peter; Bonfils, Xavier; Delfosse, Xavier; Forveille, Thierry; Lovis, Christophe; Mayor, Michel; Udry, Stephane; Smalley, Barry
2013-01-01
We present Spitzer/IRAC 4.5 μm transit photometry of GJ 3470 b, a Neptune-size planet orbiting an M1.5 dwarf star with a 3.3 day period recently discovered in the course of the HARPS M-dwarf survey. We refine the stellar parameters by employing purely empirical mass-luminosity and surface brightness relations constrained by our updated value for the mean stellar density, and additional information from new near-infrared spectroscopic observations. We derive a stellar mass of M * = 0.539 +0.047 -0.043 M sun and a radius of R * = 0.568 +0.037 -0.031 R sun . We determine the host star of GJ 3470 b to be metal-rich, with a metallicity of [Fe/H] = +0.20 ± 0.10 and an effective temperature of T eff = 3600 ± 100 K. The revised stellar parameters yield a planetary radius R p = 4.83 -0.21 +0.22 R ⊕ that is 13% larger than the value previously reported in the literature. We find a planetary mass M p = 13.9 +1.5 -1.4 M ⊕ that translates to a very low planetary density, ρ p = 0.72 +0.13 -0.12 g cm –3 , which is 33% smaller than the original value. With a mean density half of that of GJ 436 b, GJ 3470 b is an example of a very low-density low-mass planet, similar to Kepler-11 d, Kepler-11 e, and Kepler-18 c, but orbiting a much brighter nearby star that is more conducive to follow-up studies.
Czech Academy of Sciences Publication Activity Database
Chiodaroli, E.; Kreml, Ondřej
2018-01-01
Roč. 31, č. 4 (2018), s. 1441-1460 ISSN 0951-7715 R&D Projects: GA ČR(CZ) GJ17-01694Y Institutional support: RVO:67985840 Keywords : Riemann problem * non-uniqueness * weak solutions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.767, year: 2016 http://iopscience.iop.org/ article /10.1088/1361-6544/aaa10d/meta
Czech Academy of Sciences Publication Activity Database
Chiodaroli, E.; Kreml, Ondřej
2018-01-01
Roč. 31, č. 4 (2018), s. 1441-1460 ISSN 0951-7715 R&D Projects: GA ČR(CZ) GJ17-01694Y Institutional support: RVO:67985840 Keywords : Riemann problem * non-uniqueness * weak solutions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.767, year: 2016 http://iopscience.iop.org/article/10.1088/1361-6544/aaa10d/meta
Czech Academy of Sciences Publication Activity Database
Stenger, B.L.S.; Clark, M.E.; Kváč, Martin; Khan, E.; Giddings, C.W.; Dyer, N.W.; Schultz, J.L.; McEvoy, J.M.
2015-01-01
Roč. 32, JUN 2015 (2015), s. 113-123 ISSN 1567-1348 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : Cryptosporidium * Paralogy * 18S rRNA * 18S rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.591, year: 2015
International Nuclear Information System (INIS)
Anglada-Escudé, Guillem; Boss, Alan P.; Weinberger, Alycia J.; Butler, R. Paul; Thompson, Ian B.; Vogt, Steven S.; Rivera, Eugenio J.
2012-01-01
We have obtained precision astrometry of the planet host M dwarf GJ 317 in the framework of the Carnegie Astrometric Planet Search project. The new astrometric measurements give a distance determination of 15.3 pc, 65% further than previous estimates. The resulting absolute magnitudes suggest that it is metal-rich and more massive than previously assumed. This result strengthens the correlation between high metallicity and the presence of gas giants around low-mass stars. At 15.3 pc, the minimal astrometric amplitude for planet candidate GJ 317b is 0.3 mas (edge-on orbit), just below our astrometric sensitivity. However, given the relatively large number of observations and good astrometric precision, a Bayesian Monte Carlo Markov Chain analysis indicates that the mass of planet b has to be smaller than twice the minimum mass with a 99% confidence level, with a most likely value of 2.5 M Jup . Additional radial velocity (RV) measurements obtained with Keck by the Lick-Carnegie Planet search program confirm the presence of an additional very long period planet candidate, with a period of 20 years or more. Even though such an object will imprint a large astrometric wobble on the star, its curvature is yet not evident in the astrometry. Given high metallicity, and the trend indicating that multiple systems are rich in low-mass companions, this system is likely to host additional low-mass planets in its habitable zone that can be readily detected with state-of-the-art optical and near-infrared RV measurements.
Energy Technology Data Exchange (ETDEWEB)
Anglada-Escude, Guillem; Boss, Alan P.; Weinberger, Alycia J.; Butler, R. Paul [Department of Terrestrial Magnetism, Carnegie Institution for Science, 5241 Broad Branch Road NW, Washington, DC 20015 (United States); Thompson, Ian B. [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Vogt, Steven S.; Rivera, Eugenio J., E-mail: anglada@dtm.ciw.edu [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States)
2012-02-10
We have obtained precision astrometry of the planet host M dwarf GJ 317 in the framework of the Carnegie Astrometric Planet Search project. The new astrometric measurements give a distance determination of 15.3 pc, 65% further than previous estimates. The resulting absolute magnitudes suggest that it is metal-rich and more massive than previously assumed. This result strengthens the correlation between high metallicity and the presence of gas giants around low-mass stars. At 15.3 pc, the minimal astrometric amplitude for planet candidate GJ 317b is 0.3 mas (edge-on orbit), just below our astrometric sensitivity. However, given the relatively large number of observations and good astrometric precision, a Bayesian Monte Carlo Markov Chain analysis indicates that the mass of planet b has to be smaller than twice the minimum mass with a 99% confidence level, with a most likely value of 2.5 M{sub Jup}. Additional radial velocity (RV) measurements obtained with Keck by the Lick-Carnegie Planet search program confirm the presence of an additional very long period planet candidate, with a period of 20 years or more. Even though such an object will imprint a large astrometric wobble on the star, its curvature is yet not evident in the astrometry. Given high metallicity, and the trend indicating that multiple systems are rich in low-mass companions, this system is likely to host additional low-mass planets in its habitable zone that can be readily detected with state-of-the-art optical and near-infrared RV measurements.
Precision half-life determination of a mirror β transition: The decay of 31S
International Nuclear Information System (INIS)
Bacquias, A.; Kurtukian-Nieto, T.; Ascher, P.; Audirac, L.; Blank, B.; Giovinazzo, J.; Aeystoe, J.; Elomaa, V.V.; Eronen, T.; Hakala, J.; Jokinen, A.; Kankainen, A.; Karvonen, P.; Kolhinen, V.S.; Moore, I.D.; Rahaman, S.; Reponen, M.; Rissanen, J.; Saastamoinen, A.; Souin, J.
2012-01-01
The half-life of the mirror β decay of 31 S has been measured at the IGISOL facility at the University of Jyvaeskylae. The value obtained is T 1/2 ( 31 S)=(2553.4±1.8) ms, in agreement with previous measurements, but with a precision that is better by a factor of ten than the literature value previously adopted. When the new result is combined with the Q EC value measured recently at JYFLTRAP, a precision of better than 10 -3 is obtained for the ft value. (orig.)
DIRECT IMAGING OF A COLD JOVIAN EXOPLANET IN ORBIT AROUND THE SUN-LIKE STAR GJ 504
Energy Technology Data Exchange (ETDEWEB)
Kuzuhara, M. [Department of Earth and Planetary Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Tamura, M.; Kandori, R.; Hori, Y.; Suzuki, R.; Suenaga, T.; Takahashi, Y. H.; Kwon, J. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Kudo, T. [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohoku Place, Hilo, HI 96720 (United States); Janson, M.; Brandt, T. D.; Spiegel, D.; Burrows, A.; Turner, E. L.; Moro-Martin, A. [Department of Astrophysical Sciences, Princeton University, Peyton Hall, Ivy Lane, Princeton, NJ 08544 (United States); Thalmann, C. [Astronomical Institute ' ' Anton Pannekoek' ' , University of Amsterdam, Postbus 94249, 1090 GE, Amsterdam (Netherlands); Biller, B.; Henning, T. [Max Planck Institute for Astronomy, Koenigstuhl 17, D-69117 Heidelberg (Germany); Carson, J. [Department of Physics and Astronomy, College of Charleston, 58 Coming Street, Charleston, SC 29424 (United States); McElwain, M. W., E-mail: m.kuzuhara@nao.ac.jp [Exoplanets and Stellar Astrophysics Laboratory, Code 667, Goddard Space Flight Center, Greenbelt, MD 20771 (United States); and others
2013-09-01
Several exoplanets have recently been imaged at wide separations of >10 AU from their parent stars. These span a limited range of ages (<50 Myr) and atmospheric properties, with temperatures of 800-1800 K and very red colors (J - H > 0.5 mag), implying thick cloud covers. Furthermore, substantial model uncertainties exist at these young ages due to the unknown initial conditions at formation, which can lead to an order of magnitude of uncertainty in the modeled planet mass. Here, we report the direct-imaging discovery of a Jovian exoplanet around the Sun-like star GJ 504, detected as part of the SEEDS survey. The system is older than all other known directly imaged planets; as a result, its estimated mass remains in the planetary regime independent of uncertainties related to choices of initial conditions in the exoplanet modeling. Using the most common exoplanet cooling model, and given the system age of 160{sup +350}{sub -60} Myr, GJ 504b has an estimated mass of 4{sup +4.5}{sub -1.0} Jupiter masses, among the lowest of directly imaged planets. Its projected separation of 43.5 AU exceeds the typical outer boundary of {approx}30 AU predicted for the core accretion mechanism. GJ 504b is also significantly cooler (510{sup +30}{sub -20} K) and has a bluer color (J - H = -0.23 mag) than previously imaged exoplanets, suggesting a largely cloud-free atmosphere accessible to spectroscopic characterization. Thus, it has the potential of providing novel insights into the origins of giant planets as well as their atmospheric properties.
Step-parent adoption gone wrong: GT v CT [2015] 3 ALL SA 631 (GJ ...
African Journals Online (AJOL)
Because of the immense impact on a child, the rescission of an adoption order has to be handled with kid gloves. In GT v CT [2015] 3 ALL SA 631 (GJ) two children had been legally adopted by their stepfather while the Child Care Act was in operation. After the implementation of the Children's Act 38 of 2005, however, ...
Energy Technology Data Exchange (ETDEWEB)
Demory, Brice-Olivier; Seager, Sara [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Torres, Guillermo [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Neves, Vasco; Santos, Nuno [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Rogers, Leslie [Department of Astrophysics, California Institute of Technology, MC 249-17, Pasadena, CA 91125 (United States); Gillon, Michaeel [Institut d' Astrophysique et de Geophysique, Universite de Liege, Allee du 6 Aout, 17, Bat. B5C, Liege 1 (Belgium); Horch, Elliott [Department of Physics, 501 Crescent Street, Southern Connecticut State University, New Haven, CT 06515 (United States); Sullivan, Peter [Department of Physics and Kavli Institute for Astrophysics and Space Research, MIT, 77 Massachusetts Avenue, Cambridge, MA 02138 (United States); Bonfils, Xavier; Delfosse, Xavier; Forveille, Thierry [UJF-Grenoble 1/CNRS-INSU, Institut de Planetologie et d' Astrophysique de Grenoble (IPAG) UMR 5274, Grenoble, F-38041 (France); Lovis, Christophe; Mayor, Michel; Udry, Stephane [Observatoire de Geneve, Universite de Geneve, 51 ch. des Maillettes, CH-1290 Versoix (Switzerland); Smalley, Barry, E-mail: demory@mit.edu [Astrophysics Group, Keele University, Staffordshire, ST55BG (United Kingdom)
2013-05-10
We present Spitzer/IRAC 4.5 {mu}m transit photometry of GJ 3470 b, a Neptune-size planet orbiting an M1.5 dwarf star with a 3.3 day period recently discovered in the course of the HARPS M-dwarf survey. We refine the stellar parameters by employing purely empirical mass-luminosity and surface brightness relations constrained by our updated value for the mean stellar density, and additional information from new near-infrared spectroscopic observations. We derive a stellar mass of M{sub *}= 0.539{sup +0.047}{sub -0.043} M{sub sun} and a radius of R{sub *}= 0.568{sup +0.037}{sub -0.031} R{sub sun}. We determine the host star of GJ 3470 b to be metal-rich, with a metallicity of [Fe/H] = +0.20 {+-} 0.10 and an effective temperature of T{sub eff} = 3600 {+-} 100 K. The revised stellar parameters yield a planetary radius R{sub p}= 4.83{sub -0.21}{sup +0.22} R{sub Circled-Plus} that is 13% larger than the value previously reported in the literature. We find a planetary mass M{sub p}= 13.9{sup +1.5}{sub -1.4} M{sub Circled-Plus} that translates to a very low planetary density, {rho}{sub p}= 0.72{sup +0.13}{sub -0.12} g cm{sup -3}, which is 33% smaller than the original value. With a mean density half of that of GJ 436 b, GJ 3470 b is an example of a very low-density low-mass planet, similar to Kepler-11 d, Kepler-11 e, and Kepler-18 c, but orbiting a much brighter nearby star that is more conducive to follow-up studies.
Energy Technology Data Exchange (ETDEWEB)
Anglada-Escude, Guillem; Butler, R. Paul [Carnegie Institution of Washington, Department of Terrestrial Magnetism, 5241 Broad Branch Rd. NW, Washington, DC 20015 (United States); Arriagada, Pamela; Minniti, Dante [Department of Astronomy, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Vogt, Steven S.; Rivera, Eugenio J. [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian B. [Carnegie Observatories, 813 Santa Barbara St., Pasadena, CA 91101-1292 (United States); Haghighipour, Nader [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Monoa, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Carter, Brad D. [Faculty of Sciences, University of Southern Queensland, Toowoomba 4350 (Australia); Tinney, C. G.; Wittenmyer, Robert A.; Bailey, Jeremy A. [Department of Astrophysics, School of Physics, University of New South Wales, Sydney 2052 (Australia); O' Toole, Simon J. [Australian Astronomical Observatory, P.O. Box 296, Epping 1710 (Australia); Jones, Hugh R. A. [Centre for Astrophysics Research, University of Hertfordshire, College Lane, Hatfield, Herts, AL10 9AB (United Kingdom); Jenkins, James S., E-mail: anglada@dtm.ciw.edu [Departamento de Astronomia, Universidad de Chile, Camino El Observatorio 1515, Las Condes, Santiago (Chile)
2012-05-20
We re-analyze 4 years of HARPS spectra of the nearby M1.5 dwarf GJ 667C available through the European Southern Observatory public archive. The new radial velocity (RV) measurements were obtained using a new data analysis technique that derives the Doppler measurement and other instrumental effects using a least-squares approach. Combining these new 143 measurements with 41 additional RVs from the Magellan/Planet Finder Spectrograph and Keck/High Resolution Echelle Spectrometer spectrometers reveals three additional signals beyond the previously reported 7.2 day candidate, with periods of 28 days, 75 days, and a secular trend consistent with the presence of a gas giant (period {approx}10 years). The 28 day signal implies a planet candidate with a minimum mass of 4.5 M{sub Circled-Plus} orbiting well within the canonical definition of the star's liquid water habitable zone (HZ), that is, the region around the star at which an Earth-like planet could sustain liquid water on its surface. Still, the ultimate water supporting capability of this candidate depends on properties that are unknown such as its albedo, atmospheric composition, and interior dynamics. The 75 day signal is less certain, being significantly affected by aliasing interactions among a potential 91 day signal, and the likely rotation period of the star at 105 days detected in two activity indices. GJ 667C is the common proper motion companion to the GJ 667AB binary, which is metal-poor compared to the Sun. The presence of a super-Earth in the HZ of a metal-poor M dwarf in a triple star system supports the evidence that such worlds should be ubiquitous in the Galaxy.
Angucycline Glycosides from Mangrove-Derived Streptomyces diastaticus subsp. SCSIO GJ056
Directory of Open Access Journals (Sweden)
Chun Gui
2018-05-01
Full Text Available Nine new angucycline glycosides designated urdamycins N1–N9 (1–9, together with two known congener urdamycins A (10 and B (11, were obtained from a mangrove-derived Streptomyces diastaticus subsp. SCSIO GJ056. The structures of new compounds were elucidated on the basis of extensive spectroscopic data analysis. The absolute configurations of 6–9 were assigned by electronic circular dichroism calculation method. Urdamycins N6 (6 and N9 (9 represent the first naturally occurring (5R, 6R-angucycline glycosides, which are diastereomers of urdamycins N7 (7 and N8 (8, respectively.
A. Poveda; A. Hernández-Alcántara; R. Costero; J. Echevarría
2008-01-01
En una búsqueda de compa~neras con movimiento propio común para las binarias separadas de la vecindad solar encontramos que GJ 282AB tiene una compañera distante (NLTT 18149), a una separaci on de s = 1:09°. Las paralajes trigonométricas (Hipparcos), velocidades radiales y edades son similares, y sugieren que éste es un sistema físico.
Phototriggered functionalization of hierarchically structured polymer brushes
Czech Academy of Sciences Publication Activity Database
de los Santos Pereira, Andres; Kostina, Nina Yu.; Bruns, M.; Rodriguez-Emmenegger, Cesar; Barner-Kowollik, C.
2015-01-01
Roč. 31, č. 21 (2015), s. 5899-5907 ISSN 0743-7463 R&D Projects: GA ČR(CZ) GJ15-09368Y; GA MŠk(CZ) ED1.1.00/02.0109 Grant - others:OPPK(XE) CZ.2.16/3.1.00/21545 Program:OPPK Institutional support: RVO:61389013 Keywords : polymer brushes * antifouling * click chemistry Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.993, year: 2015
Factors influencing the price of greasy fleece wool in South Africa ...
African Journals Online (AJOL)
Factors influencing the price of greasy fleece wool in South Africa. G.J. Erasmus, G.J. Delport. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...
The atmospheric circulation of the super Earth GJ 1214b: Dependence on composition and metallicity
Energy Technology Data Exchange (ETDEWEB)
Kataria, T.; Showman, A. P. [Department of Planetary Sciences and Lunar and Planetary Laboratory, The University of Arizona, Tucson, AZ 85721 (United States); Fortney, J. J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Marley, M. S.; Freedman, R. S., E-mail: tkataria@lpl.arizona.edu [NASA Ames Research Center 245-3, Moffett Field, CA 94035 (United States)
2014-04-20
We present three-dimensional atmospheric circulation models of GJ 1214b, a 2.7 Earth-radius, 6.5 Earth-mass super Earth detected by the MEarth survey. Here we explore the planet's circulation as a function of atmospheric metallicity and atmospheric composition, modeling atmospheres with a low mean molecular weight (MMW; i.e., H{sub 2}-dominated) and a high MMW (i.e., water- and CO{sub 2}-dominated). We find that atmospheres with a low MMW have strong day-night temperature variations at pressures above the infrared photosphere that lead to equatorial superrotation. For these atmospheres, the enhancement of atmospheric opacities with increasing metallicity lead to shallower atmospheric heating, larger day-night temperature variations, and hence stronger superrotation. In comparison, atmospheres with a high MMW have larger day-night and equator-to-pole temperature variations than low MMW atmospheres, but differences in opacity structure and energy budget lead to differences in jet structure. The circulation of a water-dominated atmosphere is dominated by equatorial superrotation, while the circulation of a CO{sub 2}-dominated atmosphere is instead dominated by high-latitude jets. By comparing emergent flux spectra and light curves for 50× solar and water-dominated compositions, we show that observations in emission can break the degeneracy in determining the atmospheric composition of GJ 1214b. The variation in opacity with wavelength for the water-dominated atmosphere leads to large phase variations within water bands and small phase variations outside of water bands. The 50× solar atmosphere, however, yields small variations within water bands and large phase variations at other characteristic wavelengths. These observations would be much less sensitive to clouds, condensates, and hazes than transit observations.
Nitro-oleic acid regulates growth factor-induced differentiation of bone marrow-derived macrophages
Czech Academy of Sciences Publication Activity Database
Vereščáková, Hana; Ambrožová, Gabriela; Kubala, Lukáš; Perečko, Tomáš; Koudelka, Adolf; Vašíček, Ondřej; Rudolph, T.K.; Klinke, A.; Woodcock, S.R.; Freeman, B.A.; Pekarová, Michaela
2017-01-01
Roč. 104, MAR2017 (2017), s. 10-19 ISSN 0891-5849 R&D Projects: GA ČR GP13-40824P; GA ČR(CZ) GJ17-08066Y; GA MŠk(CZ) LD15069 Institutional support: RVO:68081707 Keywords : colony-stimulating factor * nitrated fatty-acids * hematopoietic stem-cells * gm-csf Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 5.606, year: 2016
Holocene glacier activity reconstructed from proglacial lake Gjøavatnet on Amsterdamøya, NW Svalbard
de Wet, Gregory A.; Balascio, Nicholas L.; D'Andrea, William J.; Bakke, Jostein; Bradley, Raymond S.; Perren, Bianca
2018-03-01
Well-dated and highly resolved paleoclimate records from high latitudes allow for a better understanding of past climate change. Lake sediments are excellent archives of environmental change, and can record processes occurring within the catchment, such as the growth or demise of an upstream glacier. Here we present a Holocene-length, multi-proxy lake sediment record from proglacial lake Gjøavatnet on the island of Amsterdamøya, northwest Svalbard. Today, Gjøavatnet receives meltwater from the Annabreen glacier and contains a record of changes in glacier activity linked to regional climate conditions. We measured changes in organic matter content, dry bulk density, bulk carbon isotopes, elemental concentrations via Itrax core-scanning, and diatom community composition to reconstruct variability in glacier extent back through time. Our reconstruction indicates that glacially derived sedimentation in the lake decreased markedly at ∼11.1 cal kyr BP, although a glacier likely persisted in the catchment until ∼8.4 cal kyr BP. During the mid-Holocene (∼8.4-1.0 cal kyr BP) there was significantly limited glacial influence in the catchment and enhanced deposition of organic-rich sediment in the lake. The deposition of organic rich sediments during this time was interrupted by at least three multi-centennial intervals of reduced organic matter accumulation (∼5.9-5.0, 2.7-2.0, and 1.7-1.5 cal kyr BP). Considering our chronological information and a sedimentological comparison with intervals of enhanced glacier input, we interpret these intervals not as glacial advances, but rather as cold/dry episodes that inhibited organic matter production in the lake and surrounding catchment. At ∼1.0 cal kyr BP, input of glacially derived sediment to Gjøavatnet abruptly increased, representing the rapid expansion of the Annabreen glacier.
A Local Pair Natural Orbital-Based Multireference Mukherjee’s Coupled Cluster Method
Czech Academy of Sciences Publication Activity Database
Demel, Ondřej; Pittner, Jiří
2015-01-01
Roč. 11, č. 7 (2015), s. 3104-3114 ISSN 1549-9618 R&D Projects: GA ČR GAP208/11/2222; GA ČR(CZ) GJ15-00058Y Institutional support: RVO:61388955 Keywords : ELECTRON CORRELATION METHODS * BRILLOUIN-WIGNER * CONFIGURATION-INTERACTION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.301, year: 2015
Quantifying bacterial adhesion on antifouling polymer brushes via single-cell force spectroscopy
Czech Academy of Sciences Publication Activity Database
Rodriguez-Emmenegger, Cesar; Janel, S.; de los Santos Pereira, Andres; Bruns, M.; Lafont, F.
2015-01-01
Roč. 6, č. 31 (2015), s. 5740-5751 ISSN 1759-9954 R&D Projects: GA ČR(CZ) GJ15-09368Y; GA MŠk(CZ) ED1.1.00/02.0109 Grant - others:OPPK(XE) CZ.2.16/3.1.00/21545 Program:OPPK Institutional support: RVO:61389013 Keywords : antifouling polymer brushes * single-cell force spectroscopy * bacterial adhesion Subject RIV: BO - Biophysics Impact factor: 5.687, year: 2015
Czech Academy of Sciences Publication Activity Database
Petrášová, J.; Modrý, David; Huffman, M. A.; Mapua, Mwanahamissi Issa; Bobáková, Lucia; Mazoch, Vladimír; Singh, J.; Kaur, T.; Petrželková, Klára Judita
Roč. 31, č. 5 ( 2010 ), s. 920-936 ISSN 0164-0291 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927; GA AV ČR KJB600930615 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z60930519 Keywords : Chimpanzee * Parasite * Parasite richness * Prevalence * Primate introduction Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.793, year: 2010
Phylogenetic position of Dracunculus medinensis and some related nematodes inferred from 18S rRNA
Czech Academy of Sciences Publication Activity Database
Wijová, Martina; Moravec, František; Horák, Aleš; Modrý, David; Lukeš, Julius
2005-01-01
Roč. 96, č. 2 (2005), s. 133-135 ISSN 0932-0113 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculus * Nematoda * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.226, year: 2005
Time-Resolved Ultraviolet Spectroscopy of The M-Dwarf GJ 876 Exoplanetary System
France, Kevin; Linsky, Jeffrey L.; Tian, Feng; Froning, Cynthia S.; Roberge, Aki
2012-01-01
Extrasolar planets orbiting M-stars may represent our best chance to discover habitable worlds in the coming decade. The ultraviolet spectrum incident upon both Earth-like and Jovian planets is critically important for proper modeling of their atmospheric heating and chemistry. In order to provide more realistic inputs for atmospheric models of planets orbiting low-mass stars, we present new near- and far-ultraviolet (NUV and FUV) spectroscopy of the M-dwarf exoplanet host GJ 876 (M4V). Using the COS and STIS spectrographs on board the Hubble Space Telescope, we have measured the 1150-3140 A spectrum of GJ 876. We have reconstructed the stellar H1 Ly alpha emission line profile, and find that the integrated Ly alpha flux is roughly equal to the rest of the integrated flux (1150-1210 A + 1220-3140 A) in the entire ultraviolet bandpass (F(Ly alpha)/F(FUV+NUV) equals approximately 0.7). This ratio is approximately 2500x greater than the solar value. We describe the ultraviolet line spectrum and report surprisingly strong fluorescent emission from hot H2 (T(H2) greater than 2000 K). We show the light curve of a chromospheric + transition region flare observed in several far-UV emission lines, with flare/quiescent flux ratios greater than or equal to 10. The strong FUV radiation field of an M-star (and specifically Ly alpha) is important for determining the abundance of O2--and the formation of biomarkers-in the lower atmospheres of Earth-like planets in the habitable zones of low-mass stars.
TIME-RESOLVED ULTRAVIOLET SPECTROSCOPY OF THE M-DWARF GJ 876 EXOPLANETARY SYSTEM
International Nuclear Information System (INIS)
France, Kevin; Froning, Cynthia S.; Linsky, Jeffrey L.; Tian, Feng; Roberge, Aki
2012-01-01
Extrasolar planets orbiting M-stars may represent our best chance to discover habitable worlds in the coming decade. The ultraviolet spectrum incident upon both Earth-like and Jovian planets is critically important for proper modeling of their atmospheric heating and chemistry. In order to provide more realistic inputs for atmospheric models of planets orbiting low-mass stars, we present new near- and far-ultraviolet (NUV and FUV) spectroscopy of the M-dwarf exoplanet host GJ 876 (M4V). Using the COS and STIS spectrographs on board the Hubble Space Telescope, we have measured the 1150-3140 Å spectrum of GJ 876. We have reconstructed the stellar H I Lyα emission line profile, and find that the integrated Lyα flux is roughly equal to the rest of the integrated flux (1150-1210 Å + 1220-3140 Å) in the entire ultraviolet bandpass (F(Lyα)/F(FUV+NUV) ≈ 0.7). This ratio is ∼2500× greater than the solar value. We describe the ultraviolet line spectrum and report surprisingly strong fluorescent emission from hot H 2 (T(H 2 ) > 2000 K). We show the light curve of a chromospheric + transition region flare observed in several far-UV emission lines, with flare/quiescent flux ratios ≥10. The strong FUV radiation field of an M-star (and specifically Lyα) is important for determining the abundance of O 2 —and the formation of biomarkers—in the lower atmospheres of Earth-like planets in the habitable zones of low-mass stars.
31 CFR 800.226 - U.S. business.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. business. 800.226 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.226 U.S. business. The term U.S. business means any entity... subsidiary is a U.S. business. Corporation A and its branch or subsidiary is each also a foreign person...
Teske, Johanna K.; Wang, Sharon; Wolfgang, Angie; Dai, Fei; Shectman, Stephen A.; Butler, R. Paul; Crane, Jeffrey D.; Thompson, Ian B.
2018-04-01
The Kepler mission showed us that planets with sizes between that of Earth and Neptune appear to be the most common type in our Galaxy. These “super-Earths” continue to be of great interest for exoplanet formation, evolution, and composition studies. However, the number of super-Earths with well-constrained mass and radius measurements remains small (40 planets with σ mass Earth planets were detected by the K2 mission around the nearby star GJ 9827/HIP 115752, at only 30 pc away. The radii of the planets span the “radius gap” detected by Fulton et al. (2017), and all orbit within ∼6.5 days, easing follow-up observations. Here, we report radial velocity (RV) observations of GJ 9827, taken between 2010 and 2016 with the Planet Finder Spectrograph on the Magellan II Telescope. We employ two different RV analysis packages, SYSTEMIC and RADVEL, to derive masses and thus densities of the GJ 9827 planets. We also test a Gaussian Process regression analysis but find the correlated stellar noise is not well constrained by the PFS data and that the GP tends to over-fit the RV semi-amplitudes resulting in a lower K value. Our RV observations are not able to place strong mass constraints on the two outer planets (c and d) but do indicate that planet b, at 1.64 R ⊕ and ∼8 M ⊕, is one of the most massive (and dense) super-Earth planets detected to date.
Domain-Based Local Pair Natural Orbital Version of Mukherjee’s State-Specific Coupled Cluster Method
Czech Academy of Sciences Publication Activity Database
Brabec, Jiří; Lang, Jakub; Saitow, M.; Pittner, Jiří; Neese, F.; Demel, Ondřej
2018-01-01
Roč. 14, č. 3 (2018), s. 1370-1382 ISSN 1549-9618 R&D Projects: GA ČR GJ15-00058Y Institutional support: RVO:61388955 Keywords : MULTIREFERENCE PERTURBATION-THEORY * SINGLE-REFERENCE FORMALISM * ELECTRON CORRELATION METHODS Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016
Orbital misalignment of the Neptune-mass exoplanet GJ 436b with the spin of its cool star
Bourrier, Vincent; Lovis, Christophe; Beust, Hervé; Ehrenreich, David; Henry, Gregory W.; Astudillo-Defru, Nicola; Allart, Romain; Bonfils, Xavier; Ségransan, Damien; Delfosse, Xavier; Cegla, Heather M.; Wyttenbach, Aurélien; Heng, Kevin; Lavie, Baptiste; Pepe, Francesco
2018-01-01
The angle between the spin of a star and the orbital planes of its planets traces the history of the planetary system. Exoplanets orbiting close to cool stars are expected to be on circular, aligned orbits because of strong tidal interactions with the stellar convective envelope. Spin–orbit alignment can be measured when the planet transits its star, but such ground-based spectroscopic measurements are challenging for cool, slowly rotating stars. Here we report the three-dimensional characterization of the trajectory of an exoplanet around an M dwarf star, derived by mapping the spectrum of the stellar photosphere along the chord transited by the planet. We find that the eccentric orbit of the Neptune-mass exoplanet GJ 436b is nearly perpendicular to the stellar equator. Both eccentricity and misalignment, surprising around a cool star, can result from dynamical interactions (via Kozai migration) with a yet-undetected outer companion. This inward migration of GJ 436b could have triggered the atmospheric escape that now sustains its giant exosphere.
31 CFR 575.320 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 575.320... § 575.320 U.S. financial institution. The term U.S. financial institution means any U.S. person.... This term includes those branches, offices and agencies of foreign financial institutions which are...
31 CFR 587.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 587.311... MONTENEGRO) MILOSEVIC SANCTIONS REGULATIONS General Definitions § 587.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity (including its foreign branches) that is engaged...
31 CFR 586.317 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 586.317... & MONTENEGRO) KOSOVO SANCTIONS REGULATIONS General Definitions § 586.317 U.S. financial institution. The term U.S. financial institution means any U.S. entity (including foreign branches) that is engaged in the...
31 CFR 546.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 546.311... Definitions § 546.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices, and agencies of foreign financial institutions that are...
31 CFR 538.316 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 538.316... Definitions § 538.316 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions which are...
31 CFR 548.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 548.311... Definitions § 548.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity... foregoing. This term includes those branches, offices, and agencies of foreign financial institutions that...
31 CFR 594.314 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 594.314... Definitions § 594.314 U.S. financial institution. The term U.S. financial institution means any U.S. person.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 537.320 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 537.320... Definitions § 537.320 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 542.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 542.311... Definitions § 542.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 541.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 541.311... Definitions § 541.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 543.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 543.311... Definitions § 543.311 U.S. financial institution. The term U.S. financial institution means any U.S. entity.... This term includes those branches, offices and agencies of foreign financial institutions that are...
31 CFR 595.316 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 595.316... Definitions § 595.316 U.S. financial institution. The term U.S. financial institution means any U.S. person.... This term includes those branches, offices and agencies of foreign financial institutions which are...
31 CFR 551.310 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 551.310... Definitions § 551.310 U.S. financial institution. The term U.S. financial institution means any U.S. entity... foregoing. This term includes those branches, offices and agencies of foreign financial institutions that...
31 CFR 593.312 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 593.312... SANCTIONS REGULATIONS General Definitions § 593.312 U.S. financial institution. The term U.S. financial... financial institutions that are located in the United States, but not such institutions' foreign branches...
31 CFR 540.319 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 540.319... CONTROL REGULATIONS General Definitions § 540.319 U.S. financial institution. The term U.S. financial... financial institutions that are located in the United States, but not such institutions' foreign branches...
31 CFR 585.318 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 585.318... General Definitions § 585.318 U.S. financial institution. The term U.S. financial institution means any U... foregoing. This term includes those branches, offices and agencies of foreign financial institutions which...
31 CFR 536.317 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 536.317... General Definitions § 536.317 U.S. financial institution. The term U.S. financial institution means any U... foregoing. This term includes those branches, offices and agencies of foreign financial institutions which...
31 CFR 547.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 547.311... REGULATIONS General Definitions § 547.311 U.S. financial institution. The term U.S. financial institution... financial institutions that are located in the United States, but not such institutions' foreign branches...
31 CFR 544.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 544.311... SANCTIONS REGULATIONS General Definitions § 544.311 U.S. financial institution. The term U.S. financial... financial institutions that are located in the United States, but not such institutions' foreign branches...
GJ 3236: A NEW BRIGHT, VERY LOW MASS ECLIPSING BINARY SYSTEM DISCOVERED BY THE MEARTH OBSERVATORY
International Nuclear Information System (INIS)
Irwin, Jonathan; Charbonneau, David; Berta, Zachory K.; Quinn, Samuel N.; Latham, David W.; Torres, Guillermo; Blake, Cullen H.; Burke, Christopher J.; Esquerdo, Gilbert A.; Fueresz, Gabor; Mink, Douglas J.; Nutzman, Philip; Szentgyorgyi, Andrew H.; Calkins, Michael L.; Falco, Emilio E.; Bloom, Joshua S.; Starr, Dan L.
2009-01-01
We report the detection of eclipses in GJ 3236, a bright (I = 11.6), very low mass binary system with an orbital period of 0.77 days. Analysis of light and radial velocity curves of the system yielded component masses of 0.38 ± 0.02 M sun and 0.28 ± 0.02 M sun . The central values for the stellar radii are larger than the theoretical models predict for these masses, in agreement with the results for existing eclipsing binaries, although the present 5% observational uncertainties limit the significance of the larger radii to approximately 1σ. Degeneracies in the light curve models resulting from the unknown configuration of surface spots on the components of GJ 3236 currently dominate the uncertainties in the radii, and could be reduced by obtaining precise, multiband photometry covering the full orbital period. The system appears to be tidally synchronized and shows signs of high activity levels as expected for such a short orbital period, evidenced by strong Hα emission lines in the spectra of both components. These observations probe an important region of mass-radius parameter space around the predicted transition to fully convective stellar interiors, where there are a limited number of precise measurements available in the literature.
The Approximate Loebl-Komlos-Sos Conjecture III: The Finer Structure of LKS Graphs
Czech Academy of Sciences Publication Activity Database
Hladký, J.; Komlós, J.; Piguet, Diana; Simonovits, M.; Stein, M.; Szemerédi, E.
2017-01-01
Roč. 31, č. 2 (2017), s. 1017-1071 ISSN 0895-4801 R&D Projects: GA MŠk(CZ) 1M0545; GA ČR GJ16-07822Y Grant - others:EPRSC(GB) EP/D063191/1; EPRSC(GB) EP/J501414/1; FP7(XE) PIEF-GA-2009-253925; GA MŠK(CZ) CZ.1.05/1.1.00/02.0090 Institutional support: RVO:67985807 Keywords : extremal graph theory * Loebl–Komlós–Sós conjecture * regularity lemma Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.755, year: 2016
31 CFR 598.319 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 598.319... General Definitions § 598.319 U.S. financial institution. The term U.S. financial institution means any U..., offices, and agencies of foreign financial institutions which are located in the United States, but not...
31 CFR 588.311 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 588.311... General Definitions § 588.311 U.S. financial institution. The term U.S. financial institution means any U... financial institutions that are located in the United States, but not such institutions' foreign branches...
31 CFR 545.314 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 545.314... General Definitions § 545.314 U.S. financial institution. The term U.S. financial institution means any U... financial institutions that are located in the United States, but not such institutions' foreign branches...
Optical to near-infrared transit observations of super-Earth GJ 1214b: water-world or mini-Neptune?
de Mooij, E. J. W.; Brogi, M.; de Kok, R. J.; Koppenhoefer, J.; Nefs, S. V.; Snellen, I. A. G.; Greiner, J.; Hanse, J.; Heinsbroek, R. C.; Lee, C. H.; van der Werf, P. P.
2012-02-01
Context. GJ 1214b, the 6.55 Earth-mass transiting planet recently discovered by the MEarth team, has a mean density of ~35% of that of the Earth. It is thought that this planet is either a mini-Neptune, consisting of a rocky core with a thick, hydrogen-rich atmosphere, or a planet with a composition dominated by water. Aims: In the case of a hydrogen-rich atmosphere, molecular absorption and scattering processes may result in detectable radius variations as a function of wavelength. The aim of this paper is to measure these variations. Methods: We have obtained observations of the transit of GJ 1214b in the r- and I-band with the Isaac Newton Telescope (INT), in the g-, r-, i- and z-bands with the 2.2 m MPI/ESO telescope, in the Ks-band with the Nordic Optical Telescope (NOT), and in the Kc-band with the William Herschel Telescope (WHT). By comparing the transit depth between the the different bands, which is a measure for the planet-to-star size ratio, the atmosphere is investigated. Results: We do not detect clearly significant variations in the planet-to-star size ratio as function of wavelength. Although the ratio at the shortest measured wavelength, in g-band, is 2σ larger than in the other bands. The uncertainties in the Ks and Kc bands are large, due to systematic features in the light curves. Conclusions: The tentative increase in the planet-to-star size ratio at the shortest wavelength could be a sign of an increase in the effective planet-size due to Rayleigh scattering, which would require GJ 1214b to have a hydrogen-rich atmosphere. If true, then the atmosphere has to have both clouds, to suppress planet-size variations at red optical wavelengths, as well as a sub-solar metallicity, to suppress strong molecular features in the near- and mid-infrared. However, star spots, which are known to be present on the host-star's surface, can (partly) cancel out the expected variations in planet-to-star size ratio, because the lower surface temperature of the
Janssen, Dick B.; Pries, Frens; Ploeg, Jan van der; Kazemier, Bert; Terpstra, Peter; Witholt, Bernard
1989-01-01
A gene bank from the chlorinated hydrocarbon-degrading bacterium Xanthobacter autotrophicus GJ10 was prepared in the broad-host-range cosmid vector pLAFR1. By using mutants impaired in dichloroethane utilization and strains lacking dehalogenase activities, several genes involved in
Controllable synthesis and enhanced photocatalytic properties of Cu2O/Cu31S16 composites
International Nuclear Information System (INIS)
Liu, Xueqin; Li, Zhen; Zhang, Qiang; Li, Fei
2012-01-01
Highlights: ► Facile sonochemical route. ► The content of Cu 31 S 16 in the Cu 2 O/Cu 31 S 16 can be easily controlled. ► Structure and optical properties of Cu 2 O/Cu 31 S 16 were discussed. ► Enhanced photocatalytic property of Cu 2 O/Cu 31 S 16 . ► Cu 2 O/Cu 31 S 16 core/shell structures were more stable than single Cu 2 O particles. -- Abstract: The controlled synthesis of Cu 2 O/Cu 31 S 16 microcomposites with hierarchical structures had been prepared via a convenient sonochemical route. Ultrasonic irradiation of a mixture of Cu 2 O and (NH 2 ) 2 CS in an aqueous medium yielded Cu 2 O/Cu 31 S 16 composites. The content of Cu 31 S 16 in the Cu 2 O/Cu 31 S 16 can be easily controlled by adjusting the synthesis time. The Cu 31 S 16 layer not only protected and stabilized Cu 2 O particles, but also prohibited the recombination of photogenerated electrons–holes pair between Cu 31 S 16 and Cu 2 O. X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FTIR) spectra, ultraviolet–visible (UV–Vis) spectroscopy and photoluminescence (PL) spectroscopy were used to characterize the products. Photocatalytic performance of the Cu 2 O/Cu 31 S 16 hierarchical structures was evaluated by measuring the decomposition rate of methyl orange solution under natural light. To the best of our knowledge, this is the first report on the preparation and photocatalytic activity of Cu 2 O/Cu 31 S 16 microcomposite. Additionally, the Cu 2 O/Cu 31 S 16 core/shell structures were more stable than single Cu 2 O particles during photocatalytic process since the photocatalytic activity of the second reused architecture sample was much higher than that of pure Cu 2 O. The Cu 2 O/Cu 31 S 16 microcomposites may be a good promising candidate for wastewater treatment.
Microglial KCa3.1 Channels as a Potential Therapeutic Target for Alzheimer’s Disease
Directory of Open Access Journals (Sweden)
Izumi Maezawa
2012-01-01
Full Text Available There exists an urgent need for new target discovery to treat Alzheimer’s disease (AD; however, recent clinical trials based on anti-Aβ and anti-inflammatory strategies have yielded disappointing results. To expedite new drug discovery, we propose reposition targets which have been previously pursued by both industry and academia for indications other than AD. One such target is the calcium-activated potassium channel KCa3.1 (KCNN4, which in the brain is primarily expressed in microglia and is significantly upregulated when microglia are activated. We here review the existing evidence supporting that KCa3.1 inhibition could block microglial neurotoxicity without affecting their neuroprotective phagocytosis activity and without being broadly immunosuppressive. The anti-inflammatory and neuroprotective effects of KCa3.1 blockade would be suitable for treating AD as well as cerebrovascular and traumatic brain injuries, two well-known risk factors contributing to the dementia in AD patients presenting with mixed pathologies. Importantly, the pharmacokinetics and pharmacodynamics of several KCa3.1 blockers are well known, and a KCa3.1 blocker has been proven safe in clinical trials. It is therefore promising to reposition old or new KCa3.1 blockers for AD preclinical and clinical trials.
Exposure to psychosocial work factors in 31 European countries.
Niedhammer, I; Sultan-Taïeb, H; Chastang, J-F; Vermeylen, G; Parent-Thirion, A
2012-04-01
Although psychosocial work factors are recognized as major occupational risk factors, little information is available regarding the prevalence of exposure to these factors and the differences in exposure between countries. To explore the differences in various psychosocial work exposures between 31 European countries. The study was based on a sample of 14,881 male and 14,799 female workers from the 2005 European Working Conditions Survey. Eighteen psychosocial work factors were studied: low decision latitude (skill discretion and decision authority), high psychological demands, job strain, low social support, iso-strain, physical violence, sexual harassment, bullying, discrimination, work-family imbalance, long working hours, high effort, job insecurity, low job promotion, low reward and effort-reward imbalance. Covariates were age, number of workers in household, occupation, economic activity, self-employed/employee, public/private sector and part/full time work. Statistical analysis was performed using multilevel logistic regression analysis. Significant differences in all psychosocial work factors were observed between countries. The rank of the countries varied according to the exposure considered. However, some countries, especially Denmark, Netherlands and Norway, displayed a significantly lower prevalence of exposure to four factors or more, while some Southern and Eastern countries, especially Czech Republic, Greece, Lithuania and Turkey, had a higher prevalence. Differences in psychosocial work exposures were found between countries. This study is the first to compare a large set of psychosocial work exposures between 31 European countries. These findings may be useful to guide prevention policies at European level.
31 CFR 537.323 - U.S. registered money transmitter.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. registered money transmitter. 537.323 Section 537.323 Money and Finance: Treasury Regulations Relating to Money and Finance... General Definitions § 537.323 U.S. registered money transmitter. The term U.S. registered money...
31 CFR 538.319 - U.S. registered money transmitter.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. registered money transmitter. 538.319 Section 538.319 Money and Finance: Treasury Regulations Relating to Money and Finance... General Definitions § 538.319 U.S. registered money transmitter. The term U.S. registered money...
Czech Academy of Sciences Publication Activity Database
Horáková, Eva; Changmai, Piya; Paris, Zdeněk; Salmon, D.; Lukeš, Julius
2015-01-01
Roč. 282, č. 21 (2015), s. 4157-4175 ISSN 1742-464X R&D Projects: GA ČR(CZ) GAP305/11/2179; GA ČR GJ15-21450Y; GA MŠk LH12104 EU Projects: European Commission(XE) 316304 Institutional support: RVO:60077344 Keywords : Atm * Fe-S cluster * heme * Mdl * Trypanosoma Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.237, year: 2015
International Nuclear Information System (INIS)
Anglada-Escudé, Guillem; Butler, R. Paul; Arriagada, Pamela; Minniti, Dante; Vogt, Steven S.; Rivera, Eugenio J.; Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian B.; Haghighipour, Nader; Carter, Brad D.; Tinney, C. G.; Wittenmyer, Robert A.; Bailey, Jeremy A.; O'Toole, Simon J.; Jones, Hugh R. A.; Jenkins, James S.
2012-01-01
We re-analyze 4 years of HARPS spectra of the nearby M1.5 dwarf GJ 667C available through the European Southern Observatory public archive. The new radial velocity (RV) measurements were obtained using a new data analysis technique that derives the Doppler measurement and other instrumental effects using a least-squares approach. Combining these new 143 measurements with 41 additional RVs from the Magellan/Planet Finder Spectrograph and Keck/High Resolution Echelle Spectrometer spectrometers reveals three additional signals beyond the previously reported 7.2 day candidate, with periods of 28 days, 75 days, and a secular trend consistent with the presence of a gas giant (period ∼10 years). The 28 day signal implies a planet candidate with a minimum mass of 4.5 M ⊕ orbiting well within the canonical definition of the star's liquid water habitable zone (HZ), that is, the region around the star at which an Earth-like planet could sustain liquid water on its surface. Still, the ultimate water supporting capability of this candidate depends on properties that are unknown such as its albedo, atmospheric composition, and interior dynamics. The 75 day signal is less certain, being significantly affected by aliasing interactions among a potential 91 day signal, and the likely rotation period of the star at 105 days detected in two activity indices. GJ 667C is the common proper motion companion to the GJ 667AB binary, which is metal-poor compared to the Sun. The presence of a super-Earth in the HZ of a metal-poor M dwarf in a triple star system supports the evidence that such worlds should be ubiquitous in the Galaxy.
Clarification of the technic of intrinsic factor radioimmunoassay for the cat and the rat
International Nuclear Information System (INIS)
Perrin, M.O.; Nicolas, J.P.; Dubrasquet, M.
1983-01-01
Cats and rats secrete very small quantities of gastric juice (GJ). In order to measure the Intrinsic Factor (IF) in GJ of animals certain modifications are necessary. It is very important to select with great care pernicious anemia sera which will be used to cross react with the animals' IF to determine their IF level by radioimmunoassay. The technic described here enables the dosage of low quantities of IF with a 7 per cent coefficient of variation [fr
Mentink, Matthias; Mulder, Tim; Van Nugteren, Jeroen; ten Kate, Herman
2016-01-01
An investigation is performed on the quench behavior of a conceptual 50-GJ 8-T high-temperature-superconductor-based solenoid. In this design, a 50-kA conductor-on-round-core cable-in-conduit conductor utilizing ReBCO technology is envisioned, operating at 40 K. Various properties such as resistivity, thermal conductivity, and heat capacity are very different at this temperature, which affects the quench behavior. It is found that the envisioned conductor is very stable with a minimum quench energy of about 2 kJ. However, the quench propagation velocity is typically about 20 mm/s, so that creating a wide-spread normal zone throughout the coil is very challenging. Moreover, an extraction voltage exceeding 20 kV would be required to ensure a hot-spot temperature below 100 K once a thermal runaway occurs. A novel concept dubbed “rapid quench transformation” is proposed whereby the superconducting conductor is co-wound with a normal conductor to achieve a high degree of inductive coupling. This geometry allow...
Czech Academy of Sciences Publication Activity Database
Moravec, František; Ali, A. H.
2005-01-01
Roč. 52, č. 3 (2005), s. 267-273 ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * marine fishes * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005
Energy use and energy intensity of the U.S. chemical industry
Energy Technology Data Exchange (ETDEWEB)
Worrell, E.; Phylipsen, D.; Einstein, D.; Martin, N.
2000-04-01
The U.S. chemical industry is the largest in the world, and responsible for about 11% of the U.S. industrial production measured as value added. It consumes approximately 20% of total industrial energy consumption in the U.S. (1994), and contributes in similar proportions to U.S. greenhouse gas emissions. Surprisingly, there is not much information on energy use and energy intensity in the chemical industry available in the public domain. This report provides detailed information on energy use and energy intensity for the major groups of energy-intensive chemical products. Ethylene production is the major product in terms of production volume of the petrochemical industry. The petrochemical industry (SIC 2869) produces a wide variety of products. However, most energy is used for a small number of intermediate compounds, of which ethylene is the most important one. Based on a detailed assessment we estimate fuel use for ethylene manufacture at 520 PJ (LHV), excluding feedstock use. Energy intensity is estimated at 26 GJ/tonne ethylene (LHV), excluding feedstocks.The nitrogenous fertilizer production is a very energy intensive industry, producing a variety of fertilizers and other nitrogen-compounds. Ammonia is the most important intermediate chemical compound, used as basis for almost all products. Fuel use is estimated at 268 PJ (excluding feedstocks) while 368 PJ natural gas is used as feedstock. Electricity consumption is estimated at 14 PJ. We estimate the energy intensity of ammonia manufacture at 39.3 GJ/tonne (including feedstocks, HHV) and 140 kWh/tonne, resulting in a specific primary energy consumption of 40.9 GJ/tonne (HHV), equivalent to 37.1 GJ/tonne (LHV). Excluding natural gas use for feedstocks the primary energy consumption is estimated at 16.7 GJ/tonne (LHV). The third most important product from an energy perspective is the production of chlorine and caustic soda. Chlorine is produced through electrolysis of a salt-solution. Chlorine production is
Directory of Open Access Journals (Sweden)
Seetha Ram Kotra
2014-03-01
Full Text Available Objective:Synthetic cationic antimicrobial peptide (SC-AMP is an important and upcoming therapeutic molecule against onventional antibiotics. In this study, an attempt was made to purify the SC-AMP without the enzymatic cleavage of the affinity tag, by using an intein-based system. Methods:The intein sequence was amplified from pTYB11 vector using PCR methodologies and the N-terminal of intein was ligated with SC-AMP. The designed construct, intein-SC-AMP was cloned into MCS region of cold shock expression vector, pCOLDI and the recombinant peptide was purified on a chitin affinity column by cleaving intein with 50 mM DTT without applying enzymatic cleavage. Later the peptide was quantified and its antibacterial activity of the purified peptide was studied using well diffusion method. Results: Initially, intein-SC-AMP was expressed as a fusion protein in both IPTG inducible E. coli BL21(DE3 and salt inducible E. coli GJ1158. Single step purification using CBD (chitin binding domain - intein tag in salt inducible E. coli GJ1158, yields the SC-AMP in the soluble form at a oncentration of 208 mg/L. The antibacterial activity and minimal inhibitory concentration (MIC of the purified SC-AMP was studied against both Gram positive and Gram negative microorganisms. Conclusion: For the first time, single step purification of soluble SC-AMP was carried out using chitin-binding domain affinity tag in salt inducible E. coli GJ1158 without an application of enzymatic cleavage. J Microbiol Infect Dis 2014;4(1:13-19
Air Force Journal of Logsitics. Volume 31, Number 3, Fall 2007
2007-01-01
Prc s roemn DLA Fowr Stokig: An Ecnoi Anlyi O f0122002 htp :/w w.fmahqafmi/gj/Afjhmehm AIR FORCE JOURNAL LOGISTICS Volume XXXI, Number 3 Fall 2007...Foc spl sytm and our ledrhpi plnnn is main ls tic plyi ag m s si uato s an exrie trl meanigful AFL A You LgsisSuiesadAayisCneto htp :/w w.fIahqafmi...less than 5 years (in accordance with CAF LSC - Combat Air Forces Logistics Support Air Force Manual 23-I 10). Therefore. the model evaluates Center
DEFF Research Database (Denmark)
van der Ploeg, J; Willemsen, M; Van Hall, Gerrit
1995-01-01
B gene. In mutant GJ10M50, a DNA fragment (designated IS1247) had copied itself from a position on the chromosome that was not linked to the dhlB region to a site immediately upstream of dhlB, resulting in a 1,672-bp insertion. IS1247 was found to encode an open reading frame corresponding to 464 amino...... acids which showed similarity to putative transposases from two other insertion elements. In most of the other MBA-resistant mutants of GJ10, IS1247 was also present in one more copy than in the wild type, which had two copies located within 20 kb. After insertion to a site proximal to dhlB, IS1247...... was able to transpose itself together with the dhlB gene to a plasmid, without the requirement of a second insertion element being present downstream of dhlB. The results show that IS1247 causes bromoacetate resistance by overexpression and mobilization of the haloacid dehalogenase gene, which mimics steps...
31 CFR 597.319 - U.S. financial institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. financial institution. 597.319 Section 597.319 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE... financial institution's foreign branches; (b) Any financial institution operating or doing business in the...
31 CFR 537.319 - U.S. depository institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. depository institution. 537.319 Section 537.319 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE..., that is engaged primarily in the business of banking (for example, banks, savings banks, savings...
31 CFR 538.317 - U.S. depository institution.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. depository institution. 538.317 Section 538.317 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE..., that is engaged primarily in the business of banking (for example, banks, savings banks, savings...
Czech Academy of Sciences Publication Activity Database
Scholz, Tomáš; Harris, C. E.
2006-01-01
Roč. 73, č. 1 (2006), s. 130-133 ISSN 1525-2647 R&D Projects: GA ČR GA524/04/0342; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : metacestodes * fish * morphology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.659, year: 2006
Li, Yongjie; Tang, Aiwei; Liu, Zhenyang; Peng, Lan; Yuan, Yi; Shi, Xifeng; Yang, Chunhe; Teng, Feng
2018-01-07
A simple two-phase strategy was developed to prepare Cu 31 S 16 -CuInS 2 heterostructures (HNS) at the oil/aqueous interface, in which the In(OH) 3 phase was often obtained in the products due to the reaction between indium ions and hydroxyl ions in the aqueous phase. To prevent the formation of the In(OH) 3 phase, citric acid was incorporated into the aqueous phase to assist in the synthesis of uniform carrot-like Cu 31 S 16 -CuInS 2 semiconductor HNS at the oil/aqueous interface for the first time. By manipulating the dosage of citric acid and Cu/In precursor ratios, the morphology of the Cu 31 S 16 -CuInS 2 HNS could be tailored from mushroom to carrot-like, and the presence of citric acid played a critical role in the synthesis of high-quality Cu 31 S 16 -CuInS 2 HNS, which inhibited the formation of the In(OH) 3 phase due to the formation of the indium(iii)-citric acid complex. The formation mechanism was studied by monitoring the morphology and phase evolution of the Cu 31 S 16 -CuInS 2 HNS with reaction time, which revealed that the Cu 31 S 16 seeds were first formed and then the cation-exchange reaction directed the subsequent anisotropic growth of the Cu 31 S 16 -CuInS 2 HNS.
Czech Academy of Sciences Publication Activity Database
Mašová, Š.; Moravec, František; Baruš, V.; Seifertová, M.
2010-01-01
Roč. 57, č. 4 (2010), s. 280-288 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Grant - others:GA ČR(CZ) GD526/09/H025 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Brevimulticaecum * Multicaecum * Senegal * Sudan * Africa * Heterotis * barcoding * 18S rDNA sequences * ITS2 sequences Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010
International Nuclear Information System (INIS)
Makarov, Valeri V.; Berghea, Ciprian; Efroimsky, Michael
2012-01-01
GJ 581d is a potentially habitable super-Earth in the multiple system of exoplanets orbiting a nearby M dwarf. We investigate this planet's long-term dynamics with an emphasis on its probable final rotation states acquired via tidal interaction with the host. The published radial velocities for the star are re-analyzed with a benchmark planet detection algorithm to confirm that there is no evidence for the recently proposed two additional planets (f and g). Limiting the scope to the four originally detected planets, we assess the dynamical stability of the system and find bounded chaos in the orbital motion. For the planet d, the characteristic Lyapunov time is 38 yr. Long-term numerical integration reveals that the system of four planets is stable, with the eccentricity of the planet d changing quasi-periodically in a tight range around 0.27, and with its semimajor axis varying only a little. The spin-orbit interaction of GJ 581d with its host star is dominated by the tides exerted by the star on the planet. We model this interaction, assuming a terrestrial composition of the mantle. Besides the triaxiality-caused torque and the secular part of the tidal torque, which are conventionally included in the equation of motion, we also include the tidal torques' oscillating components. It turns out that, depending on the mantle temperature, the planet gets trapped into the 2:1 or an even higher spin-orbit resonance. It is very improbable that the planet could have reached the 1:1 resonance. This improves the possibility of the planet being suitable for sustained life.
International Nuclear Information System (INIS)
Knutson, Heather A.; Madhusudhan, Nikku; Cowan, Nicolas B.; Christiansen, Jessie L.; Agol, Eric; Deming, Drake; Desert, Jean-Michel; Charbonneau, David; Henry, Gregory W.; Homeier, Derek; Laughlin, Gregory; Langton, Jonathan; Seager, Sara
2011-01-01
In this paper, we describe a uniform analysis of eight transits and eleven secondary eclipses of the extrasolar planet GJ 436b obtained in the 3.6, 4.5, and 8.0 μm bands using the IRAC instrument on the Spitzer Space Telescope between UT 2007 June 29 and UT 2009 February 4. We find that the best-fit transit depths for visits in the same bandpass can vary by as much as 8% of the total (4.7σ significance) from one epoch to the next. Although we cannot entirely rule out residual detector effects or a time-varying, high-altitude cloud layer in the planet's atmosphere as the cause of these variations, we consider the occultation of active regions on the star in a subset of the transit observations to be the most likely explanation. We find that for the deepest 3.6 μm transit the in-transit data have a higher standard deviation than the out-of-transit data, as would be expected if the planet occulted a star spot. We also compare all published transit observations for this object and find that transits observed in the infrared typically have smaller timing offsets than those observed in visible light. In this case, the three deepest Spitzer transits are all measured within a period of five days, consistent with a single epoch of increased stellar activity. We reconcile the presence of magnetically active regions with the lack of significant visible or infrared flux variations from the star by proposing that the star's spin axis is tilted with respect to our line of sight and that the planet's orbit is therefore likely to be misaligned. In contrast to the results reported by Beaulieu et al., we find no convincing evidence for methane absorption in the planet's transmission spectrum. If we exclude the transits that we believe to be most affected by stellar activity, we find that we prefer models with enhanced CO and reduced methane, consistent with GJ 436b's dayside composition from Stevenson et al. It is also possible that all transits are significantly affected by this
Czech Academy of Sciences Publication Activity Database
Umur, S.; Moravec, František; Gurler, A.; Bolukbas, C.; Acici, M.
2012-01-01
Roč. 41, č. 6 (2012), s. 384-387 ISSN 0047-2565 Institutional support: RVO:60077344 Keywords : Aonchotheca annulosa * baboon * Capillariidae * Turkey * zoo Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine; GJ - Animal Vermins ; Diseases, Veterinary Medicine (BC-A) Impact factor: 1.106, year: 2012 http://onlinelibrary.wiley.com/doi/10.1111/jmp.12020/abstract
Global Properties of M31's Stellar Halo from the SPLASH Survey. I. Surface Brightness Profile
Gilbert, Karoline M.; Guhathakurta, Puragra; Beaton, Rachael L.; Bullock, James; Geha, Marla C.; Kalirai, Jason S.; Kirby, Evan N.; Majewski, Steven R.; Ostheimer, James C.; Patterson, Richard J.; Tollerud, Erik J.; Tanaka, Mikito; Chiba, Masashi
2012-11-01
We present the surface brightness profile of M31's stellar halo out to a projected radius of 175 kpc. The surface brightness estimates are based on confirmed samples of M31 red giant branch stars derived from Keck/DEIMOS spectroscopic observations. A set of empirical spectroscopic and photometric M31 membership diagnostics is used to identify and reject foreground and background contaminants. This enables us to trace the stellar halo of M31 to larger projected distances and fainter surface brightnesses than previous photometric studies. The surface brightness profile of M31's halo follows a power law with index -2.2 ± 0.2 and extends to a projected distance of at least ~175 kpc (~2/3 of M31's virial radius), with no evidence of a downward break at large radii. The best-fit elliptical isophotes have b/a = 0.94 with the major axis of the halo aligned along the minor axis of M31's disk, consistent with a prolate halo, although the data are also consistent with M31's halo having spherical symmetry. The fact that tidal debris features are kinematically cold is used to identify substructure in the spectroscopic fields out to projected radii of 90 kpc and investigate the effect of this substructure on the surface brightness profile. The scatter in the surface brightness profile is reduced when kinematically identified tidal debris features in M31 are statistically subtracted; the remaining profile indicates that a comparatively diffuse stellar component to M31's stellar halo exists to large distances. Beyond 90 kpc, kinematically cold tidal debris features cannot be identified due to small number statistics; nevertheless, the significant field-to-field variation in surface brightness beyond 90 kpc suggests that the outermost region of M31's halo is also comprised to a significant degree of stars stripped from accreted objects. The data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California
DEFF Research Database (Denmark)
Harpsøe, Kennet Bomann West; Hardis, S.; Hinse, T. C.
2012-01-01
Aims: We present 11 high-precision photometric transit observations of the transiting super-Earth planet GJ1214b. Combining these data with observations from other authors, we investigate the ephemeris for possible signs of transit timing variations (TTVs) using a Bayesian approach. Methods......: The observations were obtained using telescope-defocusing techniques, and achieve a high precision with random errors in the photometry as low as 1mmag per point. To investigate the possibility of TTVs in the light curve, we calculate the overall probability of a TTV signal using Bayesian methods. Results...
Study of the early signal perturbations due to GJ and Elves using the LWPC code
Nait Amor, Samir; Ghalila, Hassen; Bouderba, Yasmina
2015-04-01
Early events are a Very Low Frequencies (VLF) signal perturbations recorded during a lightning activity. The properties of these signal perturbations and their association to the lightning peak current and/or Transient Luminous Events (TLEs) were widely studied. In a recently analysis a new early signal perturbations whose recovery time persists for several minutes were discovered. The underlying cause of these events is still unclear. In a recently published work, these events were attributed to the lightning peak current and the type of associated TLE. In others, and newly published papers, analyzes were done where all kind of early events were considered. Statistical results showed that the occurrence of long recovery events is independent of the lightning current amplitude and/or TLEs type. To understand which is the main cause of these events, we analyzed two types of early signal perturbations: One was a typical event (~200s time duration) in association with a Gigantic Jet and the second was a long recovery event in association with an elve recorded on December 12 2009 during the EuroSprite campaign. In addition to the VLF signal analysis, we used the Long Wave Propagation Capability (LWPC) code to simulate the unperturbed and perturbed signal parameters (amplitude and phase), to determine the signal modes attenuation coefficient and then to infer the electron density increases in the disturbed region. The results showed that the reference height was reduced from its ambient value (87km) to 66.4 km in the case of the GJ and 74.3 km for the elve. These reference heights decreases affected the propagating signal at the disturbed region by increasing the modes attenuation coefficient. Effectively, the number of modes was reduced from 28 at ambient condition to 9 modes (in the case of GJ) and 17 (in the case of elve). This high attenuation of modes leads to the appearance of null signal perturbations positions due to the interferences. Between two null positions
Detection of Plasmodium spp. in Human Feces
Czech Academy of Sciences Publication Activity Database
Jirků, Milan; Pomajbíková, K.; Petrželková, Klára Judita; Hůzová, Z.; Modrý, David; Lukeš, Julius
2012-01-01
Roč. 18, č. 4 (2012), s. 634-636 ISSN 1080-6040 R&D Projects: GA ČR GA206/09/0927 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z60930519 Keywords : great apes * faecal samples * PCR Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine; GJ - Animal Vermins ; Diseases , Veterinary Medicine (UBO-W) Impact factor: 5.993, year: 2012
27 CFR 31.161 - Conversion between metric and U.S. units.
2010-04-01
... Wholesale Dealers' Records and Reports § 31.161 Conversion between metric and U.S. units. When liters are... number of cases to be converted, as follows: (a) If the conversion from liters to U.S. units is made... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion between metric...
EXTraS discovery of a 1.2-s X-ray pulsar in M31
Esposito, P.; Israel, G.; Belfiore, A.; Novara, G.; Sidoli, L.; Rodriguez Castillo, G.; De Luca, A.; Tiengo, A.; Haberl, F.; Salvaterra, R.
2017-10-01
A systematic search for periodic signals in the XMM-Newton's EPIC archive carried out within the EXTraS project resulted in the discovery of a 1.2-s flux modulation in 3XMM J004301.4+413017. It is the first accreting neutron star in M31 for which the spin period has been detected. Besides this distinction, 3XMM J0043 proved to be an interesting system. Doppler shifts of the spin modulation revealed an orbital motion with period of 1.27 d and the analysis of optical data shows that, while the source is likely associated to a globular cluster, a counterpart with V ˜ 22 outside the cluster cannot be excluded. The emission of the pulsar appears rather hard (most data are described by a power law with photon index <1) and, assuming the distance to M31, the 0.3-10 keV luminosity was variable, from ˜3×10^{37} to 2×10^{38} erg/s. Based on this, we discuss two main possible scenarios for 3X J0043: a peculiar low-mass X-ray binary, perhaps similar to 4U 1822-37 or 4U 1626-67, or an intermediate-mass X-ray binary akin Her X-1.
Kobayashi, Shinji; Nishimiya, Nobuo; Suzuki, Masao
2017-10-01
The saturated absorption lines of neutral titanium were measured in the region of 9950-14380 cm-1 using a Ti:sapphire ring laser. A facing target sputtering system was used to obtain the gaseous state of a Ti I atom. The Zeeman splitting of 38 transitions was observed under the condition that the electric field component of a linearly polarized laser beam was parallel to the magnetic field. The gJ factors of the odd parity states were determined for 28 states belonging to 3d24s4p and 3d34p using those of the even parity states reported by Stachowska in 1997. The gJ factors of z5P1,2,3 levels were newly determined. gJ of y3F2, y3D2, z3P2, and z5S2 levels were refined.
HADES RV Programme with HARPS-N at TNG. VI. GJ 3942 b behind dominant activity signals
Perger, M.; Ribas, I.; Damasso, M.; Morales, J. C.; Affer, L.; Suárez Mascareño, A.; Micela, G.; Maldonado, J.; González Hernández, J. I.; Rebolo, R.; Scandariato, G.; Leto, G.; Zanmar Sanchez, R.; Benatti, S.; Bignamini, A.; Borsa, F.; Carbognani, A.; Claudi, R.; Desidera, S.; Esposito, M.; Lafarga, M.; Martinez Fiorenzano, A. F.; Herrero, E.; Molinari, E.; Nascimbeni, V.; Pagano, I.; Pedani, M.; Poretti, E.; Rainer, M.; Rosich, A.; Sozzetti, A.; Toledo-Padrón, B.
2017-12-01
Context. Short- to mid-term magnetic phenomena on the stellar surface of M-type stars can resemble the effects of planets in radial velocity data, and may also hide them. Aims: We analyze 145 spectroscopic HARPS-N observations of GJ 3942 taken over the past five years and additional photometry in order to disentangle stellar activity effects from genuine Doppler signals as a result of the orbital motion of the star around the common barycenter with its planet. Methods: To achieve this, we use the common methods of pre-whitening, and treat the correlated red noise by a first-order moving average term and by Gaussian-process regression following an MCMC analysis. Results: We identify the rotational period of the star at 16.3 days and discover a new super-Earth, GJ 3942 b, with an orbital period of 6.9 days and a minimum mass of 7.1 M⊕. An additional signal in the periodogram of the residuals is present, but at this point we cannot claim with sufficient significance that it is related to a second planet. If confirmed, this planet candidate would have a minimum mass of 6.3 M⊕ and a period of 10.4 days, which might indicate a 3:2 mean-motion resonance with the inner planet. Based on observations made with the Italian Telescopio Nazionale Galileo (TNG), operated on the island of La Palma by the INAF - Fundación Galileo Galilei at the Roque de los Muchachos Observatory of the Instituto de Astrofísica de Canarias (IAC); photometric observations from the APACHE array located at the Astronomical Observatory of the Aosta Valley; photometric observations made with the robotic APT2 (within the EXORAP program) located at Serra La Nave on Mt. Etna.Table 9 is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/608/A63
Energy Technology Data Exchange (ETDEWEB)
Eswaran, M A; Gove, H E; Cook, R; Sikora, B [Rochester Univ., NY (USA). Nuclear Structure Research Lab.
1979-08-13
The ..cap alpha..-transfer reactions /sup 27/Al(/sup 6/Li,d)/sup 31/P,/sup 29/Si(/sup 6/Li,d) /sup 33/S and /sup 31/P(Li,d)/sup 35/Cl have been studied at a /sup 6/Li energy of 36 MeV. Absolute cross sections and angular distributions have been measured and an exact finite-range distorted-wave Born approximation analysis assuming a direct cluster transfer has been used to extract from the data ..cap alpha..-particle spectroscopic strengths for levels populated in /sup 31/P, /sup 33/S and /sup 35/Cl in three reactions respectively. The results show that in the case of most of the low-lying excited states of /sup 31/P a single value of L of the transferred ..cap alpha..-particle contributes, though a multiplicity of L-values are allowed by angular momentum selection rules. It is also found that the ..cap alpha..-particle spectroscopic strength of the ground state of /sup 31/P is a factor of 2 more than the strengths of the ground states of /sup 33/S and /sup 35/Cl. The ..cap alpha..-spectroscopic strengths of ground states of these, as well as other odd-A s-d shell nuclei, are compared with the presently available shell model calculations.
A Skew Version of the Loebl–Komlós–Sós Conjecture
Czech Academy of Sciences Publication Activity Database
Klimošová, T.; Piguet, Diana; Rozhoň, Václav
2017-01-01
Roč. 61, August (2017), s. 743-749 ISSN 1571-0653 R&D Projects: GA ČR GJ16-07822Y; GA ČR GBP202/12/G061 Institutional support: RVO:67985807 Keywords : extremal graph theory * trees * Loebl-Komlós-Sós conjecture * regularity lemma Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics
HELIUM ATMOSPHERES ON WARM NEPTUNE- AND SUB-NEPTUNE-SIZED EXOPLANETS AND APPLICATIONS TO GJ 436b
Energy Technology Data Exchange (ETDEWEB)
Hu, Renyu; Yung, Yuk L. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Seager, Sara, E-mail: renyu.hu@jpl.nasa.gov [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)
2015-07-01
Warm Neptune- and sub-Neptune-sized exoplanets in orbits smaller than Mercury’s are thought to have experienced extensive atmospheric evolution. Here we propose that a potential outcome of this atmospheric evolution is the formation of helium-dominated atmospheres. The hydrodynamic escape rates of Neptune- and sub-Neptune-sized exoplanets are comparable to the diffusion-limited escape rate of hydrogen, and therefore the escape is heavily affected by diffusive separation between hydrogen and helium. A helium atmosphere can thus be formed—from a primordial hydrogen–helium atmosphere—via atmospheric hydrodynamic escape from the planet. The helium atmosphere has very different abundances of major carbon and oxygen species from those of a hydrogen atmosphere, leading to distinctive transmission and thermal emission spectral features. In particular, the hypothesis of a helium-dominated atmosphere can explain the thermal emission spectrum of GJ 436b, a warm Neptune-sized exoplanet, while also being consistent with the transmission spectrum. This model atmosphere contains trace amounts of hydrogen, carbon, and oxygen, with the predominance of CO over CH{sub 4} as the main form of carbon. With our atmospheric evolution model, we find that if the mass of the initial atmosphere envelope is 10{sup −3} planetary mass, hydrodynamic escape can reduce the hydrogen abundance in the atmosphere by several orders of magnitude in ∼10 billion years. Observations of exoplanet transits may thus detect signatures of helium atmospheres and probe the evolutionary history of small exoplanets.
HELIUM ATMOSPHERES ON WARM NEPTUNE- AND SUB-NEPTUNE-SIZED EXOPLANETS AND APPLICATIONS TO GJ 436b
International Nuclear Information System (INIS)
Hu, Renyu; Yung, Yuk L.; Seager, Sara
2015-01-01
Warm Neptune- and sub-Neptune-sized exoplanets in orbits smaller than Mercury’s are thought to have experienced extensive atmospheric evolution. Here we propose that a potential outcome of this atmospheric evolution is the formation of helium-dominated atmospheres. The hydrodynamic escape rates of Neptune- and sub-Neptune-sized exoplanets are comparable to the diffusion-limited escape rate of hydrogen, and therefore the escape is heavily affected by diffusive separation between hydrogen and helium. A helium atmosphere can thus be formed—from a primordial hydrogen–helium atmosphere—via atmospheric hydrodynamic escape from the planet. The helium atmosphere has very different abundances of major carbon and oxygen species from those of a hydrogen atmosphere, leading to distinctive transmission and thermal emission spectral features. In particular, the hypothesis of a helium-dominated atmosphere can explain the thermal emission spectrum of GJ 436b, a warm Neptune-sized exoplanet, while also being consistent with the transmission spectrum. This model atmosphere contains trace amounts of hydrogen, carbon, and oxygen, with the predominance of CO over CH 4 as the main form of carbon. With our atmospheric evolution model, we find that if the mass of the initial atmosphere envelope is 10 −3 planetary mass, hydrodynamic escape can reduce the hydrogen abundance in the atmosphere by several orders of magnitude in ∼10 billion years. Observations of exoplanet transits may thus detect signatures of helium atmospheres and probe the evolutionary history of small exoplanets
Czech Academy of Sciences Publication Activity Database
Calvo, E.; Mizurini, D.M.; Sa-Nunes, A.; Ribeiro, J.M.C.; Andersen, J. F.; Mans, B.J.; Monteiro, R.Q.; Kotsyfakis, Michalis; Francischetti, I.M.B.
2011-01-01
Roč. 286, č. 32 (2011), 27998-28010 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z60220518 Keywords : serpin * mosquito * Aedes albopictus * phospholipids * Factor Xa * heparin * binding affinity * coagulation * thrombus * bleeding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.773, year: 2011
DEFF Research Database (Denmark)
van der Ploeg, J; Van Hall, Gerrit; Janssen, D B
1991-01-01
B) was cloned and could be allocated to a 6.5-kb EcoRI-BglII fragment. Part of this fragment was sequenced, and the dhlB open reading frame was identified by comparison with the N-terminal amino acid sequence of the protein. The gene was found to encode a protein of 27,433 Da that showed considerable homology...... chromatography. The enzyme was active with 2-halogenated carboxylic acids and converted only the L-isomer of 2-chloropropionic acid with inversion of configuration to produce D-lactate. The activity of the enzyme was not readily influenced by thiol reagents. The gene encoding the haloacid dehalogenase (dhl...... (60.5 and 61.0% similarity) with the two other haloacid dehalogenases sequenced to date but not with the haloalkane dehalogenase from X. autotrophicus GJ10....
The κ-(AdS quantum algebra in (3+1 dimensions
Directory of Open Access Journals (Sweden)
Ángel Ballesteros
2017-03-01
Full Text Available The quantum duality principle is used to obtain explicitly the Poisson analogue of the κ-(AdS quantum algebra in (3+1 dimensions as the corresponding Poisson–Lie structure on the dual solvable Lie group. The construction is fully performed in a kinematical basis and deformed Casimir functions are also explicitly obtained. The cosmological constant Λ is included as a Poisson–Lie group contraction parameter, and the limit Λ→0 leads to the well-known κ-Poincaré algebra in the bicrossproduct basis. A twisted version with Drinfel'd double structure of this κ-(AdS deformation is sketched.
31 CFR 31.211 - Organizational conflicts of interest.
2010-07-01
... conflict may depend on a variety of factors, including the type of conflict, the scope of work under the... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Organizational conflicts of interest... ASSET RELIEF PROGRAM Conflicts of Interest § 31.211 Organizational conflicts of interest. (a) Retained...
Protection by Purines in Toxin Models of Parkinson’s Disease
2013-07-01
Puringergic Pathways to Clinical Trials for Parkinson’s Disease" [pending]. NIH (NINDS/ NIA ) R21 in response to FOA PA-11-261, “NIH Exploratory...pyrimidine bases, ribonucleosides, and ribonucleotides by high-pressure liquid chromatography. Analytical Biochemistry 1980; 106(2): 497– 505 . Quinlan GJ
Scoping Analysis on Core Disruptive Accident in PGSFR (2015 Results)
Energy Technology Data Exchange (ETDEWEB)
Lee, Seung Won; Chang, Won-Pyo; Ha, Kwi-Seok; Ahn, Sang June; Kang, Seok Hun; Choi, Chi-Woong; Lee, Kwi Lim; Jeong, Jae-Ho; Kim, Jin Su; Jeong, Taekyeong [KAERI, Daejeon (Korea, Republic of)
2016-05-15
In general, the severe accident is classified by three phases. The first phase is the initiation (pre-disassembly) phase that occurs the gradual core meltdown from accident initiation to the point of neutronic shutdown with an intact geometry. The second phase is the transition phase that happens the fuel transition from a solid to a liquid phase. Fuel and cladding can melt to form a molten pool and core can boil, then criticality conditions can recur. The third phase is the disassembly phase. In other words, this phase is Core Disruptive Accident (CDA). Power excursion is followed until the core is disassembled in this phase. In the early considerations of Liquid Metal Fast Breeder Reactor (LMFBR) energetics, the term Hypothetical Core Disruptive Accidents (HCDAs) was in common use. This was not only to connote the extremely low probability of initiation of such accidents, but also the tentative nature of our understanding of their behavior and resulting consequences. A numerical analysis is conducted to estimate the energy release, pressure behavior and core expansion behavior induced by CDA of PGSFR using CDA-ER and CDA-CEME codes. Conservatively, the calculated results of energy release and pressure behavior induced by CDA without Doppler effect in PGSFR when whole cores were melted (100 $/s) were 7.844 GJ and 4.845 GPa, respectively. With Doppler effect, the analyzed maximum energy release and pressure were 6.696 GJ and 3.449 GPa, respectively. The calculated results of the core expansion behavior during 0.015 seconds after the explosion without Doppler effect in PGSFR when whole cores were melted (100 $/s) were as follows: The total energy is calculated to be 1.87 GJ. At 0.01 s, the kinetic energy of the sodium is 1.85 GJ, while the expansion work and internal energy of the bubble are 19.7 MJ and 0.98 J, respectively. With Doppler effect, the total energy is calculated to be 1.33 GJ. At 0.01 s, the kinetic energy of the sodium is 1.31 GJ, while the expansion
Directory of Open Access Journals (Sweden)
Paulo T.V. Farinatti
1999-12-01
Full Text Available Sabe-se pouco sobre os efeitos do envelhecimento na recuperação pós-esforço (RP. O estudo observou a RP em 15 idosos (GI, idade = 61 ± 1 anos e 15 jovens (GJ, idade = 22 ± 2 anos após atividades de três intensidades (IE em cicloergômetro. Realizaram-se testes máximos, com incremento de 30W/min para GJ e de 25W/min após detecção de steady-state para GI. Posteriormente, os grupos pedalaram a 40% e 75% da carga máxima, respectivamente, 25 e 15 minutos. Foram acompanhados VO2, VCO2, V E e FC nos primeiros 15 minutos da RP nas três IE. O tratamento dos resultados compreendeu: a teste de ajustamento das curvas experimentais a equações com uma ou duas exponenciais; b cálculo do valor dos componentes para a equação mais ajustada; c análise das constantes extraídas. Os desvios de ajustamento foram inferiores para uma curva de duas exponenciais, definida por integral de tempo na forma A/a +B/b. A/a designa a componente rápida da recuperação e B/b a lenta. Quando comparados os grupos, GI mostrou constantes maiores que GJ, evidenciando recuperação mais lenta nas duas fases. Subdividindo os componentes, em GI e GJ as constantes de velocidade de recuperação rápida (1/a para VO2 e VCO2 foram semelhantes nas três IE, enquanto para a constante lenta (1/b, os valores para GI indicaram maior dependência em relação à carga. A recuperação da FC revelou-se extremamente dependente da IE para GJ. Para GI isso foi menos evidente, talvez por menor possibilidade de elevação da FC. A V E em GJ comportou-se de forma similar ao VO2 e VCO2. Porém, para GI as constantes de tempo foram mais lentas, mais associadas à IE que os demais parâmetros. Conclui-se: a pode existir uma constante comum para a chamada 'fase alática' da curva de recuperação do VO2 e do VCO2, independentemente da IE e da idade; b as diferenças entre GJ e GI podem dever-se às menores potência aeróbia máxima, termorregulação e eficácia do tampão respirat
Suárez Mascareño, A.; González Hernández, J. I.; Rebolo, R.; Velasco, S.; Toledo-Padrón, B.; Affer, L.; Perger, M.; Micela, G.; Ribas, I.; Maldonado, J.; Leto, G.; Zanmar Sanchez, R.; Scandariato, G.; Damasso, M.; Sozzetti, A.; Esposito, M.; Covino, E.; Maggio, A.; Lanza, A. F.; Desidera, S.; Rosich, A.; Bignamini, A.; Claudi, R.; Benatti, S.; Borsa, F.; Pedani, M.; Molinari, E.; Morales, J. C.; Herrero, E.; Lafarga, M.
2017-09-01
We report the discovery of a super-Earth orbiting at the inner edge of the habitable zone of the star GJ 625 based on the analysis of the radial-velocity (RV) time series from the HARPS-N spectrograph, consisting of 151 HARPS-N measurements taken over 3.5 yr. GJ 625 b is a planet with a minimum mass Msini of 2.82 ± 0.51 M⊕ with an orbital period of 14.628 ± 0.013 days at a distance of 0.078 AU from its parent star. The host star is the quiet M2 V star GJ 625, located at 6.5 pc from the Sun. We find the presence of a second radial-velocity signal in the range 74-85 days that we relate to stellar rotation after analysing the time series of Ca II H&K and Hα spectroscopic indicators, the variations of the FWHM of the CCF, and the APT2 photometric light curves. We find no evidence linking the short-period radial-velocity signal to any activity proxy. Based on observations made with the Italian Telescopio Nazionale Galileo (TNG), operated on the island of La Palma by the INAF - Fundación Galileo Galilei at the Roche de Los Muchachos Observatory of the Instituto de Astrofísica de Canarias (IAC); photometric observations made with the robotic telescope APT2 (within the EXORAP programme) located at Serra La Nave on Mt. Etna; and lucky imaging observations made with the Telescopio Carlos Sánchez operated on the island of Tenerife by the Instituto de Astrofísica de Canarias in the Spanish Observatorio del Teide.Tables A.1-A.5 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/605/A92
2009-09-15
basketball (24 percent), weightlifting (19 percent), PT (18 percent), and football (14 percent). Injury Prevention Report No. 12-HF-0C7F-10, 1 Jan... INJURY PREVENTION REPORT NO. 12-HF-0C7F-10 U.S. ARMY DEPLOYMENT INJURY SURVEILLANCE SUMMARY CALENDAR YEAR 2008 1 JANUARY 2008–31...2008 – 31 December 2008 4. TITLE AND SUBTITLE U.S. Army Deployment Injury Surveillance Summary 2008 5a. CONTRACT NUMBER n/a 5b. GRANT NUMBER
g-factors in deformed nuclei: Annual report, September 1, 1983-August 31, 1984
International Nuclear Information System (INIS)
Krane, K.S.
1984-01-01
This report describes work performed for the period September 1, 1983 to August 31, 1984 under the contract DE-AT06-83ER40109, /open quotes/g-Factors in Deformed Nuclei./close quotes/ The literature survey has been completed and the first stage of the raw data analysis has been accomplished. A preliminary data summary prepared for publication is attached
Czech Academy of Sciences Publication Activity Database
Sommer, Vítězslav
2016-01-01
Roč. 1, č. 2 (2016), s. 138-157 ISSN 2521-0947 R&D Projects: GA ČR GJ15-19437Y Institutional support: RVO:68378114 Keywords : Czechoslovakia * Communist Party * social ism Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) http://serendipities.uni-graz.at/index.php/serendipities/article/view/2/pdf
Directory of Open Access Journals (Sweden)
Ruisong Li
Full Text Available Human milk contains a wide variety of nutrients that contribute to the fulfillment of its functions, which include the regulation of newborn development. However, few studies have investigated the concentrations of S100B protein, brain-derived neurotrophic factor (BDNF, and glial cell line-derived neurotrophic factor (GDNF in human milk. The associations of the concentrations of S100B protein, BDNF, and GDNF with maternal factors are not well explored.To investigate the concentrations of S100B protein, BDNF, and GDNF in human milk and characterize the maternal factors associated with their levels in human milk, human milk samples were collected at days 3, 10, 30, and 90 after parturition. Levels of S100B protein, BDNF, and GDNF, and their mRNAs in the samples were detected. Then, these concentrations were compared with lactation and other maternal factors. S100B protein levels in human milk samples collected at 3, 10, 30, and 90 d after parturition were 1249.79±398.10, 1345.05±539.16, 1481.83±573.30, and 1414.39±621.31 ng/L, respectively. On the other hand, the BDNF concentrations in human milk samples were 10.99±4.55, 13.01±5.88, 13.35±6.43, and 2.83±5.47 µg/L, while those of GDNF were 10.90±1.65, 11.38±1., 11.29±3.10, and 11.40±2.21 g/L for the same time periods. Maternal post-pregnancy body mass index was positively associated with S100B levels in human milk (r = 0.335, P = 0.030<0.05. In addition, there was a significant correlation between the levels of S100B protein and BDNF (z = 2.09, P = 0.037<0.05. Delivery modes were negatively associated with the concentration of GDNF in human milk.S100B protein, BDNF, and GDNF are present in all samples of human milk, and they may be responsible for the long term effects of breast feeding.
Investigation of the reactions 31P(n, γ)32P and 32S(n, γ)33S
Middelkoop, G. van; Spilling, P.
1965-01-01
The γ radiation following capture of thermal neutrons in 31P and 32S was investigated with scintillation-spectrometer techniques. Measurements of single and coincidence spectra and of γ-γ angular correlations yield the following spins in 32P: J(0.52) = 0, J(1.32) = (2), J(4.04) = 1, J(4.88) = 1,
Directory of Open Access Journals (Sweden)
Maciej Tokarski
2011-12-01
Full Text Available Local self-governments are reliable business partners. Such belief, confirmed by long-term experience, results in eager collaboration between financial institutions and these entities. Contrary to its name, local self-governments do not constitute the main beneficiaries of the self-government’s factoring. The enterprises which perform investments commissioned by a local commune, district or province are the principal recipients. Such firms may utilise it independently if they have signed contracts with the proper authority and conduct sale with deferred payment, or they may be forced to utilise factoring when they submit their bids in self-government’s tenders within which a refinance guarantee is required. The main aim of the article is to present the mechanism and features of the self-government’s factoring, as well as the benefits which the entities involved enjoy.
Psychosocial work factors and sickness absence in 31 countries in Europe.
Niedhammer, Isabelle; Chastang, Jean-François; Sultan-Taïeb, Hélène; Vermeylen, Greet; Parent-Thirion, Agnès
2013-08-01
The studies on the associations between psychosocial work factors and sickness absence have rarely included a large number of factors and European data. The objective was to examine the associations between a large set of psychosocial work factors following well-known and emergent concepts and sickness absence in Europe. The study population consisted of 14,881 male and 14,799 female workers in 31 countries from the 2005 European Working Conditions Survey. Psychosocial work factors included the following: decision latitude, psychological demands, social support, physical violence, sexual harassment, discrimination, bullying, long working hours, shift and night work, job insecurity, job promotion and work-life imbalance. Covariates were as follows: age, occupation, economic activity, employee/self-employed status and physical, chemical, biological and biomechanical exposures. Statistical analysis was performed using multilevel negative binomial hurdle models to study the occurrence and duration of sickness absence. In the models, including all psychosocial work factors together and adjustment for covariates, high psychological demands, discrimination, bullying, low-job promotion and work-life imbalance for both genders and physical violence for women were observed as risk factors of the occurrence of sickness absence. Bullying and shift work increased the duration of absence among women. Bullying had the strongest association with sickness absence. Various psychosocial work factors were found to be associated with sickness absence. A less conservative analysis exploring each factor separately provided a still higher number of risk factors. Preventive measures should take psychosocial work environment more comprehensively into account to reduce sickness absence and improve health at work at European level.
31 CFR 546.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... SANCTIONS REGULATIONS Interpretations § 546.409 Credit extended and cards issued by U.S. financial..., charge cards, debit cards, or other credit facilities issued by a U.S. financial institution to a person...
31 CFR 548.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... SANCTIONS REGULATIONS Interpretations § 548.409 Credit extended and cards issued by U.S. financial..., charge cards, debit cards, or other credit facilities issued by a U.S. financial institution to a person...
31 CFR 588.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... BALKANS STABILIZATION REGULATIONS Interpretations § 588.409 Credit extended and cards issued by U.S... not limited to, charge cards, debit cards, or other credit facilities issued by a U.S. financial...
31 CFR 542.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... SANCTIONS REGULATIONS Interpretations § 542.409 Credit extended and cards issued by U.S. financial..., charge cards, debit cards, or other credit facilities issued by a U.S. financial institution to a person...
KEPLER FLARES. II. THE TEMPORAL MORPHOLOGY OF WHITE-LIGHT FLARES ON GJ 1243
Energy Technology Data Exchange (ETDEWEB)
Davenport, James R. A.; Hawley, Suzanne L.; Johnson, Emily C.; Peraza, Jesus; Jansen, Tiffany C.; Larsen, Daniel M. [Department of Astronomy, University of Washington, P.O. Box 351580, Seattle, WA 98195 (United States); Hebb, Leslie [Department of Physics, Hobart and William Smith Colleges, 300 Pulteney Street, Geneva, NY 14456 (United States); Wisniewski, John P.; Malatesta, Michael; Keil, Marcus; Silverberg, Steven M.; Scheffler, Matthew S.; Berdis, Jodi R. [HL Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W Brooks Street, Norman, OK 73019 (United States); Kowalski, Adam F. [NASA Goddard Space Flight Center, Code 671, Greenbelt, MD 20771 (United States); Hilton, Eric J., E-mail: jrad@astro.washington.edu [Universe Sandbox, 911 E. Pike Street #333, Seattle, WA 98122 (United States)
2014-12-20
We present the largest sample of flares ever compiled for a single M dwarf, the active M4 star GJ 1243. Over 6100 individual flare events, with energies ranging from 10{sup 29} to 10{sup 33} erg, are found in 11 months of 1 minute cadence data from Kepler. This sample is unique for its completeness and dynamic range. We have developed automated tools for finding flares in short-cadence Kepler light curves, and performed extensive validation and classification of the sample by eye. From this pristine sample of flares we generate a median flare template. This template shows that two exponential cooling phases are present during the white-light flare decay, providing fundamental constraints for models of flare physics. The template is also used as a basis function to decompose complex multi-peaked flares, allowing us to study the energy distribution of these events. Only a small number of flare events are not well fit by our template. We find that complex, multi-peaked flares occur in over 80% of flares with a duration of 50 minutes or greater. The underlying distribution of flare durations for events 10 minutes and longer appears to follow a broken power law. Our results support the idea that sympathetic flaring may be responsible for some complex flare events.
KEPLER FLARES. II. THE TEMPORAL MORPHOLOGY OF WHITE-LIGHT FLARES ON GJ 1243
International Nuclear Information System (INIS)
Davenport, James R. A.; Hawley, Suzanne L.; Johnson, Emily C.; Peraza, Jesus; Jansen, Tiffany C.; Larsen, Daniel M.; Hebb, Leslie; Wisniewski, John P.; Malatesta, Michael; Keil, Marcus; Silverberg, Steven M.; Scheffler, Matthew S.; Berdis, Jodi R.; Kowalski, Adam F.; Hilton, Eric J.
2014-01-01
We present the largest sample of flares ever compiled for a single M dwarf, the active M4 star GJ 1243. Over 6100 individual flare events, with energies ranging from 10 29 to 10 33 erg, are found in 11 months of 1 minute cadence data from Kepler. This sample is unique for its completeness and dynamic range. We have developed automated tools for finding flares in short-cadence Kepler light curves, and performed extensive validation and classification of the sample by eye. From this pristine sample of flares we generate a median flare template. This template shows that two exponential cooling phases are present during the white-light flare decay, providing fundamental constraints for models of flare physics. The template is also used as a basis function to decompose complex multi-peaked flares, allowing us to study the energy distribution of these events. Only a small number of flare events are not well fit by our template. We find that complex, multi-peaked flares occur in over 80% of flares with a duration of 50 minutes or greater. The underlying distribution of flare durations for events 10 minutes and longer appears to follow a broken power law. Our results support the idea that sympathetic flaring may be responsible for some complex flare events
31 CFR 541.408 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... ZIMBABWE SANCTIONS REGULATIONS Interpretations § 541.408 Credit extended and cards issued by U.S. financial..., charge cards, debit cards, or other credit facilities issued by a U.S. financial institution to a person...
31 CFR 543.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U...'IVOIRE SANCTIONS REGULATIONS Interpretations § 543.409 Credit extended and cards issued by U.S. financial..., charge cards, debit cards, or other credit facilities issued by a U.S. financial institution to a person...
31S(p,γ)32Cl reaction in explosive hydrogen burning
International Nuclear Information System (INIS)
Lefebvre, A.; Vouzoukas, S.; Aguer, P.; Bogaert, G.; Coc, A.; Denker, A.; De Oliveira, F.; Fortier, S.; Goerres, J.; Kiener, J.; Maison, J.M.; Porquet, M.G.; Rosier, L.; Tatischeff, V.; Thibaud, J.P.; Wiescher, M.
1997-01-01
In the present work we attempted to determine excitation energies and widths of proton unbound states in 32 Cl. These states may contribute as resonances to the 31 S(p,γ) reaction and will determine the reaction rate. Results were used to evaluate the reaction flow in the Si to Ar region obtained by nova outbursts in the case of an ONeMg white dwarf of 1.35 M odot . (orig.)
Directory of Open Access Journals (Sweden)
Marcus J. Calkins
2012-10-01
Full Text Available In neuronal systems, the health and activity of mitochondria and synapses are tightly coupled. For this reason, it has been postulated that mitochondrial abnormalities may, at least in part, drive neurodegeneration in conditions such as Alzheimer’s disease (AD. Mounting evidence from multiple Alzheimer’s disease cell and mouse models and postmortem brains suggest that loss of mitochondrial integrity may be a key factor that mediates synaptic loss. Therefore, the prevention or rescue of mitochondrial dysfunction may help delay or altogether prevent AD-associated neurodegeneration. Since mitochondrial health is heavily dependent on antioxidant defenses, researchers have begun to explore the use of mitochondria-targeted antioxidants as therapeutic tools to prevent neurodegenerative diseases. This review will highlight advances made using a model mitochondria-targeted antioxidant peptide, SS31, as a potential treatment for AD.
Two stage S-N curve in corrosion fatigue of extruded magnesium alloy AZ31
Directory of Open Access Journals (Sweden)
Yoshiharu Mutoh
2009-11-01
Full Text Available Tension-compression fatigue tests of extruded AZ31 magnesium alloys were carried out under corrosive environments:(a high humidity environment (80 %RH and (b 5 wt. %NaCl environment. It was found that the reduction rate of fatiguestrength due to corrosive environment was 0.12 under a high humidity and 0.53 under a NaCl environment. It was alsoobserved that under corrosive environments, the S-N curve was not a single curve but a two-stage curve. Above the fatiguelimit under low humidity, the crack nucleation mechanism was due to a localized slip band formation mechanism. Below thefatigue limit under low humidity, the reduction in fatigue strength was attributed to the corrosion pit formation and growth to the critical size for fatigue crack nucleation under the combined effect of cyclic load and the corrosive environment. The critical size was attained when the stress intensity factor range reached the threshold value for crack growth.
Analysis of a deletion in the nephronophthisis 4 gene in different dog breeds
Czech Academy of Sciences Publication Activity Database
Palánová, Anna; Schröffelová, D.; Přibáňová, M.; Dvořáková, Věra; Stratil, Antonín
2014-01-01
Roč. 17, č. 1 (2014), s. 76-78 ISSN 1463-5216 Institutional support: RVO:67985904 Keywords : blindness * cone * Dachshund Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.062, year: 2014
Czech Academy of Sciences Publication Activity Database
Violante-González, J.; Mendoza-Franco, Edgar F.; Rojas-Herrera, A.; Guerrero, S.G.
2010-01-01
Roč. 107, č. 1 (2010), 59-66 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : TRES-PALOS LAGOON * HELMINTH COMMUNITIES * PACIFIC COAST * BALTIC SEA * FISHES * SIMILARITY * COLONIZATION * TELEOSTEI * BRAZIL * GILLS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010
Cryptosporidium from tortoises: Genetic characterisation, phylogeny and zoonotic implications
Czech Academy of Sciences Publication Activity Database
Traversa, D.; Iorio, R.; Otranto, D.; Modrý, David; Šlapeta, J.
2008-01-01
Roč. 22, č. 2 (2008), s. 122-128 ISSN 0890-8508 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium * tortoises * COWP * Testudo * epidemiology * 18S SSU rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.196, year: 2008
Dirofilaria repens microfilariae in Aedes vexans mosquitoes in Slovakia
Czech Academy of Sciences Publication Activity Database
Bocková, E.; Rudolf, Ivo; Kočišová, A.; Betášová, Lenka; Venclíková, Kristýna; Mendel, Jan; Hubálek, Zdeněk
2013-01-01
Roč. 112, č. 10 (2013), s. 3465-3470 ISSN 0932-0113 Institutional support: RVO:68081766 Keywords : Dirofilaria * mosquitoes * Aedes vexans Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.327, year: 2013
Effect of increased urea levels on mouse preimplantation embryos develop in vivo and in vitro
Czech Academy of Sciences Publication Activity Database
Bystriansky, J.; Burkuš, J.; Juhás, Štefan; Fabian, D.; Koppel, J.
2012-01-01
Roč. 56, č. 2 (2012), s. 211-216 ISSN 0042-4870 Institutional support: RVO:67985904 Keywords : mouse * preimplantation embryo * urea Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.377, year: 2012
Regulation of mitogen-activated protein kinase 3/1 activity during meiosis resumption in mammals
Czech Academy of Sciences Publication Activity Database
Procházka, Radek; Blaha, Milan
2015-01-01
Roč. 61, č. 6 (2015), s. 495-502 ISSN 0916-8818 R&D Projects: GA MZe(CZ) QJ1510138 Institutional support: RVO:67985904 Keywords : cumulus oocyte complexes * meiosis resumption * mitogen-activated protein kinase 3/1 (MAPK3/1) Subject RIV: GI - Animal Husbandry ; Breeding Impact factor: 1.453, year: 2015
Gilbert, Karoline M.; Tollerud, Erik; Beaton, Rachael L.; Guhathakurta, Puragra; Bullock, James S.; Chiba, Masashi; Kalirai, Jason S.; Kirby, Evan N.; Majewski, Steven R.; Tanaka, Mikito
2018-01-01
We present the velocity dispersion of red giant branch stars in M31’s halo, derived by modeling the line-of-sight velocity distribution of over 5000 stars in 50 fields spread throughout M31’s stellar halo. The data set was obtained as part of the Spectroscopic and Photometric Landscape of Andromeda’s Stellar Halo (SPLASH) Survey, and covers projected radii of 9 to 175 kpc from M31’s center. All major structural components along the line of sight in both the Milky Way (MW) and M31 are incorporated in a Gaussian Mixture Model, including all previously identified M31 tidal debris features in the observed fields. The probability that an individual star is a constituent of M31 or the MW, based on a set of empirical photometric and spectroscopic diagnostics, is included as a prior probability in the mixture model. The velocity dispersion of stars in M31’s halo is found to decrease only mildly with projected radius, from 108 km s‑1 in the innermost radial bin (8.2 to 14.1 kpc) to ∼80 to 90 km s‑1 at projected radii of ∼40–130 kpc, and can be parameterized with a power law of slope ‑0.12 ± 0.05. The quoted uncertainty on the power-law slope reflects only the precision of the method, although other sources of uncertainty we consider contribute negligibly to the overall error budget. The data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W.M. Keck Foundation.
Towards Precision Measurement of the 21S0-31D2 Two-Photon Transition in Atomic Helium
Huang, Yi-Jan; Guan, Yu-Chan; Suen, Te-Hwei; Wang, Li-Bang; Shy, Jow-Tsong
2017-04-01
We intend to accurately measure the frequency for 2S-3D two-photon transition and to deduce the 2S ionization energy to an accuracy below 100 kHz from the theoretical calculation of the 3D state. In this talk, we present a precision measurement of the 21S0 -31D2 two-photon transition in atomic helium at 1009 nm. A master oscillator power amplifier (MOPA) is seeded by an external cavity diode laser (ECDL) is constructed to generate more than 700 mW laser power with TEM00 beam profile at 1009 nm. To observe the two-photon transition, a helium cell is placed inside a power enhancement optical cavity and the helium atoms at 21S metastable level are prepared by a pulsed RF discharge and monitor the 668 nm 31D2 to 21P1 fluorescence after RF discharge is turned off . The absolute frequency metrology of the ECDL is carried out by an Er-fiber optical frequency comb (OFC). The two-photon spectrum is obtained by tuning the repetition frequency of the OFC. The 21S0-31D2 frequency is determined to be 594414291.967 (80) MHz in He-4. More results will be presented at the annual meeting.
Czech Academy of Sciences Publication Activity Database
Janatová, M.; Albrechtová, K.; Petrželková, Klára Judita; Dolejská, M.; Papoušek, I.; Masaříková, M.; Čížek, A.; Todd, A.; Shutt, K.; Kalousová, B.; Profousová-Pšenková, I.; Modrý, David; Literák, I.
2014-01-01
Roč. 171, 3-4 (2014), s. 422-431 ISSN 0378-1135 Institutional support: RVO:60077344 Keywords : ESBL * PMQR * Enterobacteriaceae * Resistance * Gorilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.511, year: 2014
Czech Academy of Sciences Publication Activity Database
Gallusová, M.; Jirsová, D.; Mihalca, A. D.; Gherman, C.M.; D’Amico, G.; Qablan, M. A.; Modrý, David
2016-01-01
Roč. 102, č. 3 (2016), s. 377-380 ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : Lynx * domestic cats * molecular characterization Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.326, year: 2016
Cattle tick vaccine researchers join forces in CATVAC
Czech Academy of Sciences Publication Activity Database
Schetters, T.P.; Bishop, R.; Crampton, M.; Kopáček, Petr; Lew-Tabor, A.; Maritz-Olivier, C.; Miller, R.; Mosqueda, J.; Patarroyo, J.; Rodriguez-Valle, M.; Scoles, G.A.; de la Fuente, J.
2016-01-01
Roč. 9, FEB 24 (2016), s. 105 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : CATVAC * vaccine * cattle * tick * Rhipicephalus microplus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.080, year: 2016
Czech Academy of Sciences Publication Activity Database
Wagnerová, Pavla; Sak, Bohumil; McEvoy, J.; Rost, M.; Perec Matysiak, A.; Ježková, J.; Kváč, Martin
2015-01-01
Roč. 114, č. 4 (2015), s. 1619-1624 ISSN 0932-0113 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : horse * Cryptosporidium * SSU * gp60 * MLST Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.027, year: 2015
Cryptosporidium erinacei and C. parvum in a group of overwintering hedgehogs
Czech Academy of Sciences Publication Activity Database
Hofmannová, L.; Hauptman, K.; Huclová, K.; Květoňová, Dana; Sak, Bohumil; Kváč, Martin
2016-01-01
Roč. 56, č. 1 (2016), s. 15-20 ISSN 0932-4739 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidiosis * Erinaceus europaeus * European hedgehog Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.581, year: 2016
Novel Cryptosporidium bat genotypes III and IV in bats/nfrom the USA and Czech Republic
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Hořická, A.; Sak, Bohumil; Prediger, Jitka; Salát, J.; Širmarová, J.; Bartonička, T.; Clark, M.; Chelladurai, J.R.J.J.; Gillam, E.; McEvoy, J.
2015-01-01
Roč. 114, č. 10 (2015), s. 3917-3921 ISSN 0932-0113 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium * Bats * SSU * Actin * PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.027, year: 2015
Czech Academy of Sciences Publication Activity Database
Mitková, B.; Hrazdilová, K.; Novotna, M.; Juránková, J.; Hofmannová, L.; Forejtek, P.; Modrý, David
2017-01-01
Roč. 62, č. 3 (2017), s. 138-146 ISSN 0375-8427 Institutional support: RVO:60077344 Keywords : tick-borne diseases * apicomplexan parasites * PCR detection * 18S rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 0.489, year: 2016
Los profesionales de secundaria, como factores de riesgo en el síndrome de Burnout
Directory of Open Access Journals (Sweden)
Giselle León-León
2011-06-01
Full Text Available Recibido 21 de julio de 2010 • Aceptado 31 de agosto de 2010 • Corregido 03 de octubre de 2010 Este artículo aborda el síndrome de Bournout, entendido como un trastorno de la adaptación ante el estrés crónico laboral que logra desencadenar síntomas físicos y psicológicos, los cuales dañan significativamente la ejecución profesional de los individuos que prestan servicios, en este particular, el trabajo de los docentes de secundaria, los cuales se describen como vulnerables por atender a adolescentes, quienes requieren mayor comunicación, atención y guía por las característica propias de esa etapa. Además se describen algunos factores que pueden incidir en el docente, desde una perspectiva individual como por ejemplo estrés, rol, edad, estado civil, entre otros. Asímismo factores laborales tales como baja implicación, sobre carga, burocracia, ambiente, consecuencias sobre el individuo y sobre la institución y medidas para prevenirlo.
Tick-borne encephalitis virus in horses, Austria, 2011
Czech Academy of Sciences Publication Activity Database
Rushton, J. O.; Lecollinet, S.; Hubálek, Zdeněk; Svobodová, Petra; Lussy, H.; Nowotny, N.
2013-01-01
Roč. 19, č. 4 (2013), s. 635-637 ISSN 1080-6040 Institutional support: RVO:68081766 Keywords : tick-borne encephalitis virus (TBEV) * strains Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 7.327, year: 2013
Czech Academy of Sciences Publication Activity Database
Šebesta, O.; Gelbič, Ivan
2016-01-01
Roč. 71, č. 11 (2016), s. 1292-1297 ISSN 0006-3088 Institutional support: RVO:60077344 Keywords : Aedes vexans * Aedes sticticus * autumn floods Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.759, year: 2016
Contribution to canine babesiosis in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Konvalinová, J.; Rudolf, Ivo; Šikutová, Silvie; Hubálek, Zdeněk; Svobodová, V.; Svoboda, M.
2012-01-01
Roč. 81, č. 2 (2012), s. 91-95 ISSN 0001-7213 Institutional support: RVO:68081766 Keywords : dogs * Babesia canis * antibodies * Dermacentor reticulatus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.393, year: 2012
Usutu Virus in Blackbirds (Turdus merula), Czech Republic, 2011-2012
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk; Rudolf, Ivo; Čapek, Miroslav; Bakonyi, T.; Betášová, Lenka; Nowotny, N.
2014-01-01
Roč. 61, č. 3 (2014), s. 273-276 ISSN 1865-1674 Institutional support: RVO:68081766 Keywords : Usutu virus * blackbird * Turdus merula * Czechland Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 2.944, year: 2014
Czech Academy of Sciences Publication Activity Database
Hofmannová, L.; Romeo, C.; Štohanzlová, L.; Jirsová, D.; Mazzamuto, M.V.; Wauters, L.A.; Ferrari, N.; Modrý, David
2016-01-01
Roč. 56, OCT (2016), s. 1-14 ISSN 0932-4739 Institutional support: RVO:60077344 Keywords : Competition * Eimeria * Sciurus carolinensis * Sciurus vulgaris * Squirrels Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.581, year: 2016
2010-07-01
... transformation of an extension of protection to the United States into a U.S. application. 7.31 Section 7.31... transformation of an extension of protection to the United States into a U.S. application. If the International... transformation within three months of the date of cancellation of the international registration and include: (1...
The construction of factorized S-matrices
International Nuclear Information System (INIS)
Chudnovsky, D.V.
1981-01-01
We study the relationships between factorized S-matrices given as representations of the Zamolodchikov algebra and exactly solvable models constructed using the Baxter method. Several new examples of symmetric and non-symmetric factorized S-matrices are proposed. (orig.)
The closest M-dwarf quadruple system to the Sun
International Nuclear Information System (INIS)
Davison, Cassy L.; White, R. J.; Jao, W.-C.; Henry, T. J.; Quinn, S. N.; Cantrell, J. R.; Winters, J. G.; Bailey, J. I. III; Riedel, A. R.; Subasavage, J. P.; Crockett, C. J.
2014-01-01
We report new infrared radial velocity measurements obtained with CSHELL at NASA's Infrared Telescope Facility that reveal the M3.5 dwarf GJ 867B to be a single-lined spectroscopic binary with a period of 1.795 ± 0.017 days. Its velocity semi-amplitude of 21.4 ± 0.5 km s –1 corresponds to a minimum mass of 61 ± 7 M JUP ; the new companion, which we call GJ 867D, could be a brown dwarf. Stable astrometric measurements of GJ 867BD obtained with CTIO's 0.9 m telescope over the last decade exclude the presence of any massive planetary companions (7-18 M JUP ) with longer orbital periods (2-10 yr) for the majority of orientations. These complementary observations are also used to determine the trigonometric distance and proper motion of GJ 867BD; the measurements are consistent with the HIPPARCOS measured values of the M2 dwarf GJ 867AC, which is itself a 4.1 day double-lined spectroscopic binary at a projected separation of 24.''5 (216 AU) from GJ 867BD. These new measurements strengthen the case that GJ 867AC and GJ 867BD are physically associated, making the GJ 867 system one of only four quadruple systems within 10 pc of the Sun (d = 8.82 ± 0.08 pc) and the only among these with all M-dwarf (or cooler) components.
DEFF Research Database (Denmark)
Larsen, Anna Warberg; Astrup, Thomas
2011-01-01
variations between emission factors for different incinerators, but the background for these variations has not been thoroughly examined. One important reason may be variations in collection of recyclable materials as source separation alters the composition of the residual waste incinerated. The objective...... routed to incineration. Emission factors ranged from 27 to 40kg CO2/GJ. The results appeared most sensitive towards variations in waste composition and water content. Recycling rates and lower heating values could not be used as simple indicators of the resulting emission factors for residual household...... different studies and when using the values for environmental assessment purposes....
Effect of salicylic acid on early life stages of common carp (Cyprinus carpio)
Czech Academy of Sciences Publication Activity Database
Živná, D.; Sehonová, P.; Plhalová, L.; Maršálek, P.; Blahová, J.; Prokeš, Miroslav; Divišová, L.; Stancová, V.; Dobšíková, R.; Tichý, F.; Široká, Z.; Svobodová, Z.
2015-01-01
Roč. 40, č. 1 (2015), s. 319-325 ISSN 1382-6689 Institutional support: RVO:68081766 Keywords : Pharmaceutical residues * NSAIDs * Oxidative stress * Lipid peroxidation Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.187, year: 2015
Detection of shrew-borne hantavirus in Eurasian pygmy shrew (Sorex minutus) in Central Europe
Czech Academy of Sciences Publication Activity Database
Radosa, L.; Schlegel, M.; Gebauer, P.; Ansorge, H.; Heroldová, Marta; Jánová, Eva; Stanko, M.; Mošanský, L.; Fričová, J.; Pejčoch, M.; Suchomel, J.; Purchart, L.; Groschup, M. H.; Krüger, D. H.; Ulrich, R. G.; Klempa, B.
2013-01-01
Roč. 19, October (2013), s. 403-410 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Hantavirus * shrew Sorex minutus * Asikkala virus * Cental Europe Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.264, year: 2013
Czech Academy of Sciences Publication Activity Database
Moravec, František
2010-01-01
Roč. 77, č. 1 (2010), s. 23-27 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdias * Lacerta * Slovakia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.056, year: 2010
Phasmid ultrastructure of an ascaridoid nematode Hysterothylacium auctum
Czech Academy of Sciences Publication Activity Database
Fagerholm, H.-P.; Bruňanská, Magdaléna; Roepstorff, A.; Eriksen, L.
2004-01-01
Roč. 90, č. 3 (2004), s. 499-506 ISSN 0022-3395 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Ascaridoidea * phasmid Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.439, year: 2004
Brucellosis of the common vole (Microtus arvalis)
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk; Scholz, H.; Sedláček, I.; Melzer, F.; Sanogo, Yibayiri Osée; Nesvadbová, Jiřina
2007-01-01
Roč. 7, č. 4 (2007), s. 679-688 ISSN 1530-3667 Institutional research plan: CEZ:AV0Z60930519 Keywords : common vole * brucellosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.919, year: 2007
Czech Academy of Sciences Publication Activity Database
Rudolf, Ivo; Venclíková, Kristýna; Blažejová, Hana; Betášová, Lenka; Mendel, Jan; Hubálek, Zdeněk; Parola, P.
2016-01-01
Roč. 7, č. 6 (2016), s. 1222-1224 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Rickettsia spp. * Dermacentor spp. * DEBONEL * SENLAT Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 3.230, year: 2016
Czech Academy of Sciences Publication Activity Database
Lawrence, A.L.; Hii, S.-F.; Jirsová, D.; Panáková, L.; Ionică, A.M.; Gilchrist, K.; Modrý, David; Mihalca, A. D.; Webb, C.E.; Traub, R.J.; Šlapeta, J.
2015-01-01
Roč. 210, 3-4 (2015), s. 215-223 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Arthropod * Siphonaptera * Zoonosis * Bartonella * Taxonomy * cox1 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015
Czech Academy of Sciences Publication Activity Database
Ionică, A.M.; Matei, I.A.; Mircean, V.; Dumitrache, M.O.; D’Amico, G.; Győrke, A.; Pantchev, N.; Annoscia, G.; Albrechtová, K.; Otranto, D.; Modrý, David; Mihalca, A. D.
2015-01-01
Roč. 114, č. 3 (2015), s. 975-982 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : dogs * Dirofilaria * Acanthocheilonema * Romania * prevalence * distribution * diagnosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.027, year: 2015
Cryptosporidium parvum and Enterocytozoon bieneusi in American Mustangs and Chincoteague ponies
Czech Academy of Sciences Publication Activity Database
Wagnerová, Pavla; Sak, Bohumil; McEvoy, J.; Rost, M.; Sherwood, D.; Holcomb, K.; Kváč, Martin
2016-01-01
Roč. 162, MAR (2016), s. 24-27 ISSN 0014-4894 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : feral horses * Cryptosporidium * SSU * gp60 * Microsporidia * ITS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.724, year: 2016
Czech Academy of Sciences Publication Activity Database
Stenger, B.L.S.; Clark, M.E.; Kváč, Martin; Khan, E.; Giddings, C.W.; Prediger, Jitka; McEvoy, J.M.
2015-01-01
Roč. 36, 2015-Dec (2015), s. 287-293 ISSN 1567-1348 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium * Tree squirrels * Ground squirrels * Host specificity * Zoonotic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.591, year: 2015
Drosophila DH31 Neuropeptide and PDF Receptor Regulate Night-Onset Temperature Preference.
Goda, Tadahiro; Tang, Xin; Umezaki, Yujiro; Chu, Michelle L; Hamada, Fumika N
2016-11-16
Body temperature exhibits rhythmic fluctuations over a 24 h period (Refinetti and Menaker, 1992) and decreases during the night, which is associated with sleep initiation (Gilbert et al., 2004; Kräuchi, 2007a,b). However, the underlying mechanism of this temperature decrease is largely unknown. We have previously shown that Drosophila exhibit a daily temperature preference rhythm (TPR), in which their preferred temperatures increase during the daytime and then decrease at the transition from day to night (night-onset) (Kaneko et al., 2012). Because Drosophila are small ectotherms, their body temperature is very close to that of the ambient temperature (Stevenson, 1985), suggesting that their TPR generates their body temperature rhythm. Here, we demonstrate that the neuropeptide diuretic hormone 31 (DH31) and pigment-dispersing factor receptor (PDFR) contribute to regulate the preferred temperature decrease at night-onset. We show that PDFR and tethered-DH31 expression in dorsal neurons 2 (DN2s) restore the preferred temperature decrease at night-onset, suggesting that DH31 acts on PDFR in DN2s. Notably, we previously showed that the molecular clock in DN2s is important for TPR. Although PDF (another ligand of PDFR) is a critical factor for locomotor activity rhythms, Pdf mutants exhibit normal preferred temperature decreases at night-onset. This suggests that DH31-PDFR signaling specifically regulates a preferred temperature decrease at night-onset. Thus, we propose that night-onset TPR and locomotor activity rhythms are differentially controlled not only by clock neurons but also by neuropeptide signaling in the brain. Body temperature rhythm (BTR) is fundamental for the maintenance of functions essential for homeostasis, such as generating metabolic energy and sleep. One major unsolved question is how body temperature decreases dramatically during the night. Previously, we demonstrated that a BTR-like mechanism, referred to as temperature preference rhythm (TPR
Kvantitativní 31P NMR spektroskopie huminových kyselin
Czech Academy of Sciences Publication Activity Database
Novák, František; Hrabal, R.; Bartošová, I.; Kalčík, Jiří
2005-01-01
Roč. 99, - (2005), s. 236-245 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA206/02/1504 Institutional research plan: CEZ:AV0Z6066911 Keywords : 31P NMR spectroscopy * humic acids Subject RIV: EH - Ecology, Behaviour Impact factor: 0.445, year: 2005
Izolace humusových kyselin pro 31P NMR spektroskopii
Czech Academy of Sciences Publication Activity Database
Novák, František; Hrabal, R.; Kalousková, Nataša
2003-01-01
Roč. 97, - (2003), s. 621-622 ISSN 0009-2770 R&D Projects: GA ČR GA206/02/1504 Institutional research plan: CEZ:AV0Z6066911 Keywords : 31P NMR * humic acid * phosphorus transformation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.345, year: 2003
Czech Academy of Sciences Publication Activity Database
Charvátová, N.; Želinská, G.; Dobšíková, R.; Stancová, V.; Živná, D.; Plhalová, L.; Blahová, J.; Sehonová, P.; Maršálek, P.; Bartošková, M.; Prokeš, Miroslav; Piskořová, I.; Svobodová, Z.
2015-01-01
Roč. 36, Supplement 1 (2015), s. 79-87 ISSN 0172-780X Institutional support: RVO:68081766 Keywords : antibiotics * fish * morphometry * antioxidant enzymes * lipid peroxidation Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.946, year: 2015
Tick-Borne Encephalitis in Sheep, Romania
Czech Academy of Sciences Publication Activity Database
Salát, J.; Mihalca, A. D.; Mihaiu, M.; Modrý, D.; Růžek, Daniel
2017-01-01
Roč. 23, č. 12 (2017), s. 2065-2067 ISSN 1080-6040 Institutional support: RVO:60077344 Keywords : borrelia-burgdorferi * virus * tbev Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 8.222, year: 2016
First report of Rickettsia raoultii in field collected Dermacentor reticulatus ticks from Austria
Czech Academy of Sciences Publication Activity Database
Duscher, G. G.; Hodžić, A.; Weiler, M.; Vaux, A. G. C.; Rudolf, Ivo; Sixl, W.; Medlock, J. M.; Versteirt, V.; Hubálek, Zdeněk
2016-01-01
Roč. 7, č. 5 (2016), s. 720-722 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Rickettsia raoultii * Dermacentor reticulatus * TIBOLA * DEBONEL * Austria Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.230, year: 2016
Czech Academy of Sciences Publication Activity Database
Mapua, M. I.; Qablan, M. A.; Pomajbíková, K.; Petrželková, Klára Judita; Hůzová, Z.; Rádrová, J.; Votýpka, J.; Todd, A.; Jirků, M.; Leendertz, F. H.; Lukeš, J.; Neel, C.; Modrý, D.
2015-01-01
Roč. 142, č. 7 (2015), s. 890-900 ISSN 0031-1820 Institutional support: RVO:68081766 Keywords : Plasmodium spp. * African great apes * malaria * lowland gorilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.031, year: 2015
Seroprevalence of Neospora caninum in aborting dairy cattle in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Václavek, P.; Koudela, Břetislav; Modrý, David; Sedlák, K.
2003-01-01
Roč. 115, č. 3 (2003), s. 239-245 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z6022909 Keywords : Neospora caninum * abortion * cattle Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.583, year: 2003
Host-pathogen evolutionary signatures reveal dynamics and future invasions of vampire bat rabies
Czech Academy of Sciences Publication Activity Database
Streicker, D. G.; Winternitz, Jamie Caroline; Satterfield, D. A.; Condori-Condori, R. E.; Broos, A.; Tello, C.; Recuenco, S.; Velasco-Villa, A.; Altizer, S.; Valderrama, W.
2016-01-01
Roč. 113, č. 39 (2016), s. 10926-10931 ISSN 0027-8424 Institutional support: RVO:68081766 Keywords : Desmodus * zoonotic disease * forecasting * sex bias * spatial dynamics Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 9.661, year: 2016
Czech Academy of Sciences Publication Activity Database
D'Amico, G.; Dumitrache, M.O.; Široký, P.; Albrechtová, K.; Sloboda, M.; Domsa, C.; Sándor, A.D.; Balázsi, R.; Kanyari, P. W. N.; Modrý, David; Mihalca, A. D.
2015-01-01
Roč. 212, 3-4 (2015), s. 318-323 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Altitudinal distribution * Rhipicephalus sanguineus * Rhipicephalus pulchellus * Rhipicephalus armatus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015
MCNP4c JEFF-3.1 Based Libraries. Eccolib-Jeff-3.1 libraries; Les bibliotheques Eccolib-Jeff-3.1
Energy Technology Data Exchange (ETDEWEB)
Sublet, J.Ch
2006-07-01
Continuous-energy and multi-temperatures MCNP Ace types libraries, derived from the Joint European Fusion-Fission JEFF-3.1 evaluations, have been generated using the NJOY-99.111 processing code system. They include the continuous-energy neutron JEFF-3.1/General Purpose, JEFF-3.1/Activation-Dosimetry and thermal S({alpha},{beta}) JEFF-3.1/Thermal libraries and data tables. The processing steps and features are explained together with the Quality Assurance processes and records linked to the generation of such multipurpose libraries. (author)
Czech Academy of Sciences Publication Activity Database
Pafčo, B.; Benavides, J. A.; Pšenková-Profousová, I.; Modrý, D.; Červená, B.; Shutt, K. A.; Hasegawa, H.; Fuh, T.; Todd, A. F.; Petrželková, Klára Judita
2017-01-01
Roč. 116, č. 12 (2017), s. 3401-3410 ISSN 0932-0113 R&D Projects: GA ČR GA15-05180S Institutional support: RVO:68081766 Keywords : Western lowland gorilla * Parasite * Habituation * Human impact Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Parasitology Impact factor: 2.329, year: 2016
Czech Academy of Sciences Publication Activity Database
Hasegawa, H.; Kalousová, B.; McLennan, M. R.; Modrý, D.; Profousová-Pšenková, I.; Shutt-Phillips, K. A.; Todd, A.; Huffman, M. A.; Petrželková, Klára Judita
2016-01-01
Roč. 65, č. 5 (2016), s. 367-370 ISSN 1383-5769 R&D Projects: GA ČR GA15-05180S Institutional support: RVO:68081766 Keywords : Chimpanzee * Cox1 * Gorilla * Human * HVR-IV * Strongyloides * Transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.744, year: 2016
Czech Academy of Sciences Publication Activity Database
Laatamna, A.E.; Wagnerová, Pavla; Sak, Bohumil; Květoňová, Dana; Xiao, L.; Rost, M.; McEvoy, J.; Saadi, A.R.; Aissi, M.; Kváč, Martin
2015-01-01
Roč. 208, 3-4 (2015), s. 135-142 ISSN 0304-4017 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Horses * Donkeys * Cryptosporidium spp. * Encephalitozoon spp. * Enterocytozoon bieneusi * Molecular prevalence Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015
Czech Academy of Sciences Publication Activity Database
Srnec, Martin; Solomon, E. I.
2017-01-01
Roč. 139, č. 6 (2017), s. 2396-2407 ISSN 0002-7863 R&D Projects: GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : Chlorination * Chlorine compounds * Free radical reaction s Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 13.858, year: 2016
The effect of tramadol hydrochloride on early life stages of fish
Czech Academy of Sciences Publication Activity Database
Sehonová, P.; Plhalová, L.; Blahová, J.; Beránková, P.; Doubková, V.; Prokeš, Miroslav; Tichý, F.; Večerek, V.; Svobodová, Z.
2016-01-01
Roč. 44, June (2016), s. 151-157 ISSN 1382-6689 Institutional support: RVO:68081766 Keywords : Aquatic contamination * Cyprinus carpio * Danio rerio * Oxidative stress * Toxicity test Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.313, year: 2016
Czech Academy of Sciences Publication Activity Database
Hasegawa, H.; Kalousová, B.; McLennan, M. R.; Modrý, David; Profousová-Pšenková, I.; Shutt-Phillips, K. A.; Todd, A.; Huffman, M. A.; Petrželková, Klára Judita
2016-01-01
Roč. 65, č. 5 (2016), s. 367-370 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : chimpanzee * Gorilla * Human * Strongyloides * transmission * HVR-IV * cox1 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.744, year: 2016
First identification of Neospora caninum by PCR in aborted bovine foetuses in Romania
Czech Academy of Sciences Publication Activity Database
Suteu, O.; Titilincu, A.; Modrý, David; Mihalca, A. D.; Mircean, A.; Cozma, V.
2010-01-01
Roč. 106, č. 3 (2010), s. 719-722 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : DEFINITIVE HOSTS * DAIRY- CATTLE * transmission * ABORTIONS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010
Czech Academy of Sciences Publication Activity Database
Mapua, M. I.; Petrželková, Klára Judita; Burgunder, J.; Dadáková, E.; Brožová, K.; Hrazdilová, K.; Stewart, F. A.; Piel, A. K.; Vallo, Peter; Fuehrer, H.-P.; Hashimoto, C.; Modrý, D.; Qablan, M. A.
2016-01-01
Roč. 15, č. 423 (2016), s. 423 ISSN 1475-2875 Institutional support: RVO:68081766 Keywords : Cyt-b gene * Laverania * Malaria * Pan troglodytes schweinfurthii * Plasmodium spp Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.715, year: 2016
Autochthonous Hepatozoon infection in hunting dogs and foxes from the Czech Republic
Czech Academy of Sciences Publication Activity Database
Mitková, B.; Hrazdilová, K.; Steinbauer, V.; D'Amico, G.; Mihalca, A. D.; Modrý, David
2016-01-01
Roč. 115, č. 11 (2016), s. 4167-4171 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : Hepatozoon canis * dogs * red fox es * Czech Republic * autochthonous infection Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Czech Academy of Sciences Publication Activity Database
Gallusová, M.; Qablan, M.; D'Amico, G.; Oborník, Miroslav; Petrželková, Klára Judita; Mihalca, A. D.; Modrý, David
2014-01-01
Roč. 206, 3-4 (2014), s. 287-292 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : T. equi * Babesia cablli * Equine piroplasmoses * Danube Delta * Genetic diversity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.460, year: 2014
Czech Academy of Sciences Publication Activity Database
Gallusová, M.; Qablan, M. A.; D'Amico, G.; Oborník, M.; Petrželková, Klára Judita; Mihalca, A. D.; Modrý, D.
2014-01-01
Roč. 206, 3-4 (2014), s. 287-292 ISSN 0304-4017 Institutional support: RVO:68081766 Keywords : T. equi * Babesia caballi * Equine piroplasmoses * Danube Delta * Genetic diversity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.460, year: 2014
Molecular survey of arthropod-borne pathogens in sheep keds (Melophagus ovinus), Central Europe
Czech Academy of Sciences Publication Activity Database
Rudolf, Ivo; Betášová, Lenka; Bischof, V.; Venclíková, Kristýna; Blažejová, Hana; Mendel, Jan; Hubálek, Zdeněk; Kosoy, M.
2016-01-01
Roč. 115, č. 10 (2016), s. 3679-3682 ISSN 0932-0113 Institutional support: RVO:68081766 Keywords : Melophagus ovinus * Bartonella melophagi * Rickettsiae * Arboviruses * Borrelia burgdorferi * Babesia spp. Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Microsporidian xenomas in fish seen in wider perspective
Czech Academy of Sciences Publication Activity Database
Lom, Jiří; Dyková, Iva
2005-01-01
Roč. 52, 1/2 (2005), s. 69-81 ISSN 0015-5683 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish microsporidia * xenoma * life cycles Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005
Czech Academy of Sciences Publication Activity Database
Dossi, K.; Tsirkone, V.G.; Hayes, J.M.; Matoušek, Josef; Poučková, P.; Souček, J.; Zadinová, M.; Zographos, S.E.; Leonidas, D.D.
2009-01-01
Roč. 44, č. 11 (2009), s. 4496-4508 ISSN 0223-5234 Institutional research plan: CEZ:AV0Z50450515 Keywords : bovine seminal ribonuclease * antitumor agent Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.269, year: 2009
Czech Academy of Sciences Publication Activity Database
Frye, F. L.; Modrý, David; Široký, P.
2009-01-01
Roč. 235, č. 5 (2009), s. 511-512 ISSN 0003-1488 Institutional research plan: CEZ:AV0Z60220518 Keywords : european pond turtle * cutaneous horn Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.714, year: 2009
Czech Academy of Sciences Publication Activity Database
Fernández-Alvarez, A.; Modrý, David; Foronda, P.
2016-01-01
Roč. 115, č. 5 (2016), s. 1817-1825 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : Coccidia * Eimeria barbarae n. sp * Alectoris barbara * Canary Island Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Czech Academy of Sciences Publication Activity Database
Daniel, M.; Danielová, V.; Kříž, B.; Růžek, Daniel; Fialová, A.; Malý, M.; Materna, J.; Pejčoch, M.; Erhart, Jan
2016-01-01
Roč. 65, č. 2 (2016), s. 118-128 ISSN 1210-7913 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * tick-borne encephalitis virus * occurence * altitude * region * season Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.500, year: 2016
Czech Academy of Sciences Publication Activity Database
Klein, P.; Kleinová, T.; Volek, Z.; Šimůnek, Jiří
2008-01-01
Roč. 152, 1-2 (2008), s. 53-59 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z50450515 Keywords : calves * cryptosporidium parvum * intestinal absorption Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.039, year: 2008
Czech Academy of Sciences Publication Activity Database
Hůrková, L.; Halova, D.; Modrý, David
2005-01-01
Roč. 50, č. 12 (2005), s. 549-552 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z60220518 Keywords : cattle * iscom ELISA * bulk milk ELISA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.621, year: 2005
Czech Academy of Sciences Publication Activity Database
Mihalca, A. D.; Jirků, Miloslav; Malonza, P. K.; Modrý, David
2009-01-01
Roč. 74, č. 3 (2009), s. 219-223 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Isospora * Agama * Kenya * coccidium * Apicomplexa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009
Anaplasma phagocytophilum: deceptively simple or simply deceptive?
Czech Academy of Sciences Publication Activity Database
Severo, M. S.; Stephens, K. D.; Kotsyfakis, Michalis; Pedra, J. H. F.
2012-01-01
Roč. 7, č. 6 (2012), s. 719-731 ISSN 1746-0913 Institutional support: RVO:60077344 Keywords : obligate intracellular bacterium * rickettsial agents * ticks * vector-borne diseases Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.018, year: 2012
The effects of diclofenac on early life stages of common carp (Cyprinus carpio)
Czech Academy of Sciences Publication Activity Database
Štěpánová, S.; Prášková, E.; Chromcová, L.; Plhalová, L.; Prokeš, Miroslav; Blahová, J.; Svobodová, Z.
2013-01-01
Roč. 35, č. 3 (2013), s. 454-460 ISSN 1382-6689 Institutional support: RVO:68081766 Keywords : Fish * Embryo–larval toxicity test * Oxidative stress * LOEC * NOEC Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.862, year: 2013
Czech Academy of Sciences Publication Activity Database
Bruňanská, M.; Drobníková, P.; Oros, Mikuláš
2009-01-01
Roč. 105, č. 3 (2009), s. 647-654 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : vitellogenesis * Atractolytocestus huronensis * AMPHILINIDEA CESTODA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009
Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission
Czech Academy of Sciences Publication Activity Database
Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.
2017-01-01
Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.802, year: 2016
Czech Academy of Sciences Publication Activity Database
Literák, I.; Šmíd, B.; Dusbábek, František; Halouzka, R.; Novotný, L.
2005-01-01
Roč. 50, č. 6 (2005), s. 276-280 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z60220518 Keywords : papillomavirus * knemidokoptosis * diseases of birds Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.621, year: 2005
Directory of Open Access Journals (Sweden)
Ali Gargouri
2015-08-01
Full Text Available We have determined the nucleotide sequence of the mim3-1 mitochondrial ribosomal suppressor, acting on ochre mitochondrial mutations and one frameshift mutation in Saccharomyces cerevisiae. The 15s rRNA suppressor gene contains a G633 to C transversion. Yeast mitochondrial G633 corresponds to G517 of the E.coli 15S rRNA, which is occupied by an invariant G in all known small rRNA sequences. Interestingly, this mutation has occurred at the same position as the known MSU1 mitochondrial suppressor which changes G633 to A. The suppressor mutation lies in a highly conserved region of the rRNA, known in E.coli as the 530-loop, interacting with the S4, S5 and S12 ribosomal proteins. We also show an interesting interaction between the mitochondrial mim3-1 and the nuclear nam3-1 suppressors, both of which have the same action spectrum on mitochondrial mutations: nam3-1 abolishes the suppressor effect when present with mim3-1 in the same haploid cell. We discuss these results in the light of the nature of Nam3, identified by [1] as the yeast mitochondrial translation release factor. A hypothetical mechanism of suppression by "ribosome shifting" is also discussed in view of the nature of mutations suppressed and not suppressed.
31 CFR 598.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... NARCOTICS KINGPIN SANCTIONS REGULATIONS Interpretations § 598.409 Credit extended and cards issued by U.S... existing credit agreements, including, but not limited to, charge cards, debit cards, or other credit...
Directory of Open Access Journals (Sweden)
Agus Haryanto
2012-03-01
Penelitian ini bertujuan untuk menganalisis energi masukan-keluaran dan mengidentifikasi kemungkinan penghematan energi pada proses budidaya kelapa sawit. Penelitian dilakukan di PTPN VII Unit Usaha Rejosari, Lampung Selatan dengan mengamati semua energi yang digunakan dan dihasilkan. Energi masukan terdiri dari tenaga manusia, bahan bakar, energi tidak langsung dari pupuk, pestisida, dan alat-mesin pertanian. Energi keluaran berasal dari tandan buah segar (TBS dengan komponen minyak sawit, minyak inti sawit, serat, cangkang, dan tandan kosong, serta pelepah. Hasil penelitian menunjukkan bahwa budidaya kelapa sawit memerlukan energi masukan sebesar 57,63 GJ.ha-1 dan menghasilkan energi 339,14 GJ.ha-1. Sebagian besar energi masukan adalah penggunaan pupuk yang mencapai 31,22 GJ.ha-1 (54,18 % dari total energi masukan. Berdasarkan tahapan budidaya, maka pemeliharaan tanaman produktif memerlukan energi yang paling besar yaitu 33,06 GJ.ha-1 (57,37 %. Budidaya kelapa sawit menghasilkan energi neto 281,51 GJ.ha-1 dengan rasio energi 5,88, produktivitas energi 0,258 kg TBS/MJ, dan intensitas energi 3,87 MJ/kg TBS. Kata kunci: Analisis energi, energi masukan, energi keluaran, indikator energi
2010-07-01
... Justice; (6) Where the late charges pertain to claims involving savings bonds and notes arising under 31 U.S.C. 3105 and 3106 which are replaced pursuant to 31 U.S.C. 3126; (7) For reasons of equity or good...
Rodents as a Source of Salmonella Contamination in Wet Markets in Thailand
Czech Academy of Sciences Publication Activity Database
Ribas, A.; Saijuntha, W.; Agatsuma, T.; Prantlová, Veronika; Poonlaphdecha, S.
2016-01-01
Roč. 16, č. 8 (2016), s. 537-540 ISSN 1530-3667 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Norway rat * Pacific rat * S. 4,[5], 12:i * Salmonella * typhimurium * weltevreden * wet market * zoonoses Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.045, year: 2016
Czech Academy of Sciences Publication Activity Database
Blasco-Costa, Maria Isabel; Míguez-Lozano, R.; Sarabeev, V.; Balbuena, J. A.
2012-01-01
Roč. 61, č. 4 (2012), s. 619-627 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : 28S ribosomal DNA region * Internal transcribed spacer 1 * Morphology * Molecular systematics * Diversification processes * Mediterranean basin * Ergenstrema * Mugilidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.302, year: 2012 http://www.sciencedirect.com/science/article/pii/S138357691200089X
31 CFR 593.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... LIBERIAN REGIME OF CHARLES TAYLOR SANCTIONS REGULATIONS Interpretations § 593.409 Credit extended and cards..., including, but not limited to, charge cards, debit cards, or other credit facilities issued by a U.S...
31 CFR 587.408 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... Credit extended and cards issued by U.S. financial institutions. Section 587.201 on dealing in property... institutions from performing under any existing credit agreements, including, but not limited to, charge cards...
31 CFR 594.410 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... TERRORISM SANCTIONS REGULATIONS Interpretations § 594.410 Credit extended and cards issued by U.S. financial... agreements, including, but not limited to, charge cards, debit cards, or other credit facilities issued by a...
31 CFR 547.409 - Credit extended and cards issued by U.S. financial institutions.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Credit extended and cards issued by U... DEMOCRATIC REPUBLIC OF THE CONGO SANCTIONS REGULATIONS Interpretations § 547.409 Credit extended and cards..., including, but not limited to, charge cards, debit cards, or other credit facilities issued by a U.S...
Electrical conductivity studies in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites
Studenyak, I. P.; Neimet, Yu. Yu.; Kranjčec, M.; Solomon, A. M.; Orliukas, A. F.; Kežionis, A.; Kazakevičius, E.; Šalkus, T.
2014-01-01
Compositional, frequency, and temperature studies of impedance and electrical conductivity in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites were performed. Frequency range from 10 Hz to 3 × 109 Hz and temperature interval 300-400 K were used for the measurements. Compositional dependences of electrical conductivity and activation energy are analyzed; the most substantial changes are observed with the transition from (Ag3AsS3)0.4(As2S3)0.6 glass to (Ag3AsS3)0.5(As2S3)0.5 composite. With increase of Ag3AsS3 content, the investigated materials are found to have crystalline inclusions and show the two-phase composite nature. Addition of Ag3AsS3 leads to the increase of electrical conductivity whereas the activation energy decreases.
Czech Academy of Sciences Publication Activity Database
Cabezas-Cruz, A.; Alberdi, P.; Ayllón, N.; Valdés, James J.; Pierce, R.; Villar, M.; de la Fuente, J.
2016-01-01
Roč. 11, č. 4 (2016), s. 303-319 ISSN 1559-2294 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * epigenetic s * histone modifying enzyme * histone * pathogen * tick Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.394, year: 2016
Cryptosporidium avium n. sp (Apicomplexa: Cryptosporidiidae) in birds
Czech Academy of Sciences Publication Activity Database
Holubová, Nikola; Sak, Bohumil; Horčičková, Michaela; Hlásková, Lenka; Květoňová, Dana; Menchaca, S.; McEvoy, J.; Kváč, Martin
2016-01-01
Roč. 115, č. 6 (2016), s. 2243-2251 ISSN 0932-0113 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium avium * morphology * molecular analyses * transmission studies * Cryptosporidium avian genotype V Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Effect of cluster environment on the electron attachment to 2-nitrophenol
Czech Academy of Sciences Publication Activity Database
Kočišek, Jaroslav; Grygoryeva, Kateřina; Lengyel, Jozef; Fárník, Michal; Fedor, Juraj
2016-01-01
Roč. 70, č. 4 (2016), s. 98-105 ISSN 1434-6060 R&D Projects: GA ČR GJ16-10995Y; GA ČR GA14-14082S Institutional support: RVO:61388955 Keywords : electron attachment * cluster environment * 2-nitrophenol Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.288, year: 2016
Czech Academy of Sciences Publication Activity Database
Repulles-Albelda, A.; Holzer, Astrid S.; Raga, J. A.; Montero, F. E.
338-341, MAR 29 (2012), s. 47-55 ISSN 0044-8486 Institutional research plan: CEZ:AV0Z60220518 Keywords : Sparicotyle chrysophrii * Sparus aurata * Polyopisthocotylea * Oncomiracidial development * Hatching * Survival time Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.009, year: 2012 http://www.sciencedirect.com/science/article/pii/S0044848612000646
First description of Cryptosporidium ubiquitum XIIa subtype family in farmed fur animals
Czech Academy of Sciences Publication Activity Database
Kellnerová, K.; Holubová, Nikola; Jandova, Anna; Vejcik, A.; McEvoy, J.; Sak, Bohumil; Kváč, Martin
2017-01-01
Roč. 59, JUN (2017), s. 108-113 ISSN 0932-4739 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Apicomplexa * Chinchillas * Cryptosporidium * gp60 * Foxes * Mink * Nutrias Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.581, year: 2016
Designing molecular printboards: a photolithographic platform for recodable surfaces
Czech Academy of Sciences Publication Activity Database
Abt, D.; Schmidt, B. V. K. J.; Pop-Georgievski, Ognen; Quick, A. S.; Danilov, D.; Kostina, Nina Yu.; Bruns, M.; Wenzel, W.; Wegener, M.; Rodriguez-Emmenegger, Cesar; Barner-Kowollik, C.
2015-01-01
Roč. 21, č. 38 (2015), s. 13186-13190 ISSN 0947-6539 R&D Projects: GA ČR(CZ) GJ15-09368Y Institutional support: RVO:61389013 Keywords : cyclodextrin * molecular printboard * photoconjugation Subject RIV: BO - Biophysics Impact factor: 5.771, year: 2015
Prevalence and pathogenicity of Cryptosporidium andersoni in one herd of beef cattle
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Vítovec, J.
2003-01-01
Roč. 50, č. 9 (2003), s. 451-457 ISSN 0931-1793 Institutional research plan: CEZ:AV0Z6022909; CEZ:MSM 122200002 Keywords : cryptosporidiosis * cattle * Cryptosporidium andersoni Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.656, year: 2003
Czech Academy of Sciences Publication Activity Database
Neumayerová, H.; Koudela, Břetislav
2008-01-01
Roč. 153, 3/4 (2008), s. 197-202 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium muris * oocysts * low and high temperatures * infectivity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.039, year: 2008
Czech Academy of Sciences Publication Activity Database
Heneberg, P.; Faltýnková, Anna; Bizos, J.; Mala, M.; Žiak, J.; Literák, I.
2015-01-01
Roč. 8, FEB 8 2015 (2015), s. 85 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : cercariae * DNA analysis * fluke * host -parasite interaction * Hydrobiidae * life cycle * Littorinimorpha Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.234, year: 2015
Czech Academy of Sciences Publication Activity Database
Chelladurai, J.J.; Clark, M.E.; Kváč, Martin; Holubová, Nikola; Khan, E.; Stenger, B.L.S.; Giddings, C.W.; McEvoy, J.
2016-01-01
Roč. 115, č. 5 (2016), s. 1901-1906 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : Cryptosporidium * Red-winged blackbird * Passerines * Cryptosporidium galli * Avian genotypeVI * Proventriculus * Intestine Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Vítovec, J.
2007-01-01
Roč. 44, č. 1 (2007), s. 10-13 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60220518 Keywords : Strongyloides papillosus * beef calves * prevalence * sudden death syndrome Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.373, year: 2007
Deformation and fracture behavior of the P91 martensitic steel at high temperatures
Czech Academy of Sciences Publication Activity Database
Šiška, Filip; Stratil, Luděk; Šmíd, Miroslav; Luptáková, Natália; Záležák, Tomáš; Bártková, Denisa
2016-01-01
Roč. 672, AUG (2016), s. 1-6 ISSN 0921-5093 R&D Projects: GA ČR GJ15-21292Y Institutional support: RVO:68081723 Keywords : Steel * Plastic ity * Stress relaxation * Dislocations Subject RIV: JG - Metallurgy Impact factor: 3.094, year: 2016
Czech Academy of Sciences Publication Activity Database
Široký, P.; Modrý, David
2010-01-01
Roč. 49, č. 4 (2010), s. 301-310 ISSN 0065-1583 Institutional research plan: CEZ:AV0Z60220518 Keywords : Chelonians * oocysts * parasite diversity * Southeast Asia * Systematics Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.881, year: 2010
Zoonotic microsporidia in dogs and cats in Poland
Czech Academy of Sciences Publication Activity Database
Piekarska, J.; Kicia, M.; Wesołowska, M.; Kopacz, Z.; Gorczykowski, M.; Szczepankiewicz, D.; Kváč, Martin; Sak, Bohumil
2017-01-01
Roč. 246, 15 November (2017), s. 108-111 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : cat * dog * Encephalitozoon spp. * Enterocytozoon bieneusi * zoonosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.356, year: 2016
Czech Academy of Sciences Publication Activity Database
Svobodová, Z.; Kolářová, J.; Dyková, Iva; Hamáčková, J.; Kouřil, J.
2009-01-01
Roč. 29, č. 3 (2009), s. 92-97 ISSN 0108-0288 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ectocommensal ciliates * Capriniana piscium * Oncorhynchus mykiss * gill infection Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.513, year: 2009
Czech Academy of Sciences Publication Activity Database
Kalousová, B.; Piel, A. K.; Pomajbíková, Kateřina; Modrý, David; Stewart, F.A.; Petrželková, Klára Judita
2014-01-01
Roč. 35, č. 2 (2014), s. 463-475 ISSN 0164-0291 Institutional support: RVO:60077344 Keywords : hominoid * Pan troglodytes schweinfurthii * gastrointestinal parasites * savanna * Spirurids * transmission * Ugalla * Tanzania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.993, year: 2014
Czech Academy of Sciences Publication Activity Database
D'Amico, G.; Juránková, J.; Tăbăran, F. A.; Frgelecová, L.; Forejtek, P.; Matei, I.A.; Ionică, A.M.; Hodžić, A.; Modrý, David; Mihalca, A. D.
2017-01-01
Roč. 8, č. 2 (2017), s. 309-312 ISSN 1877-959X Institutional support: RVO:60077344 Keywords : Red fox * subcutaneous * ticks * Czech Republic * Romania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 3.230, year: 2016
Microhydration Prevents Fragmentation of Uracil and Thymine by Low-Energy Electrons
Czech Academy of Sciences Publication Activity Database
Kočišek, Jaroslav; Pysanenko, Andriy; Fárník, Michal; Fedor, Juraj
2016-01-01
Roč. 7, AUG 2016 (2016), s. 3401-3405 ISSN 1948-7185 R&D Projects: GA ČR GJ16-10995Y Institutional support: RVO:61388955 Keywords : Microhydration * ionization * organometallics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 9.353, year: 2016
DEFF Research Database (Denmark)
da Piedade, Isabelle; Skive, Bolette; Christensen, Henrik
2013-01-01
We present the draft genome sequence of Streptococcus equi subsp. zooepidemicus S31A1, a strain isolated from equine infectious endometritis in Denmark. Comparative analyses of this genome were done with four published reference genomes: S. zooepidemicus strains MGCS10565, ATCC 35246, and H70 and S...
Parasites of Harmonia axyridis: current research and perspectives
Czech Academy of Sciences Publication Activity Database
Haelewaters, D.; Zhao, S. Y.; Clusella-Trullas, S.; Cottrell, T. E.; De Kesel, A.; Fiedler, L.; Herz, A.; Hesketh, H.; Hui, C.; Kleespies, R. G.; Losey, J. E.; Minnaar, I. A.; Murray, K. M.; Nedvěd, Oldřich; Pfliegler, W. P.; Raak-van den Berg, C. L.; Riddick, E. W.; Shapiro-Ilan, D. I.; Smyth, R. R.; Steenberg, T.; van Wielink, P. S.; Viglášová, S.; Zhao, Z.; Ceryngier, P.; Roy, H. E.
2017-01-01
Roč. 62, č. 3 (2017), s. 355-371 ISSN 1386-6141 Institutional support: RVO:60077344 Keywords : Coccipolipus hippodamiae * enemy release hypothesis * Harmonia axyridis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Other biological topics Impact factor: 1.918, year: 2016 https://link.springer.com/article/10.1007/s10526-016-9766-8
Dissociative electron attachment and anion-induced dimerization in pyruvic acid
Czech Academy of Sciences Publication Activity Database
Zawadzki, Mateusz; Ranković, Miloš; Kočišek, Jaroslav; Fedor, Juraj
2018-01-01
Roč. 20, č. 10 (2018), s. 6838-6844 ISSN 1463-9076 R&D Projects: GA ČR GA17-04844S; GA ČR GJ16-10995Y Institutional support: RVO:61388955 Keywords : pyruvic acid * electron attachment * dimerization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.123, year: 2016
High temperature deformation mechanisms in the 14% Cr ODS alloy
Czech Academy of Sciences Publication Activity Database
Šiška, Filip; Stratil, Luděk; Hadraba, Hynek; Fintová, Stanislava; Kuběna, Ivo; Záležák, Tomáš; Bártková, Denisa
2017-01-01
Roč. 689, MAR (2017), s. 34-39 ISSN 0921-5093 R&D Projects: GA ČR(CZ) GA14-25246S; GA ČR GJ15-21292Y Institutional support: RVO:68081723 Keywords : ODS steel * Plastic ity * Stress relaxation * Dislocations Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 3.094, year: 2016
Hückel–Hubbard–Ohno modeling of π-bonds in ethene and ethyne with application to trans-polyacetylene
Czech Academy of Sciences Publication Activity Database
Timár, M.; Barcza, G.; Gebhard, F.; Veis, Libor; Legeza, Ö.
2016-01-01
Roč. 18, č. 28 (2016), s. 18835-18845 ISSN 1463-9076 R&D Projects: GA ČR GA16-12052S; GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : MATRIX RENORMALIZATION-GROUP * initio quantum chemistry * CHARGE REPULSION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.123, year: 2016
Czech Academy of Sciences Publication Activity Database
Zahradníková Jr., A.; Kováčová, V.; Martínková, Natália; Orlova, M. V.; Orlov, O. L.; Piaček, V.; Zukal, Jan; Pikula, J.
2018-01-01
Roč. 65, č. 2 (2018), s. 303-308 ISSN 1865-1674 R&D Projects: GA ČR(CZ) GA17-20286S Institutional support: RVO:68081766 Keywords : Chiroptera * ectoparasite * Eurasia * fungal infection * Russia * white-nose syndrome Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 3.585, year: 2016
HIF-1alpha Deficiency Attenuates the Cardiomyogenesis of Mouse Embryonic Stem Cells
Czech Academy of Sciences Publication Activity Database
Kudová, Jana; Procházková, J.; Vašíček, Ondřej; Perečko, Tomáš; Sedláčková, M.; Pešl, M.; Pachernik, J.; Kubala, Lukáš
2016-01-01
Roč. 11, č. 6 (2016) E-ISSN 1932-6203 R&D Projects: GA ČR GA13-29358S Grant - others:Grantová agentura ČR - GA ČR(CZ) GJ15-13443Y Institutional support: RVO:68081707 Keywords : INDUCIBLE FACTOR 1- ALPHA * GENE-EXPRESSION * CARDIAC DIFFERENTIATION Subject RIV: BO - Biophysics Impact factor: 2.806, year: 2016
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Hromadová, N.; Květoňová, Dana; Rost, M.; Sak, Bohumil
2011-01-01
Roč. 177, 3/4 (2011), s. 378-382 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Calves * Cryptosporidium andersoni * C. bovis * C. parvum * GP60 * SSU Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.579, year: 2011
Czech Academy of Sciences Publication Activity Database
Kudlai, Olena; Pulis, E.E.; Kostadinova, Aneta; Tkach, V.V.
2016-01-01
Roč. 93, č. 4 (2016), s. 307-319 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : sequences * Platyhelminthes * morphology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.181, year: 2016
Czech Academy of Sciences Publication Activity Database
Kubelová, M.; Papoušek, I.; Bělohlávek, T.; Goüy de Bellocq, Joëlle; Baird, Stuart J. E.; Široký, P.
2015-01-01
Roč. 6, č. 6 (2015), s. 711-714 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Spotted fever group rickettsiae * Rickettsia monacensis * Rickettsia helvetica * Ixodes ricinus * Lacerta schreiberi Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.690, year: 2015
Czech Academy of Sciences Publication Activity Database
Modrý, David; Hofmannová, L.; Antalová, Z.; Sak, Bohumil; Kváč, Martin
2012-01-01
Roč. 111, č. 1 (2012), s. 471-473 ISSN 0932-0113 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : C-MURIS * CATTLE * PARVUM Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.852, year: 2012
Czech Academy of Sciences Publication Activity Database
Mendoza-Franco, Edgar F.; Violante-González, J.; Roche, D. G.
2009-01-01
Roč. 105, č. 3 (2009), s. 703-708 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : Neotropics * Gerreidae * Aristocleidus * Diapterus * Gerres * host specificity * Isthmus of Panama Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009
Czech Academy of Sciences Publication Activity Database
Grützmacher, K. S.; Köndgen, S.; Keil, V.; Todd, A.; Feistner, A.; Herbinger, I.; Petrželková, Klára Judita; Fuh, T.; Leendertz, S. A.; Calvignac-Spencer, S.; Leendertz, F. H.
2016-01-01
Roč. 13, č. 3 (2016), s. 499-510 ISSN 1612-9202 Institutional support: RVO:68081766 Keywords : respiratory disease * respiratory syncytial virus * enterovirus * western lowland gorillas * great apes * noninvasive detection Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.252, year: 2016
Dawestrema cycloancistrium (Monogenea) from the head pores of arapaimas
Czech Academy of Sciences Publication Activity Database
Santos, C. P.; Da Silva, M.T.; Moravec, František
2017-01-01
Roč. 125, č. 2 (2017), s. 93-100 ISSN 0177-5103 Institutional support: RVO:60077344 Keywords : Amazonia * Arapaima gigas * Brazil * Freshwater fish * Monogenea * Parasite * Peru * Pirarucu Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.549, year: 2016
Sensitive and rapid detection of aflatoxin M1 in milk utilizing enhanced SPR and p(HEMA) brushes
Czech Academy of Sciences Publication Activity Database
Karczmarczyk, A.; Dubiak-Szepietowska, M.; Vorobii, Mariia; Rodriguez-Emmenegger, Cesar; Dostálek, J.; Feller, K.-H.
2016-01-01
Roč. 81, 15 July (2016), s. 159-165 ISSN 0956-5663 R&D Projects: GA ČR(CZ) GJ15-09368Y Institutional support: RVO:61389013 Keywords : surface plasmon resonance * aflatoxin * polymer brushes Subject RIV: CD - Macromolecular Chemistry Impact factor: 7.780, year: 2016
Czech Academy of Sciences Publication Activity Database
Traversa, D.; Avolio, S.; Modrý, David; Otranto, D.; Iorio, R.; Aroch, I.; Cringoli, G.; Milillo, P.; Albrechtová, K.; Mihalca, A. D.; Lavy, E.
2008-01-01
Roč. 157, 1/2 (2008), s. 108-116 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : spirocercosis * dog * coproscopy * FLOTAC * mitochondrial DNA * cox1 gene * diagnosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.039, year: 2008
Benchmark Applications of Variations of Multireference Equation of Motion Coupled-Cluster Theory
Czech Academy of Sciences Publication Activity Database
Huntington, L. M.; Demel, Ondřej; Nooijen, M.
2016-01-01
Roč. 12, č. 1 (2016), s. 114-132 ISSN 1549-9618 R&D Projects: GA ČR GJ15-00058Y Institutional support: RVO:61388955 Keywords : MR-EOM * Benchmark applications * variations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.245, year: 2016
Czech Academy of Sciences Publication Activity Database
Čavlovič, K.; Buj, I.; Karaica, D.; Jelič, D.; Choleva, Lukáš
2018-01-01
Roč. 54, č. 1 (2018), s. 11-20 ISSN 0036-3375 R&D Projects: GA ČR GJ15-19947Y Institutional support: RVO:67985904 Keywords : hybridogenesis * population composition * allozyme markers Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.250, year: 2016
Czech Academy of Sciences Publication Activity Database
Ash, Anirban; de Chambrier, A.; Shimazu, T.; Ermolenko, A. V.; Scholz, Tomáš
2015-01-01
Roč. 91, č. 1 (2015), s. 13-33 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : tapeworm * redescription * terminology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.316, year: 2015
Czech Academy of Sciences Publication Activity Database
Kritsky, D. C.; Mendoza-Franco, Edgar F.; Bullard, S. A.; Vidal-Martínez, V. M.
2009-01-01
Roč. 74, č. 1 (2009), s. 1-15 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Monogenea * Dactylogyridae * catfish es * morphology * morphology * Pacific Ocean * Panama Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009
Czech Academy of Sciences Publication Activity Database
Madinda, N. F.; Ehlers, B.; Wertheim, J. O.; Akoua-Koffi, C.; Bergl, R. A.; Boesch, C.; Akonkwa, D. B. M.; Eckardt, W.; Fruth, B.; Gillespie, T. R.; Gray, M.; Hohmann, G.; Karhemere, S.; Kujirakwinja, D.; Langergraber, K.; Muyembe, J.-J.; Nishuli, R.; Pauly, M.; Petrželková, Klára Judita; Robbins, M. M.; Todd, A.; Schubert, G.; Stoinski, T. S.; Wittig, R. M.; Zuberbühler, K.; Peeters, M.; Leendertz, F. H.; Calvignac-Spencer, S.
2016-01-01
Roč. 90, č. 19 (2016), s. 8531-8541 ISSN 0022-538X Institutional support: RVO:60077344 Keywords : JC virus * divergence times * evolution * phylogenies * selection * bats * coevolution * population * chimpanzee * diversity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.663, year: 2016
Czech Academy of Sciences Publication Activity Database
Vadlejch, J.; Langrová, I.; Borovský, M.; Sedmíková, M.; Jankovská, I.; Fechtner, J.; Lytvynets, Andrej
2006-01-01
Roč. 43, č. 2 (2006), s. 64-68 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z50110509 Keywords : Trichostrongylus colubriformis * hypobiosis * protein * enzymes * SDS-PAGE * API -ZYM Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.500, year: 2006
Czech Academy of Sciences Publication Activity Database
Hoffmann, A.; Plötner, J.; Pruvost, N. B. M.; Christiansen, D. G.; Röthlisberger, S.; Choleva, Lukáš; Mikulíček, P.; Cogalniceanu, D.; Sas-Kovács, I.; Shabanov, D.; Morozov-Leonov, S.; Reyer, H. U.
2015-01-01
Roč. 24, č. 17 (2015), s. 4371-4391 ISSN 0962-1083 R&D Projects: GA ČR(CZ) GJ15-19947Y Institutional support: RVO:67985904 Keywords : all-hybrids populations * founder effects * geographic distribution Subject RIV: EG - Zoology Impact factor: 5.947, year: 2015
MCNP4c JEFF-3.1 Based Libraries. Eccolib-Jeff-3.1 libraries
International Nuclear Information System (INIS)
Sublet, J.Ch.
2006-01-01
Continuous-energy and multi-temperatures MCNP Ace types libraries, derived from the Joint European Fusion-Fission JEFF-3.1 evaluations, have been generated using the NJOY-99.111 processing code system. They include the continuous-energy neutron JEFF-3.1/General Purpose, JEFF-3.1/Activation-Dosimetry and thermal S(α,β) JEFF-3.1/Thermal libraries and data tables. The processing steps and features are explained together with the Quality Assurance processes and records linked to the generation of such multipurpose libraries. (author)
Survey of oxide candidate for advanced 9%, 14% and 17%Cr ODS steels for fusion applications
Czech Academy of Sciences Publication Activity Database
Hadraba, Hynek; Husák, Roman; Stratil, Luděk; Šiška, Filip; Chlup, Zdeněk; Puchý, V.; Michalička, J.
2017-01-01
Roč. 124, NOV (2017), s. 1028-1032 ISSN 0920-3796 R&D Projects: GA ČR(CZ) GA14-25246S; GA ČR GJ15-21292Y Institutional support: RVO:68081723 Keywords : ODS steel * Mechanical alloying * SPS * Tensile behavior * Hardness Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 1.319, year: 2016
Detecting seasonal variation in composition of adult Coccinellidae communities
Czech Academy of Sciences Publication Activity Database
Honěk, A.; Martínková, Z.; Dixon, Anthony F. G.
2015-01-01
Roč. 40, č. 5 (2015), s. 543-552 ISSN 0307-6946 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073; GA ČR GA14-26561S Institutional support: RVO:67179843 Keywords : anbundance * adalia decempunctata * diversity * Harmonia axyridis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.687, year: 2015
Fracture behavior of the ODS steels prepared by internal oxidation
Czech Academy of Sciences Publication Activity Database
Stratil, Luděk; Šiška, Filip; Hadraba, Hynek; Bártková, Denisa; Fintová, Stanislava; Puchý, V.
2017-01-01
Roč. 124, NOV (2017), s. 1108-1111 ISSN 0920-3796 R&D Projects: GA ČR GJ15-21292Y; GA ČR(CZ) GA14-25246S Institutional support: RVO:68081723 Keywords : ODS * Internal oxidation * Fracture toughness * J-R curve * Fracture analysis Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 1.319, year: 2016
Tick-borne encephalitis virus infection of cultured mouse macrophages
Czech Academy of Sciences Publication Activity Database
Ahantarig, A.; Růžek, Daniel; Vancová, Marie; Janowitz, A.; Šťastná, Hana; Tesařová, Martina; Grubhoffer, Libor
2009-01-01
Roč. 52, č. 5 (2009), s. 283-290 ISSN 0300-5526 R&D Projects: GA ČR GA524/06/1479; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : tick-borne encephalitis * macrophage s * electron microscopy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.106, year: 2009
Energy Transfer in Microhydrated Uracil, 5-Fluorouracil, and 5-Bromouracil
Czech Academy of Sciences Publication Activity Database
Poštulka, J.; Slavíček, P.; Fedor, Juraj; Fárník, Michal; Kočišek, Jaroslav
2017-01-01
Roč. 121, č. 38 (2017), s. 8965-8974 ISSN 1520-6106 R&D Projects: GA ČR GJ16-10995Y; GA ČR(CZ) GA17-04068S Institutional support: RVO:61388955 Keywords : Aromatic compounds * Electrons * Energy transfer Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.177, year: 2016
Czech Academy of Sciences Publication Activity Database
Bím, Daniel; Rulíšek, Lubomír; Srnec, Martin
2016-01-01
Roč. 7, č. 1 (2016), s. 7-13 ISSN 1948-7185 R&D Projects: GA ČR(CZ) GJ15-10279Y; GA ČR(CZ) GA14-31419S Institutional support: RVO:61388963 ; RVO:61388955 Keywords : density functional theory * redox potentials * computational electrochemistry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 9.353, year: 2016
Czech Academy of Sciences Publication Activity Database
Dubská, L.; Literák, I.; Kverek, P.; Roubalová, Eva; Kocianova, E.; Taragelova, V.
2012-01-01
Roč. 3, č. 4 (2012), s. 265-268 ISSN 1877-959X Institutional support: RVO:60077344 Keywords : tick * Ixodes ricinus * Borrelia garinii * Anaplasma phagocytophilum * Rickettsia helvetica * Babesia sp. EU1 * Common nightingale Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.353, year: 2012 http://www.sciencedirect.com/science/article/pii/S1877959X12000556
Native and introduced squirrels in Italy host different Cryptosporidium spp.
Czech Academy of Sciences Publication Activity Database
Prediger, Jitka; Horčičková, Michaela; Hofmannová, L.; Sak, Bohumil; Ferrari, N.; Mazzamuto, M.V.; Romeo, C.; Wauters, L.A.; McEvoy, J.; Kváč, Martin
2017-01-01
Roč. 61, OCT (2017), s. 64-75 ISSN 0932-4739 R&D Projects: GA ČR GA15-01090S; GA MŠk LTAUSA17165 Institutional support: RVO:60077344 Keywords : Cryptosporidium * gp60 * infection * Italy * phylogeny * tree squirrels Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.581, year: 2016
Lifescience Database Archive (English)
Full Text Available URK 30S ribosomal protein S1 OS=Limnobacter s... 35 2.7 tr|Q47GJ9|Q47GJ9_DECAR SSU ribosomal protein S1P OS=...Sbjct: 371 DFSRNFKKGDK--LQGAIKSITDFGVFIGLPGGIDGLVHLSDLSWS 414 >tr|A6GU99|A6GU99_9BURK 30S ribosomal protein S1 OS=Limnobacter
Czech Academy of Sciences Publication Activity Database
Moravec, František; Chávez, R. A.; Oliva, M. E.
2011-01-01
Roč. 108, č. 1 (2011), s. 227-232 ISSN 0932-0113 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Genypterus * Chile Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.149, year: 2011
Colourings without monochromatic disjoint pairs
Czech Academy of Sciences Publication Activity Database
Clemens, D.; Das, S.; Tran, Tuan
2018-01-01
Roč. 70, May (2018), s. 99-124 ISSN 0195-6698 R&D Projects: GA ČR GJ16-07822Y Institutional support: RVO:68081715 Keywords : Erdos-Rothschild problem * intersecting families * Erdos-Ko-Rado theorem Subject RIV: BA - General Mathematics Impact factor: 0.786, year: 2016
Czech Academy of Sciences Publication Activity Database
Lopes, R.R.S.; Silveira, G. de O.; Eitler, R.; Vidal, R.S.; Kessler, A.; Hinger, S.; Paris, Zdeněk; Alfonzo, J. D.; Polycarpo, C.
2016-01-01
Roč. 22, č. 8 (2016), s. 1190-1199 ISSN 1355-8382 R&D Projects: GA ČR GJ15-21450Y Institutional support: RVO:60077344 Keywords : Trypanosoma * tRNA * tRNA editing * splicing * intron Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.605, year: 2016
Czech Academy of Sciences Publication Activity Database
Valigurová, A.; Michalková, V.; Koudela, Břetislav
2009-01-01
Roč. 39, č. 11 (2009), s. 1235-1242 ISSN 0020-7519 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * epimerite retraction * trophozoite Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.819, year: 2009
Czech Academy of Sciences Publication Activity Database
Yooyen, T.; Moravec, František; Wongsawad, C.
2011-01-01
Roč. 78, č. 2 (2011), s. 139-149 ISSN 0165-5752 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cucullanus * marine fish * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011
Effects of selected tricyclic antidepressants on early-life stages of common carp (Cyprinus carpio)
Czech Academy of Sciences Publication Activity Database
Sehonová, P.; Plhalová, L.; Blahová, J.; Doubková, V.; Maršálek, P.; Prokeš, Miroslav; Tichý, F.; Skládaná, M.; Fiorino, E.; Mikula, P.; Večerek, V.; Faggio, C.; Svobodová, Z.
2017-01-01
Roč. 185, October (2017), s. 1072-1080 ISSN 0045-6535 Institutional support: RVO:68081766 Keywords : Mixture toxicity * Amitriptyline * Nortriptyline * Clomipramine * Oxidative stress Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.208, year: 2016
Czech Academy of Sciences Publication Activity Database
Reblánová, M.; Špakulová, M.; Orosová, Martina; Kraľová-Hromadová, I.; Bazsalovicsová, E.; Rajský, D.
2011-01-01
Roč. 109, č. 4 (2011), s. 2021-1028 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : SCHISTOSOMA-MANSONI * DIFFERENTIATION * FISH * ITS2 * HYBRIDIZATION * EPIDEMIOLOGY * LOCALIZATION * CYTOGENETICS * SHEEP Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.149, year: 2011
Prevalence of Borrelia miyamotoi in Ixodes Ticks in Europe and the United States
Czech Academy of Sciences Publication Activity Database
Crowder, C. D.; Carolan, H. E.; Rounds, M. A.; Hönig, Václav; Mothes, B.; Haag, H.; Nolte, O.; Luft, B. J.; Grubhoffer, Libor; Ecker, D. J.; Schutzer, S. E.; Eshoo, M. W.
2014-01-01
Roč. 20, č. 10 (2014), s. 1678-1682 ISSN 1080-6040 Institutional support: RVO:60077344 Keywords : ionization mass spectrometry * polymerase chain reaction * Lyme disease * burgdorferi * spirochete * infection * vector * meningoencephalitis * identification * pathogens Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 6.751, year: 2014
Numerical analysis of twin thickening process in magnesium alloys
Czech Academy of Sciences Publication Activity Database
Šiška, Filip; Stratil, Luděk; Čížek, J.; Ghaderi, A.; Barnett, M.
2017-01-01
Roč. 124, FEB (2017), s. 9-16 ISSN 1359-6454 R&D Projects: GA ČR GJ15-21292Y Institutional support: RVO:68081723 Keywords : Magnesium alloy * Twinning * Crystal plastic ity * FEM Subject RIV: JG - Metallurgy OBOR OECD: Materials engineering Impact factor: 5.301, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František
2010-01-01
Roč. 57, č. 4 (2010), s. 313-314 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Paraphilometroides * Nemipterus * Malaysia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010
Czech Academy of Sciences Publication Activity Database
González-Solís, David; Ali, A. H.
2015-01-01
Roč. 60, č. 4 (2015), s. 759-766 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Arabian Gulf * elasmobranchs * nematode Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.293, year: 2015
Czech Academy of Sciences Publication Activity Database
Růžicová, M.; Petrželková, Klára Judita; Kalousová, B.; Modrý, David; Pomajbíková, Kateřina
2014-01-01
Roč. 100, č. 5 (2014), s. 662-670 ISSN 0022-3395 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : Balantidium coli * lowland gorillas * helminth eggs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.227, year: 2014
Czech Academy of Sciences Publication Activity Database
Gaglio, G.; Gianetto, S.; Panebianco, A.; Moravec, František
2009-01-01
Roč. 56, č. 4 (2009), s. 317-318 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Pagellus * Italy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.266, year: 2009
Czech Academy of Sciences Publication Activity Database
Moravec, František; Dyková, Iva; de Buron, I.
2009-01-01
Roč. 56, č. 1 (2009), s. 64-66 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Morone * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.266, year: 2009
Czech Academy of Sciences Publication Activity Database
Moravec, František; Gaglio, G.; Giannetto, S.; Marino, F.
2010-01-01
Roč. 107, č. 2 (2010), s. 399-402 ISSN 0932-0113 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Spicara * Italy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010
Czech Academy of Sciences Publication Activity Database
Srnec, Martin; Wong, S. D.; Matthews, M. L.; Krebs, C.; Bollinger, J. M.; Solomon, E. I.
2016-01-01
Roč. 138, č. 15 (2016), s. 5110-5122 ISSN 0002-7863 R&D Projects: GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : Ferryl intermediate * syringomycin halogenase * electronic structure Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 13.858, year: 2016
Multiple cross-species transmission events of human adenoviruses (HAdV) during hominine evolution
Czech Academy of Sciences Publication Activity Database
Hoppe, E.; Pauly, M.; Gillespie, T. R.; Akoua-Koffi, C.; Hohmann, G.; Fruth, B.; Karhemere, S.; Madinda, N. F.; Mugisha, L.; Muyembe, J.-J.; Todd, A.; Petrželková, Klára Judita; Gray, M.; Robbins, M.; Bergl, R. A.; Wittig, R. M.; Zuberbuehler, K.; Boesch, C.; Schubert, G.; Leendertz, F. H.; Ehlers, B.; Calvignac-Spencer, S.
2015-01-01
Roč. 32, č. 8 (2015), s. 2072-2084 ISSN 0737-4038 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : adenovirus * African great apes * zoonosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 13.649, year: 2015
Multiple Cross-Species Transmission Events of Human/nAdenoviruses (HAdV) during Hominine Evolution
Czech Academy of Sciences Publication Activity Database
Hoppe, E.; Pauly, M.; Gillespie, T. R.; Akoua-Koffi, C.; Hohmann, G.; Fruth, B.; Karhemere, S.; Madinda, N. F.; Mugisha, L.; Muyembe, J.-J.; Todd, A.; Petrželková, Klára Judita; Gray, M.; Robbins, M.; Bergl, R. A.; Wittig, R. M.; Zuberbühler, K.; Boesch, C.; Schubert, G.; Leendertz, F. H.; Ehlers, B.; Calvignac-Spencer, S.
2015-01-01
Roč. 32, č. 8 (2015), s. 2072-2084 ISSN 0737-4038 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : adenovirus * African great apes * zoonosis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 13.649, year: 2015
Czech Academy of Sciences Publication Activity Database
Moravec, František; Bakenhaster, M.
2010-01-01
Roč. 57, č. 3 (2010), s. 213-222 ISSN 0015-5683 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometridae * Marine fish * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010
Introduction of Mayorella gemmifera Schaeffer, 1926 into phylogenetic studies of Amoebozoa
Czech Academy of Sciences Publication Activity Database
Dyková, Iva; Pecková, Hana; Kostka, Martin
2008-01-01
Roč. 47, č. 4 (2008), s. 205-210 ISSN 0065-1583 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Amoebozoa * Mayorella gemmifera * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.013, year: 2008
Hybrids and horizontal transfer: introgression allows adaptive allele discovery
Czech Academy of Sciences Publication Activity Database
Schmickl, Roswitha; Marburger, S.; Bray, S.; Yant, L.
2017-01-01
Roč. 68, č. 20 (2017), s. 5453-5470 ISSN 0022-0957 R&D Projects: GA ČR(CZ) GJ16-15134Y Institutional support: RVO:67985939 Keywords : evolution * hybridization * population genetics Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 5.830, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Levron, Céline; de Buron, I.
2011-01-01
Roč. 97, č. 2 (2011), s. 297-304 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Dichelyne * Rhabdochona * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.405, year: 2011
Czech Academy of Sciences Publication Activity Database
Palánová, Anna
2015-01-01
Roč. 60, č. 7 (2015), s. 345-350 ISSN 0375-8427 R&D Projects: GA MŠk ED2.1.00/03.0124 Institutional support: RVO:67985904 Keywords : hereditary * eye * disease * dog Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.560, year: 2015
Ixodid ticks parasitizing wild carnivores in Romania
Czech Academy of Sciences Publication Activity Database
D'Amico, G.; Dumitrache, M.O.; Matei, I.A.; Ionică, A.M.; Gherman, C.M.; Sándor, A.D.; Modrý, David; Mihalca, A. D.
2017-01-01
Roč. 71, č. 2 (2017), s. 139-149 ISSN 0168-8162 Institutional support: RVO:60077344 Keywords : Dermacentor spp. * Haemaphysalis spp. * Ixodes spp. * Rhipicephalus spp. * wildlife * tick-host associations Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.760, year: 2016
Dominance on Strict Triangular Norms and Mulholland Inequality
Czech Academy of Sciences Publication Activity Database
Petrík, Milan
2018-01-01
Roč. 335, 15 March (2018), s. 3-17 ISSN 0165-0114 R&D Projects: GA ČR GJ15-07724Y Institutional support: RVO:67985807 Keywords : dominance relation * Mulholland inequality * strict triangular norm * transitivity Subject RIV: BA - General Mathematics Impact factor: 2.718, year: 2016
Investigation of phosphorous in thin films using the {sup 31}P(α,p){sup 34}S nuclear reaction
Energy Technology Data Exchange (ETDEWEB)
Pitthan, E., E-mail: eduardo.pitthan@ufrgs.br [PGMICRO, UFRGS, 91509-900 Porto Alegre, RS (Brazil); Gobbi, A.L. [Laboratório Nacional de Nanotecnologia, 13083-100 Campinas, SP (Brazil); Stedile, F.C. [PGMICRO, UFRGS, 91509-900 Porto Alegre, RS (Brazil); Instituto de Química, UFRGS, 91509-900 Porto Alegre, RS (Brazil)
2016-03-15
Phosphorus detection and quantification were obtained, using the {sup 31}P(α,p){sup 34}S nuclear reaction and Rutherford Backscattering Spectrometry, in deposited silicon oxide films containing phosphorus and in carbon substrates implanted with phosphorus. It was possible to determine the total amount of phosphorus using the resonance at 3.640 MeV of the {sup 31}P(α,p){sup 34}S nuclear reaction in samples with phosphorus present in up to 23 nm depth. Phosphorous amounts as low as 4 × 10{sup 14} cm{sup −2} were detected. Results obtained by nuclear reaction were in good agreement with those from RBS measurements. Possible applications of phosphorus deposition routes used in this work are discussed.
Techno-Economic Analysis of a Secondary Air Stripper Process
Energy Technology Data Exchange (ETDEWEB)
Heberle, J.R. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Nikolic, Heather [Center for Applied Energy Research, University of Kentucky, Lexington, KY (United States); Thompson, Jesse [Center for Applied Energy Research, University of Kentucky, Lexington, KY (United States); Liu, Kunlei [Center for Applied Energy Research, University of Kentucky, Lexington, KY (United States); Pinkerton, Lora L. [WorleyParsons, Reading, PA (United States); Brubaker, David [WorleyParsons, Reading, PA (United States); Simpson, James C. [WorleyParsons, Reading, PA (United States); Wu, Song [Mitsubishi Hitachi Power Systems America, Inc, Basking Ridge, NJ (United States); Bhown, Abhoyjit S. [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States)
2017-08-22
We present results of an initial techno-economic assessment on a post-combustion CO2 capture process developed by the Center for Applied Energy Research (CAER) at the University of Kentucky using Mitsubishi Hitachi Power Systems’ H3-1 aqueous amine solvent. The analysis is based on data collected at a 0.7 MWe pilot unit combined with laboratory data and process simulations. The process adds a secondary air stripper to a conventional solvent process, which increases the cyclic loading of the solvent in two ways. First, air strips additional CO2 from the solvent downstream of the conventional steam-heated thermal stripper. This extra stripping of CO2 reduces the lean loading entering the absorber. Second, the CO2-enriched air is then sent to the boiler for use as secondary air. This recycling of CO2 results in a higher concentration of CO2 in the flue gas sent to the absorber, and hence a higher rich loading of the solvent exiting the absorber. A process model was incorporated into a full-scale supercritical pulverized coal power plant model to determine the plant performance and heat and mass balances. The performance and heat and mass balance data were used to size equipment and develop cost estimates for capital and operating costs. Lifecycle costs were considered through a levelized cost of electricity (LCOE) assessment based on the capital cost estimate and modeled performance. The results of the simulations show that the CAER process yields a regeneration energy of 3.12 GJ/t CO2, a $53.05/t CO2 capture cost, and LCOE of $174.59/MWh. This compares to the U.S. Department of Energy’s projected costs (Case 10) of regeneration energy of 3.58 GJ/t CO2 , a $61.31/t CO2 capture cost, and LCOE of $189.59/MWh. For H3-1, the CAER process results in a regeneration energy of 2.62 GJ/tCO2 with a stripper pressure of 5.2 bar, a capture cost of $46.93/t CO2, and an LCOE of $164.33/MWh.
International Nuclear Information System (INIS)
Nimana, Balwinder; Canter, Christina; Kumar, Amit
2015-01-01
Highlights: • A model to estimate energy consumption and GHG emissions in oil sands is presented. • The model is developed from fundamental engineering principles. • Cogeneration in the oil sands has the ability to offset GHG emissions. • The effect of key parameters is investigated through a sensitivity analysis. - Abstract: A model – FUNNEL-GHG-OS (FUNdamental ENgineering PrinciplEs-based ModeL for Estimation of GreenHouse Gases in the Oil Sands) was developed to estimate project-specific energy consumption and greenhouse gas emissions (GHGs) in major recovery and extraction processes in the oil sands, namely surface mining and in situ production. This model estimates consumption of diesel (4.4–7.1 MJ/GJ of bitumen), natural gas (52.7–86.4 MJ/GJ of bitumen) and electricity (1.8–2.1 kW h/GJ of bitumen) as fuels in surface mining. The model also estimates the consumption of natural gas (123–462.7 MJ/GJ of bitumen) and electricity (1.2–3.5 kW h/GJ of bitumen) in steam assisted gravity drainage (SAGD), based on fundamental engineering principles. Cogeneration in the oil sands, with excess electricity exported to Alberta’s grid, was also explored. Natural gas consumption forms a major portion of the total energy consumption in surface mining and SAGD and thus is a main contributor to GHG emissions. Emissions in surface mining and SAGD range from 4.4 to 7.4 gCO 2 eq/MJ of bitumen and 8.0 to 34.0 gCO 2 eq/MJ of bitumen, respectively, representing a wide range of variability in oil sands projects. Depending upon the cogeneration technology and the efficiency of the process, emissions in oil sands recovery and extraction can be reduced by 16–25% in surface mining and 33–48% in SAGD. Further, a sensitivity analysis was performed to determine the effects of key parameters on the GHG emissions in surface mining and SAGD. Temperature and the consumption of warm water in surface mining and the steam-to-oil ratio (SOR) in SAGD are major parameters
Hartveit, Espen; Veruki, Margaret Lin
2010-03-15
Accurate measurement of the junctional conductance (G(j)) between electrically coupled cells can provide important information about the functional properties of coupling. With the development of tight-seal, whole-cell recording, it became possible to use dual, single-electrode voltage-clamp recording from pairs of small cells to measure G(j). Experiments that require reduced perturbation of the intracellular environment can be performed with high-resistance pipettes or the perforated-patch technique, but an accompanying increase in series resistance (R(s)) compromises voltage-clamp control and reduces the accuracy of G(j) measurements. Here, we present a detailed analysis of methodologies available for accurate determination of steady-state G(j) and related parameters under conditions of high R(s), using continuous or discontinuous single-electrode voltage-clamp (CSEVC or DSEVC) amplifiers to quantify the parameters of different equivalent electrical circuit model cells. Both types of amplifiers can provide accurate measurements of G(j), with errors less than 5% for a wide range of R(s) and G(j) values. However, CSEVC amplifiers need to be combined with R(s)-compensation or mathematical correction for the effects of nonzero R(s) and finite membrane resistance (R(m)). R(s)-compensation is difficult for higher values of R(s) and leads to instability that can damage the recorded cells. Mathematical correction for R(s) and R(m) yields highly accurate results, but depends on accurate estimates of R(s) throughout an experiment. DSEVC amplifiers display very accurate measurements over a larger range of R(s) values than CSEVC amplifiers and have the advantage that knowledge of R(s) is unnecessary, suggesting that they are preferable for long-duration experiments and/or recordings with high R(s). Copyright (c) 2009 Elsevier B.V. All rights reserved.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Authority. 3.1 Section 3.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY MINIMUM CAPITAL RATIOS; ISSUANCE OF DIRECTIVES Authority and Definitions § 3.1 Authority. This part is issued under the authority of 12 U.S.C. 1 et seq...
Czech Academy of Sciences Publication Activity Database
Wu, Tao; Kapitán, J.; Andrushchenko, Valery; Bouř, Petr
2017-01-01
Roč. 89, č. 9 (2017), s. 5043-5049 ISSN 0003-2700 R&D Projects: GA ČR(CZ) GJ16-08764Y; GA ČR GA15-09072S; GA ČR(CZ) GA16-05935S Institutional support: RVO:61388963 Keywords : rare earth ions * photophysical properties * europium(III) complexes Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.320, year: 2016
Spectroscopy of light neutron deficient nuclei: 31Ar and 27S decays
International Nuclear Information System (INIS)
Borrel, V.
1991-01-01
Light neutron-deficient nuclei exhibit several interesting decay modes. In some cases, beta-delayed alpha emission becomes possible, and beta-delayed three-proton emission can be allowed. The energy spectra of the emitted protons should give informations on the position of the isobaric analog state and on its deexcitation modes. Experimental results obtained at GANIL with the LISE spectrometer on the decay of the isotopes 31 Ar and 27 S are presented. These data are discussed and compared with the predicted isobaric analog state excitation energies and with shell-model calculations. (G.P.) 13 refs.; 7 figs.; 1 tab
Crimean-Congo Hemorrhagic Fever Virus in Bulgaria and Turkey
Czech Academy of Sciences Publication Activity Database
Mertens, M.; Schuster, I.; Sas, M. A.; Vatansever, Z.; Hubálek, Zdeněk; Güven, E.; Deniz, A.; Georgiev, G.; Peshev, R.; Groschup, M. H.
2016-01-01
Roč. 16, č. 9 (2016), s. 619-623 ISSN 1530-3667 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Crimean-Congo hemorrhagic fever virus: CCHFV * domestic animals * ELISA * epidemiology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.045, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Santos, C. P.
2009-01-01
Roč. 104, č. 3 (2009), s. 589-592 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculus * Eunectes * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009
Czech Academy of Sciences Publication Activity Database
Šlapeta, Jan Roger; Modrý, David; Ashe, J.; Koudela, Břetislav
2003-01-01
Roč. 50, č. 1 (2003), s. 23-30 ISSN 0015-5683 R&D Projects: GA ČR GA524/00/P015 Institutional research plan: CEZ:AV0Z6022909 Keywords : Coccidia * Caryospora * Eimeria Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.469, year: 2003
Taxonomy and biology of proteocephalidean cestodes: current state and perspectives
Czech Academy of Sciences Publication Activity Database
Scholz, Tomáš; de Chambrier, A.
2003-01-01
Roč. 40, č. 2 (2003), s. 65-75 ISSN 0440-6605 R&D Projects: GA ČR GA524/01/1314 Institutional research plan: CEZ:AV0Z6022909 Keywords : Proteocephalidea * taxonomy * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.474, year: 2003
Clickable antifouling polymer brushes for polymer pen lithography
Czech Academy of Sciences Publication Activity Database
Bog, U.; de los Santos Pereira, Andres; Mueller, S. L.; Havenridge, S.; Parrillo, Viviana; Bruns, M.; Holmes, A. E.; Rodriguez-Emmenegger, C.; Fuchs, H.; Hirtz, M.
2017-01-01
Roč. 9, č. 13 (2017), s. 12109-12117 ISSN 1944-8244 R&D Projects: GA ČR(CZ) GJ15-09368Y Institutional support: RVO:61389013 Keywords : antifouling * biofunctional interfaces * polymer brushes Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 7.504, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Justine, J.-L.
2011-01-01
Roč. 78, č. 2 (2011), s. 95-108 ISSN 0165-5752 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cucullanidae * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011
Czech Academy of Sciences Publication Activity Database
Moravec, František
2009-01-01
Roč. 105, č. 2 (2009), s. 577-578 ISSN 0932-0113 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : surface ultrastructure * Nicolla * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009
Czech Academy of Sciences Publication Activity Database
Bruňanská, Magdaléna; Nebesářová, Jana; Scholz, Tomáš
2003-01-01
Roč. 89, č. 5 (2003), s. 345-351 ISSN 0932-0113 R&D Projects: GA ČR GA524/01/1314 Institutional research plan: CEZ:AV0Z6022909 Keywords : cestoda * spermatozoon * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2003
A new species of Procamallanus (Nematoda: Camallanidae) from Pacific eels (Anguilla spp.)
Czech Academy of Sciences Publication Activity Database
Moravec, František; Justine, J.-L.; Würtz, J.; Taraschewski, H.; Sasal, P.
2006-01-01
Roč. 92, č. 1 (2006), s. 130-137 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Procamallanus * Anguilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.300, year: 2006
Czech Academy of Sciences Publication Activity Database
Moravec, František; Taraschewski, H.; Thairungroj Anantaphruti, M.; Maipanich, W.; Laoprasert, T.
2006-01-01
Roč. 100, č. 1 (2006), s. 69-75 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Procamallanus * Anguilla * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.140, year: 2006
Czech Academy of Sciences Publication Activity Database
Moravec, František; Fiala, Ivan; Dyková, Iva
2004-01-01
Roč. 49, č. 4 (2004), s. 319-324 ISSN 1230-2821 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : Nematoda * Philometra * parasite Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.560, year: 2004
Coexistence of gain-of-function JAK2 germ line mutations with JAK2(V617F) in polycythemia vera
Czech Academy of Sciences Publication Activity Database
Láníková, Lucie; Babošová, Oľga; Swierczek, S.; Wang, L.; Wheeler, D.A.; Divoky, V.; Kořínek, Vladimír; Prchal, J.T.
2016-01-01
Roč. 128, č. 18 (2016), s. 2266-2270 ISSN 0006-4971 R&D Projects: GA ČR GJ15-18046Y; GA MŠk LO1419 Institutional support: RVO:68378050 Keywords : JAK2 mutations * polycythemia vera Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 13.164, year: 2016
Spectroscopic insights into quadruplexes of five-repeat telomere DNA sequences upon G-block damage
Czech Academy of Sciences Publication Activity Database
Dvořáková, Zuzana; Vorlíčková, Michaela; Renčiuk, Daniel
2017-01-01
Roč. 1861, č. 11 (2017), s. 2750-2757 ISSN 0304-4165 R&D Projects: GA ČR(CZ) GJ17-19170Y Institutional support: RVO:68081707 Keywords : k+ solution * guanine quadruplexes Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.702, year: 2016
Two cystidicolids (Nematoda, Cystidicolidae) from marine fishes off New Caledonia
Czech Academy of Sciences Publication Activity Database
Moravec, František; Justine, J.-L.
2009-01-01
Roč. 54, č. 4 (2009), s. 341-349 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cystidicolid nematode * marine fish * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.070, year: 2009
Lawsonia intracellularis in wild mammals in the Slovak Carpathians
Czech Academy of Sciences Publication Activity Database
Tomanová, K.; Literák, I.; Klimeš, J.; Pavlačík, L.; Mrlík, Vojtěch; Smola, J.
2003-01-01
Roč. 39, č. 2 (2003), s. 407-411 ISSN 0090-3558 Institutional research plan: CEZ:AV0Z6093917 Keywords : Mammalia * Slovakia * Lawsonia intracellularis Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.793, year: 2003 http://www.jwildlifedis.org/cgi/reprint/39/2/407
Czech Academy of Sciences Publication Activity Database
Marzoug, D.; Boutiba, Z.; Kostadinova, Aneta; Pérez-del-Olmo, A.
2012-01-01
Roč. 61, č. 3 (2012), s. 414-420 ISSN 1383-5769 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasite communities * Fishing * Boops boops * Mediterranean * Santa Pola Bay * Gulf of Oran * Richness * Abundance Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.302, year: 2012
Antibodies to arboviruses in house sparrows (Passer domesticus) in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Juřicová, Zina; Literák, I.; Pinowski, J.
2000-01-01
Roč. 69, č. 3 (2000), s. 213-215 ISSN 0001-7213 R&D Projects: GA ČR GA524/96/1059 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.240, year: 2000 http://vfu-www.vfu.cz/acta-vet/vol69/pdf/69_213.pdf
Avipoxvirus infection in wild birds: new findings from Slovakia and Poland
Czech Academy of Sciences Publication Activity Database
Literák, I.; Halouzka, R.; Hromádko, M.; Honza, Marcel; Pinowska, B.; Haman, A.
2001-01-01
Roč. 70, č. 3 (2001), s. 339-344 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : cutaneous lesion Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_339.pdf
Larvae of trombiculid mites (Acarina: Trombiculidae) in wild birds in Slovak and Polish Carpathians
Czech Academy of Sciences Publication Activity Database
Literák, I.; Honza, Marcel; Pinowska, B.; Haman, A.
2001-01-01
Roč. 70, č. 4 (2001), s. 479-483 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : Passerines * parasites * Trombiculidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_479.pdf
Czech Academy of Sciences Publication Activity Database
Hamšíková, Z.; Silaghi, C.; Rudolf, Ivo; Venclíková, Kristýna; Mahríková, L.; Slovák, M.; Mendel, Jan; Blažejová, Hana; Berthová, L.; Kocianová, E.; Hubálek, Zdeněk; Schnittger, L.; Kazimírová, M.
2016-01-01
Roč. 115, č. 10 (2016), s. 3897-3904 ISSN 0932-0113 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Apicomplexa * Hepatozoon canis * Myodes glareolus * Apodemus spp. * Ticks * Central Europe Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Chavan, S. P.
2012-01-01
Roč. 83, č. 2 (2012), s. 117-122 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Wallago * India Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.260, year: 2012
Czech Academy of Sciences Publication Activity Database
Volf, P.; Hajmová, M.; Sádlová, J.; Votýpka, Jan
2004-01-01
Roč. 34, č. 11 (2004), s. 1221-1227 ISSN 0020-7519 Grant - others:GA FRVŠ(CZ) FRVŠ 2356/2002 Institutional research plan: CEZ:AV0Z6022909 Keywords : stomodeal valve * sand fly * Leishmania Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.092, year: 2004
Czech Academy of Sciences Publication Activity Database
Moravec, František; Bakenhaster, M.
2010-01-01
Roč. 96, č. 5 (2010), s. 987-992 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Diplectrum * Gulf of Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.208, year: 2010
Czech Academy of Sciences Publication Activity Database
Široký, P.; Modrý, David
2006-01-01
Roč. 45, č. 2 (2006), s. 183-189 ISSN 0065-1583 R&D Projects: GA ČR GP524/03/D104 Institutional research plan: CEZ:AV0Z60220518 Keywords : Eimeria * Apicomplexa * Heosemys Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.162, year: 2006
Czech Academy of Sciences Publication Activity Database
Moravec, František; Spratt, D. M.; Kay, W. R.
2006-01-01
Roč. 51, č. 4 (2006), s. 273-278 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Micropleura * Crocodylus * Australia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.772, year: 2006
Roles of bacteria in the bark beetle holobiont - how do they shape this forest pest?
Czech Academy of Sciences Publication Activity Database
García-Fraile, Paula
2018-01-01
Roč. 172, č. 2 (2018), s. 111-125 ISSN 0003-4746 R&D Projects: GA ČR(CZ) GJ16-15293Y Institutional support: RVO:61388971 Keywords : Bacterial pathogens * bacterial symbionts * beetle nutrition Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.046, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Jassim, A. A. R.; Al-Salim, N. K.
2012-01-01
Roč. 57, č. 4 (2012), s. 372-377 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometroides * Acanthopagrus * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2012
Czech Academy of Sciences Publication Activity Database
Moravec, František; Nagasawa, K.; Miyakawa, M.
2005-01-01
Roč. 66, č. 3 (2005), s. 171-173 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Physocypria * Anguillicola * Japan Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.361, year: 2005
Czech Academy of Sciences Publication Activity Database
Moravec, František; Scholz, Tomáš; Dyková, Iva; Kuchta, Roman; Fiala, Ivan; Kohn, A.
2006-01-01
Roč. 92, č. 1 (2006), s. 138-144 ISSN 0022-3395 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Alinema * Peru Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.300, year: 2006
Ultrastructure of the body wall of female Philometra obturans (Nematoda: Dracunculoidea)
Czech Academy of Sciences Publication Activity Database
Frantová, Denisa; Bruňanská, Magdaléna; Fagerholm, H.-P.; Kihlström, M.
2005-01-01
Roč. 95, č. 5 (2005), s. 327-332 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * ultrastructure * cuticule Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.226, year: 2005
Czech Academy of Sciences Publication Activity Database
Tyml, Tomáš; Skulinová, K.; Kavan, J.; Ditrich, O.; Kostka, M.; Dyková, I.
2016-01-01
Roč. 56, October (2016), s. 119-133 ISSN 0932-4739 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Arctic * Antarctic * Heterolobosea * Molecular taxonomy * Tetramitia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.581, year: 2016
Comparison of assays for the detection of West Nile virus antibodies in chicken serum
Czech Academy of Sciences Publication Activity Database
Weingartl, H. M.; Drebot, M. A.; Hubálek, Zdeněk; Halouzka, Jiří; Andonova, M.; Dibernardo, A.; Cottam-Birt, C.; Larence, J.; Marszal, P.
2003-01-01
Roč. 67, č. 2 (2003), s. 128-132 ISSN 0830-9000 Institutional research plan: CEZ:AV0Z6093917 Keywords : West Nile virus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.101, year: 2003 http://www.pubmedcentral.nih.gov/picrender.fcgi?artid=227040&blobtype=pdf
Czech Academy of Sciences Publication Activity Database
de Chambrier, A.; Scholz, Tomáš; Ibraheem, M. H.
2004-01-01
Roč. 57, č. 2 (2004), s. 97-109 ISSN 0165-5752 R&D Projects: GA ČR GA524/01/1314 Institutional research plan: CEZ:AV0Z6022909 Keywords : Cestoda * Proteocephalidea * taxonomy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.669, year: 2004
Czech Academy of Sciences Publication Activity Database
Pakandl, Michal; Černík, F.; Coudert, P.
2003-01-01
Roč. 91, č. 4 (2003), s. 304-311 ISSN 0932-0113 R&D Projects: GA AV ČR IBS6022002 Institutional research plan: CEZ:AV0Z6022909 Keywords : Coccidia * life cycle * Eimeria flavescens Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2003
Czech Academy of Sciences Publication Activity Database
Blasco-Costa, I.; Gibson, D. I.; Balbuena, J. A.; Raga, J. A.; Kostadinova, Aneta
2009-01-01
Roč. 73, č. 2 (2009), s. 107-133 ISSN 0165-5752 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : taxonomic revision * Haploporidae * Haploporus * Lecithobothrys * Mugilidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009
Czech Academy of Sciences Publication Activity Database
Marzoug, D.; Rima, M.; Boutiba, Z.; Georgieva, Simona; Kostadinova, Aneta; Pérez-del-Olmo, A.
2014-01-01
Roč. 87, č. 2 (2014), s. 127-134 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Digenea * phylogeny * Platyhelminthes * Trematoda * inference * evolution Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.336, year: 2014
Bacteria of the genus Rickettsia in ticks (Acari: Ixodidae) collected from birds in Costa Rica
Czech Academy of Sciences Publication Activity Database
Ogrzewalska, M.; Literák, I.; Čapek, Miroslav; Sychra, O.; Calderón, V. Á.; Rodríguez, B. C.; Prudencio, C.; Martins, T. F.; Labruna, M. B.
2015-01-01
Roč. 6, č. 4 (2015), s. 478-482 ISSN 1877-959X R&D Projects: GA AV ČR IAA601690901 Institutional support: RVO:68081766 Keywords : Rickettsia * Ticks * Birds * Ixodes * Amblyomma * Costa Rica Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.690, year: 2015
Czech Academy of Sciences Publication Activity Database
Moravec, František; Červinka, S.
2005-01-01
Roč. 67, 1/2 (2005), s. 105-109 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometroides * Cyprinus * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.361, year: 2005
Czech Academy of Sciences Publication Activity Database
Liedtke, H. C.; Müller, H.; Rödel, M.-O.; Menegon, M.; Gonwouo, L. N.; Barej, M. F.; Gvoždík, Václav; Schmitz, A.; Channing, A.; Nagel, P.; Loader, S. P.
2016-01-01
Roč. 70, č. 8 (2016), s. 1717-1733 ISSN 0014-3820 R&D Projects: GA ČR GJ15-13415Y Institutional support: RVO:68081766 Keywords : Amphibia * BAMM * bGMYC * disparity * evolutionary rate dynamics * molecular phylogeny Subject RIV: EH - Ecology, Behaviour Impact factor: 4.201, year: 2016
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Authority. 31.1 Section 31.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY EXTENSIONS OF CREDIT TO INSIDERS AND TRANSACTIONS WITH AFFILIATES § 31.1 Authority. This part is issued by the Comptroller of the Currency pursuant to 12 U.S.C. 93a...
22 CFR 226.31 - Insurance coverage.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Insurance coverage. 226.31 Section 226.31 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADMINISTRATION OF ASSISTANCE AWARDS TO U.S. NON-GOVERNMENTAL ORGANIZATIONS Post-award Requirements Property Standards § 226.31 Insurance coverage. Recipients...
Czech Academy of Sciences Publication Activity Database
Plecitá-Hlavatá, Lydie; Engstová, Hana; Alán, Lukáš; Špaček, Tomáš; Dlasková, Andrea; Smolková, Katarína; Špačková, Jitka; Tauber, Jan; Strádalová, Vendula; Malínský, Jan; Lessard, M.; Bewersdorf, J.; Ježek, Petr
2016-01-01
Roč. 30, č. 5 (2016), s. 1941-1957 ISSN 0892-6638 R&D Projects: GA ČR(CZ) GA13-02033S; GA ČR GJ15-02022Y Institutional support: RVO:67985823 ; RVO:68378041 Keywords : Mitofilin * Mic60 * OPA1 * dSTORM * 3D immunocytochemistry * electron microscopy * mitochondrial cristae morphology Subject RIV: EA - Cell Biology Impact factor: 5.498, year: 2016
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Babin, Vladimir; Jarý, Vítězslav; Havlák, Lubomír; Buryi, Maksym; Nikl, Martin
2017-01-01
Roč. 190, Oct (2017), s. 309-313 ISSN 0022-2313 R&D Projects: GA ČR GA17-06479S; GA ČR GJ15-18300Y Institutional support: RVO:68378271 Keywords : optical properties * oxide materials * tunneling * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.686, year: 2016
High light acclimation of Chromera velia points to photoprotective NPQ
Czech Academy of Sciences Publication Activity Database
Belgio, Erica; Trsková, Eliška; Kotabová, Eva; Ewe, Daniela; Prášil, Ondřej; Kaňa, Radek
2018-01-01
Roč. 135, 1-3 SI (2018), s. 263-274 ISSN 0166-8595 R&D Projects: GA MŠk(CZ) LO1416; GA ČR(CZ) GA16-10088S; GA ČR(CZ) GJ17-02363Y Institutional support: RVO:61388971 Keywords : Nonphotochemical quenching * Photoinhibition * Chromera velia alga Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.864, year: 2016
The G protein G(i1) exhibits basal coupling but not preassembly with G protein-coupled receptors
Czech Academy of Sciences Publication Activity Database
Bondar, Alexey; Lazar, Josef
2017-01-01
Roč. 292, č. 23 (2017), s. 9690-9698 ISSN 0021-9258 R&D Projects: GA ČR GA13-10799S; GA ČR(CZ) GJ17-14413Y Institutional support: RVO:61388971 Keywords : RESONANCE ENERGY-TRANSFER * CB1 CANNABINOID RECEPTOR * LIVING CELLS Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.125, year: 2016
Jabr, Rita I; Hatch, Fiona S; Salvage, Samantha C; Orlowski, Alejandro; Lampe, Paul D; Fry, Christopher H
2016-11-01
Cardiac arrhythmias are associated with raised intracellular [Ca 2+ ] and slowed action potential conduction caused by reduced gap junction (GJ) electrical conductance (Gj). Ventricular GJs are composed of connexin proteins (Cx43), with Gj determined by Cx43 phosphorylation status. Connexin phosphorylation is an interplay between protein kinases and phosphatases but the precise pathways are unknown. We aimed to identify key Ca 2+ -dependent phosphorylation sites on Cx43 that regulate cardiac gap junction conductance and action potential conduction velocity. We investigated the role of the Ca 2+ -dependent phosphatase, calcineurin. Intracellular [Ca 2+ ] was raised in guinea-pig myocardium by a low-Na solution or increased stimulation. Conduction velocity and Gj were measured in multicellular strips. Phosphorylation of Cx43 serine residues (S365 and S368) and of the intermediary regulator I1 at threonine35 was measured by Western blot. Measurements were made in the presence and absence of inhibitors to calcineurin, I1 or protein phosphatase-1 and phosphatase-2.Raised [Ca 2 + ] i decreased Gj, reduced Cx43 phosphorylation at S365 and increased it at S368; these changes were reversed by calcineurin inhibitors. Cx43-S368 phosphorylation was reversed by the protein kinase C inhibitor chelerythrine. Raised [Ca 2+ ] i also decreased I1 phosphorylation, also prevented by calcineurin inhibitors, to increase activity of the Ca 2+ -independent phosphatase, PPI. The PP1 inhibitor, tautomycin, prevented Cx43-365 dephosphorylation, Cx43-S368 phosphorylation and Gj reduction in raised [Ca 2+ ] i . PP2A had no role. Conduction velocity was reduced by raised [Ca 2+ ] i and reversed by calcineurin inhibitors. Reduced action potential conduction and Gj in raised [Ca 2+ ] are regulated by calcineurin-dependent Cx43-S365 phosphorylation, leading to Cx43-S368 dephosphorylation. The calcineurin action is indirect, via I1 dephosphorylation and subsequent activation of PP1.
Jin, Qing; Jiang, Qiuyue; Zhao, Lei; Su, Cuizhu; Li, Songshuo; Si, Fangyi; Li, Shanshan; Zhou, Chenhao; Mu, Yonglin; Xiao, Ming
2017-10-10
Antagonistic soil microorganisms, which are non-toxic, harmless non-pollutants, can effectively reduce the density of pathogenic species by some ways. Bacillus velezensis strain S3-1 was isolated from the rhizosphere soil of cucumber, and was shown to inhibit plant pathogens, promote plant growth and efficiently colonize rhizosphere soils. The strain produced 13 kinds of lipopeptide antibiotics, belonging to the surfactin, iturin and fengycin families. Here, we presented the complete genome sequence of S3-1. The genome consists of one chromosome without plasmids and also contains the biosynthetic gene cluster that encodes difficidin, macrolactin, surfactin and fengycin. The genome contains 86 tRNA genes, 27 rRNA genes and 57 antibiotic-related genes. The complete genome sequence of B. velezensis S3-1 provides useful information to further detect the molecular mechanisms behind antifungal actions, and will facilitate its potential as a biological pesticide in the agricultural industry. Copyright © 2017 Elsevier B.V. All rights reserved.
Effects of gap junction blockers on human neocortical synchronization.
Gigout, S; Louvel, J; Kawasaki, H; D'Antuono, M; Armand, V; Kurcewicz, I; Olivier, A; Laschet, J; Turak, B; Devaux, B; Pumain, R; Avoli, M
2006-06-01
Field potentials and intracellular recordings were obtained from human neocortical slices to study the role of gap junctions (GJ) in neuronal network synchronization. First, we examined the effects of GJ blockers (i.e., carbenoxolone, octanol, quinine, and quinidine) on the spontaneous synchronous events (duration = 0.2-1.1 s; intervals of occurrence = 3-27 s) generated by neocortical slices obtained from temporal lobe epileptic patients during application of 4-aminopyridine (4AP, 50 muM) and glutamatergic receptor antagonists. The synchronicity of these potentials (recorded at distances up to 5 mm) was decreased by GJ blockers within 20 min of application, while prolonged GJ blockers treatment at higher doses made them disappear with different time courses. Second, we found that slices from patients with focal cortical dysplasia (FCD) could generate in normal medium spontaneous synchronous discharges (duration = 0.4-8 s; intervals of occurrence = 0.5-90 s) that were (i) abolished by NMDA receptor antagonists and (ii) slowed down by carbenoxolone. Finally, octanol or carbenoxolone blocked 4AP-induced ictal-like discharges (duration = up to 35 s) in FCD slices. These data indicate that GJ play a role in synchronizing human neocortical networks and may implement epileptiform activity in FCD.
Directory of Open Access Journals (Sweden)
Hailou Zhang
2015-01-01
Full Text Available Ethanol extract of Yueju pill, a Traditional Chinese Medicine herbal formula widely used to treat mood disorders, demonstrates rapid antidepressant effects similar to ketamine, likely via instant enhancement of brain-derived neurotrophic factor (BDNF expression in the hippocampus. Here we investigated ethanol extracts of the constituent herbs of Yueju responsible for rapid antidepressant effects. Screening with tail suspension test in Kunming mice at 24 hours after a single administration of five individual constituent herbs of Yueju, we found that only Gardenia jasminoides Ellis (GJ showed a significant effect. The antidepressant response started at 2 hours after GJ administration. Similar to Yueju and ketamine, a single administration of GJ significantly reduced the number of escape failures in the learned helplessness test. Furthermore, GJ decreased latency of food consumption in the novelty suppressed-feeding test. Additionally, starting from 2 hours and continuing for over 20 hours after GJ administration, BDNF expression in the hippocampus was upregulated, temporally linked with the antidepressant response. These findings suggest that GJ has rapid antidepressant effects, which are associated with the elevated expression of BDNF in the hippocampus. In Yueju formula, Yue represents GJ, as thus our study demonstrates the primary role of GJ in rapid antidepressant efficacy of Yueju.
Metallicity and Kinematics of M31's Outer Stellar Halo from a Keck Spectroscopic Survey
Reitzel, David B.; Guhathakurta, Puragra
2002-07-01
We present first results from a spectroscopic survey designed to examine the metallicity and kinematics of individual red giant branch stars in the outer halo of the Andromeda spiral galaxy (M31). This study is based on multislit spectroscopy with the Keck II 10 m telescope and Low Resolution Imaging Spectrograph of the Ca II near-infrared triplet in 99 M31 halo candidates in a field at R=19 kpc on the southeast minor axis with brightnesses from 20intermediate-velocity stars (-160~2 dex range over which the abundance measurement methods are calibrated. The mean/median metallicity of the M31 halo is about =-1.9 to -1.1 dex (depending on the details of metallicity calibration and sample selection) and possibly higher: the high-metallicity end of the distribution is poorly constrained by our data since the selection function for the secure M31 sample excludes over 80% of the giants in solar/supersolar metallicity range. Possible reasons are explored for the apparent discrepancy between the mean [Fe/H] found in our spectroscopic survey (corrected for metallicity selection bias) and the slightly higher mean values found in earlier photometric studies. Field halo red giants in M31 appear to be somewhat more metal-rich on average than their Milky Way counterparts. The M31 halo [Fe/H] distribution is comparable to that of M31 globular clusters, Galactic globular clusters, and Local Group dwarf satellite galaxies. The data in this 19 kpc outer halo field are broadly consistent with a scenario in which the halo is built from the accretion of small stellar subsystems. There are four stars in the secure M31 sample that have particularly strong Ca II lines, indicating solar metallicity, at a common velocity of ~-340 km s-1 close to the galaxy's systemic velocity, similar to what might be expected for M31 disk giants on the minor axis. An extrapolation of the inner disk brightness profile, however, falls far short of accounting for these four stars-the disk would instead have to
Tumor-induced loss of mural Connexin 43 gap junction activity promotes endothelial proliferation
International Nuclear Information System (INIS)
Choudhary, Mayur; Naczki, Christine; Chen, Wenhong; Barlow, Keith D.; Case, L. Douglas; Metheny-Barlow, Linda J.
2015-01-01
Proper functional association between mural cells and endothelial cells (EC) causes EC of blood vessels to become quiescent. Mural cells on tumor vessels exhibit decreased attachment to EC, which allows vessels to be unstable and proliferative. The mechanisms by which tumors prevent proper association between mural cells and EC are not well understood. Since gap junctions (GJ) play an important role in cell-cell contact and communication, we investigated whether loss of GJ plays a role in tumor-induced mural cell dissociation. Mural cell regulation of endothelial proliferation was assessed by direct co-culture assays of fluorescently labeled cells quantified by flow cytometry or plate reader. Gap junction function was assessed by parachute assay. Connexin 43 (Cx43) protein in mural cells exposed to conditioned media from cancer cells was assessed by Western and confocal microscopy; mRNA levels were assessed by quantitative real-time PCR. Expression vectors or siRNA were utilized to overexpress or knock down Cx43. Tumor growth and angiogenesis was assessed in mouse hosts deficient for Cx43. Using parachute dye transfer assay, we demonstrate that media conditioned by MDA-MB-231 breast cancer cells diminishes GJ communication between mural cells (vascular smooth muscle cells, vSMC) and EC. Both protein and mRNA of the GJ component Connexin 43 (Cx43) are downregulated in mural cells by tumor-conditioned media; media from non-tumorigenic MCF10A cells had no effect. Loss of GJ communication by Cx43 siRNA knockdown, treatment with blocking peptide, or exposure to tumor-conditioned media diminishes the ability of mural cells to inhibit EC proliferation in co-culture assays, while overexpression of Cx43 in vSMC restores GJ and endothelial inhibition. Breast tumor cells implanted into mice heterozygous for Cx43 show no changes in tumor growth, but exhibit significantly increased tumor vascularization determined by CD31 staining, along with decreased mural cell support
The novel Candida albicans transporter Dur31 Is a multi-stage pathogenicity factor.
Directory of Open Access Journals (Sweden)
François L Mayer
Full Text Available Candida albicans is the most frequent cause of oral fungal infections. However, the exact pathogenicity mechanisms that this fungus employs are largely unknown and many of the genes expressed during oral infection are uncharacterized. In this study we sought to functionally characterize 12 previously unknown function genes associated with oral candidiasis. We generated homozygous knockout mutants for all 12 genes and analyzed their interaction with human oral epithelium in vitro. Eleven mutants caused significantly less epithelial damage and, of these, deletion of orf19.6656 (DUR31 elicited the strongest reduction in pathogenicity. Interestingly, DUR31 was not only involved in oral epithelial damage, but in multiple stages of candidiasis, including surviving attack by human neutrophils, endothelial damage and virulence in vivo. In silico analysis indicated that DUR31 encodes a sodium/substrate symporter with 13 transmembrane domains and no human homologue. We provide evidence that Dur31 transports histatin 5. This is one of the very first examples of microbial driven import of this highly cytotoxic antimicrobial peptide. Also, in contrast to wild type C. albicans, dur31Δ/Δ was unable to actively increase local environmental pH, suggesting that Dur31 lies in the extracellular alkalinization hyphal auto-induction pathway; and, indeed, DUR31 was required for morphogenesis. In agreement with this observation, dur31Δ/Δ was unable to assimilate the polyamine spermidine.
The Novel Candida albicans Transporter Dur31 Is a Multi-Stage Pathogenicity Factor
Mayer, François L.; Wilson, Duncan; Jacobsen, Ilse D.; Miramón, Pedro; Große, Katharina; Hube, Bernhard
2012-01-01
Candida albicans is the most frequent cause of oral fungal infections. However, the exact pathogenicity mechanisms that this fungus employs are largely unknown and many of the genes expressed during oral infection are uncharacterized. In this study we sought to functionally characterize 12 previously unknown function genes associated with oral candidiasis. We generated homozygous knockout mutants for all 12 genes and analyzed their interaction with human oral epithelium in vitro. Eleven mutants caused significantly less epithelial damage and, of these, deletion of orf19.6656 (DUR31) elicited the strongest reduction in pathogenicity. Interestingly, DUR31 was not only involved in oral epithelial damage, but in multiple stages of candidiasis, including surviving attack by human neutrophils, endothelial damage and virulence in vivo. In silico analysis indicated that DUR31 encodes a sodium/substrate symporter with 13 transmembrane domains and no human homologue. We provide evidence that Dur31 transports histatin 5. This is one of the very first examples of microbial driven import of this highly cytotoxic antimicrobial peptide. Also, in contrast to wild type C. albicans, dur31Δ/Δ was unable to actively increase local environmental pH, suggesting that Dur31 lies in the extracellular alkalinization hyphal auto-induction pathway; and, indeed, DUR31 was required for morphogenesis. In agreement with this observation, dur31Δ/Δ was unable to assimilate the polyamine spermidine. PMID:22438810
Czech Academy of Sciences Publication Activity Database
Jalovecká, M.; Sak, Bohumil; Kváč, Martin; Květoňová, Dana; Kučerová, Z.; Salát, Jiří
2010-01-01
Roč. 106, č. 5 (2010), s. 1159-1166 ISSN 0932-0113 R&D Projects: GA AV ČR KJB500960701 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium muris * T-lymphocyte migration * gastric mucosa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Hanzlíková, D.; Sak, Bohumil; Květoňová, Dana
2009-01-01
Roč. 160, 3/4 (2009), s. 319-322 ISSN 0304-4017 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium infection * age specificity * pigs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.278, year: 2009
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Sak, Bohumil; Hanzlíková, D.; Kotilová, J.; Květoňová, Dana
2009-01-01
Roč. 104, č. 2 (2009), s. 425-428 ISSN 0932-0113 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium spp. * slaughterhouse * pigs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009
Czech Academy of Sciences Publication Activity Database
Ondráčková, Z.; Kváč, Martin; Sak, Bohumil; Květoňová, Dana; Rost, M.
2009-01-01
Roč. 165, 1/2 (2009), s. 141-144 ISSN 0304-4017 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium spp. * cattle * slaughterhouses Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.278, year: 2009
Czech Academy of Sciences Publication Activity Database
Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.
2003-01-01
Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003
Czech Academy of Sciences Publication Activity Database
de Chambrier, A.; Scholz, Tomáš
2012-01-01
Roč. 59, č. 4 (2012), s. 279-286 ISSN 0015-5683 Institutional support: RVO:60077344 Keywords : taxonomy * zoogeography * tapeworms * helminths * Reptilia * South East Asia * Indomalayan Region Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.515, year: 2012 http://folia.paru.cas.cz/detail.php?id=22092
Czech Academy of Sciences Publication Activity Database
Hidalgo-Vila, J.; Martínez-Silvestre, A.; Ribas, Alexis; Casanova, J. C.; Pérez-Santigosa, N.; Díaz-Paniagua, C.
2011-01-01
Roč. 47, č. 1 (2011), s. 201-205 ISSN 0090-3558 Institutional research plan: CEZ:AV0Z60930519 Keywords : helminth * invasive exotic turtles * pancreatitis * reptiles Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.079, year: 2011 http://www.jwildlifedis.org/cgi/reprint/47/1/201
Czech Academy of Sciences Publication Activity Database
Tichá, L.; Golovchenko, Maryna; Oliver, J. H., Jr.; Grubhoffer, Libor; Rudenko, Natalia
2016-01-01
Roč. 16, č. 1 (2016), s. 13-19 ISSN 1530-3667 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : Borrelia burgdorferi sensu lato * Lyme disease * serum complement * exotic animals * reservoir hosts * zoo Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.045, year: 2016
Czech Academy of Sciences Publication Activity Database
Srnec, Martin; Solomon, E. I.
2017-01-01
Roč. 139, č. 6 (2017), s. 2396-2407 ISSN 0002-7863 R&D Projects: GA ČR(CZ) GJ15-10279Y Institutional support: RVO:61388955 Keywords : Chlorination * Chlorine compounds * Free radical reactions Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 13.858, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Fiala, Ivan; Dyková, Iva
2011-01-01
Roč. 56, č. 4 (2011), s. 433-437 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasitic nematode * Dichelyne * freshwater fish * Tetraodon * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.789, year: 2011
Phylogenetic analysis of coccidian parasites from invertebrates: search for missing links
Czech Academy of Sciences Publication Activity Database
Kopečná, Jana; Jirků, Milan; Oborník, Miroslav; Tokarev, Y. S.; Lukeš, Julius; Modrý, David
2006-01-01
Roč. 157, č. 2 (2006), s. 173-183 ISSN 1434-4610 R&D Projects: GA ČR GP524/03/D104 Institutional research plan: CEZ:AV0Z60220518 Keywords : Adelina * Aggregata * molecular phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.262, year: 2006
Czech Academy of Sciences Publication Activity Database
Xi, B. W.; Oros, Mikuláš; Wang, G. T.; Wu, S. G.; Gao, D.; Nie, P.
2009-01-01
Roč. 95, č. 6 (2009), s. 1516-1519 ISSN 0022-3395 R&D Projects: GA ČR GA524/08/0885; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : CESTOIDEA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009
Three nematode species from elasmobranchs off New Caledonia
Czech Academy of Sciences Publication Activity Database
Moravec, František; Justine, J.-L.
2006-01-01
Roč. 64, č. 2 (2006), s. 131-145 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Terranova * Echinocephalus * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.856, year: 2006
The effect of diazinon on haematological indices of common carp (Cyprinus carpio L.)
Czech Academy of Sciences Publication Activity Database
Svoboda, M.; Lusková, Věra; Drastichová, J.; Žlábek, V.
2001-01-01
Roč. 70, č. 4 (2001), s. 457-465 ISSN 0001-7213 Institutional research plan: CEZ:MSM 162700004 Keywords : common carp * acute toxicity * haematology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_457.pdf
Czech Academy of Sciences Publication Activity Database
Kotková, Michaela; Němejc, K.; Sak, Bohumil; Hanzal, V.; Květoňová, Dana; Hlásková, Lenka; Čondlová, Šárka; McEvoy, J.; Kváč, Martin
2016-01-01
Roč. 63, 25 January (2016), č. článku 003. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidiidae * epidemiology * phylogeny * SSU * gp60 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.082, year: 2016
Dependence of the immune response to coccidiosis on the age of rabbit suckling
Czech Academy of Sciences Publication Activity Database
Pakandl, Michal; Hlásková, Lenka; Poplštein, M.; Chromá, V.; Vodička, T.; Salát, Jiří; Mucksová, J.
2008-01-01
Roč. 103, č. 6 (2008), s. 1265-1271 ISSN 0932-0113 R&D Projects: GA ČR GA524/05/2328 Institutional research plan: CEZ:AV0Z60220518 Keywords : suckling rabbits * coccidiosis * immune response Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.473, year: 2008
On the bright side of a forest pest-the metabolic potential of bark beetles' bacterial associates
Czech Academy of Sciences Publication Activity Database
Fabryová, Anna; Kostovčík, Martin; Diez-Mendez, A.; Jimenez-Gomez, A.; Celador-Lera, L.; Saati-Santamaria, Z.; Sechovcová, Hana; Menéndez, E.; Kolařík, Miroslav; García-Fraile, Paula
2018-01-01
Roč. 619, APR 1 2018 (2018), s. 9-17 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GJ16-15293Y Institutional support: RVO:61388971 ; RVO:67985904 Keywords : Lignocellulolytic enzymes * Biomass hydrolysis * Genome sequence Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.900, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Kay, W. R.; Hobbs, R. P.
2004-01-01
Roč. 90, č. 2 (2004), s. 322-326 ISSN 0022-3395 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra * marine fishes Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.439, year: 2004
Czech Academy of Sciences Publication Activity Database
Pauly, M.; Hoppe, E.; Mugisha, L.; Petrželková, Klára Judita; Akoua-Koffi, C.; Couacy-Hymann, E.; Anoh, A. E.; Mossoun, A.; Schubert, G.; Wiersma, L.; Pascale, S.; Muyembe, J.-J.; Karhemere, S.; Weiss, S.; Leendertz, S. A.; Calvignac-Spencer, S.; Leendertz, F. H.; Ehlers, B.
2014-01-01
Roč. 11, č. 25 (2014), s. 25 ISSN 1743-422X R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Adenoviridae * Human adenovirus D * Genotype * Sub-Saharan Africa * PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.181, year: 2014
First report of Enterocytozoon bieneusi infection on a pig farm in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Sak, Bohumil; Kváč, Martin; Hanzlíková, D.; Cama, V.
2008-01-01
Roč. 153, 3/4 (2008), s. 220-224 ISSN 0304-4017 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : Enterocytozoon bieneusi * pigs * microsporidia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.039, year: 2008
Czech Academy of Sciences Publication Activity Database
Mendoza-Franco, Edgar F.; Scholz, Tomáš; Rozkošná, Petra
2010-01-01
Roč. 96, č. 3 (2010), s. 491-498 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : NEOTROPICAL MONOGENEA * ANCYROCEPHALINAE * PROPOSAL * GILLS * TREMATODES * TELEOSTEI Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.208, year: 2010
Czech Academy of Sciences Publication Activity Database
Moravec, František; Shamsi, S.
2017-01-01
Roč. 94, č. 6 (2017), s. 627-634 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : yamaguti * fishes * coast Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.181, year: 2016
Cryptosporidium erinacei n. sp. (Apicomplexa: Cryptosporidiidae) in hedgehogs
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Hofmannová, L.; Hlásková, Lenka; Květoňová, Dana; Vitovec, J.; McEvoy, J.; Sak, Bohumil
2014-01-01
Roč. 201, 1-2 (2014), s. 9-17 ISSN 0304-4017 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : Cryptosporidium erinacei * taxonomy * morphology * molecular analyses * transmission studies * Cryptosporidium hedgehog genotype Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.460, year: 2014
Diphyllobothrium nihonkaiense Tapeworm Larvae in Salmon from North America
Czech Academy of Sciences Publication Activity Database
Kuchta, Roman; Oros, M.; Ferguson, J.; Scholz, Tomáš
2017-01-01
Roč. 23, č. 2 (2017), s. 351-353 ISSN 1080-6040 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Alaska * Diphyllobothrium * human * larva * nonhuman * Oncorhynchus * seashore Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Parasitology Impact factor: 8.222, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František
2003-01-01
Roč. 50, č. 4 (2003), s. 296-304 ISSN 0015-5683 R&D Projects: GA ČR GA524/00/0267 Institutional research plan: CEZ:AV0Z6022909 Keywords : Atlantic salmon * helminths * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.469, year: 2003
Misclassification in binary choice models
Czech Academy of Sciences Publication Activity Database
Meyer, B. D.; Mittag, Nikolas
2017-01-01
Roč. 200, č. 2 (2017), s. 295-311 ISSN 0304-4076 R&D Projects: GA ČR(CZ) GJ16-07603Y Institutional support: Progres-Q24 Keywords : measurement error * binary choice models * program take-up Subject RIV: AH - Economics OBOR OECD: Economic Theory Impact factor: 1.633, year: 2016
Avian botulism at a sugar beet processing plant in South Moravia (Czech Republic)
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk; Škorpíková, V.; Horal, D.
2005-01-01
Roč. 50, č. 10 (2005), s. 443-445 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z60930519 Keywords : Clostridium botulinum * free-living birds Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.621, year: 2005 http://www.vri.cz/docs/vetmed/50-10-443.pdf
Czech Academy of Sciences Publication Activity Database
Moravec, František; Gibson, D. I.
2007-01-01
Roč. 44, č. 3 (2007), s. 118-119 ISSN 0440-6605 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Python * Dracunculus * Papua New Guinea Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.373, year: 2007
Czech Academy of Sciences Publication Activity Database
Kučera, R.; Černá, M.; Ňaršanská, A.; Svobodová, Š.; Straková, M.; Vrzalová, J.; Fuchsová, R.; Třešková, I.; Kydlíček, T.; Třeška, V.; Pecen, Ladislav; Topolčan, O.; Padziora, P.
2011-01-01
Roč. 31, č. 12 (2011), s. 4653-4656 ISSN 0250-7005 Grant - others:GA MZd(CZ) NS9727; GA MZd(CZ) NS10238; GA MZd(CZ) NS10253 Institutional research plan: CEZ:AV0Z10300504 Keywords : growth factor * breast cancer * tumor markers * CA 15-3 * CEA * IGF1 * EGF * HGF Subject RIV: FD - Oncology ; Hematology Impact factor: 1.725, year: 2011
Gelfand, Ilya; Snapp, Sieglinde S; Robertson, G Philip
2010-05-15
The prospect of biofuel production on a large scale has focused attention on energy efficiencies associated with different agricultural systems and production goals. We used 17 years of detailed data on agricultural practices and yields to calculate an energy balance for different cropping systems under both food and fuel scenarios. We compared four grain and one forage systems in the U.S. Midwest: corn (Zea mays) - soybean (Glycine max) - wheat (Triticum aestivum) rotations managed with (1) conventional tillage, (2) no till, (3) low chemical input, and (4) biologically based (organic) practices, and (5) continuous alfalfa (Medicago sativa). We compared energy balances under two scenarios: all harvestable biomass used for food versus all harvestable biomass used for biofuel production. Among the annual grain crops, average energy costs of farming for the different systems ranged from 4.8 GJ ha(-1) y(-1) for the organic system to 7.1 GJ ha(-1) y(-1) for the conventional; the no-till system was also low at 4.9 GJ ha(-1) y(-1) and the low-chemical input system intermediate (5.2 GJ ha(-1) y(-1)). For each system, the average energy output for food was always greater than that for fuel. Overall energy efficiencies ranged from output:input ratios of 10 to 16 for conventional and no-till food production and from 7 to 11 for conventional and no-till fuel production, respectively. Alfalfa for fuel production had an efficiency similar to that of no-till grain production for fuel. Our analysis points to a more energetically efficient use of cropland for food than for fuel production and large differences in efficiencies attributable to management, which suggests multiple opportunities for improvement.
Suppression of low-energy dissociative electron attachment in Fe(CO)5 upon clustering
Czech Academy of Sciences Publication Activity Database
Lengyel, Jozef; Papp, P.; Matejčík, Š.; Kočišek, Jaroslav; Fárník, Michal; Fedor, Juraj
2017-01-01
Roč. 8, č. 1 (2017), s. 2200-2207 ISSN 2190-4286 R&D Projects: GA ČR GA17-04844S; GA ČR(CZ) GA17-04068S; GA ČR GJ16-10995Y Grant - others:COST(XE) CM1301 Institutional support: RVO:61388955 Keywords : aggregation effects * FEBID * dissociative electron attachment Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.127, year: 2016
Detection of Sugars via Chirality Induced in Europium(III) Compounds
Czech Academy of Sciences Publication Activity Database
Wu, Tao; Průša, Jiří; Kessler, Jiří; Dračínský, Martin; Valenta, J.; Bouř, Petr
2016-01-01
Roč. 88, č. 17 (2016), s. 8878-8885 ISSN 0003-2700 R&D Projects: GA ČR(CZ) GA16-05935S; GA ČR(CZ) GJ16-08764Y; GA ČR GA15-11223S; GA ČR GA15-09072S Institutional support: RVO:61388963 Keywords : Raman optical activity * molecular dynamics simulations * D-3 lanthanide(III) complexes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.320, year: 2016
African Journals Online (AJOL)
Chloride was determined using Volhard's method. [9] and nitrate using the Brucine method [10]. Total phosphate .... "Meu MTN 31 MARTIN MATH DIMANA. M 1. Fig. 7. ..... B.K. Shephard, A.W. Mcintosh, G.J. Atchison and D.W. Nelson, Water.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Plant pests. 12.31 Section 12.31 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Wild Animals, Birds, and Insects § 12.31 Plant pests. The importation in a...
Umbilical artery doppler abnormalities and associated factors in ...
African Journals Online (AJOL)
Critically ill patients and those in active phase of labour or premature rupture of membranes were excluded. Results: The overall prevalence of UA Doppler abnormalities was 31.6%. High RI, high S/D ratio, AEDV and RF were found in 25.8%, 31.6%, 7.7% and 4.5% of the population respectively. Key factors associated with ...
Energy analysis of various grassland utilisation systems
Directory of Open Access Journals (Sweden)
Jozef Ržonca
2005-01-01
Full Text Available In 2003 and 2004 was carried out the energy analysis of the different types of permanent grassland utilization on the Hrubý Jeseník locality. There were estimated values of the particular entrances of additional energy. Energy entrances moved according to the pratotechnologies from 2.17 GJ. ha–1 to 22.70 GJ.ha–1. The biggest share on energy entrances had fertilizers. It was 84.93% by the nitrogen fertilisation. The most energy benefit of brutto and nettoenergy was marked by the low intensive utilisation (33.40 GJ.ha–1 NEL and 32.40 GJ.ha–1 NEV on average. The highest value of energy efficiency (13.23% was marked by the low intensive utilization of permanent grassland. By using of higher doses of industrial fertilizers has energy efficiency decreased. From view of energy benefit and intensiveness on energy entrances it appears the most available utilisation of permanent grassland with three cuts per year (first cut on May 31st at the latest, every next after 60 days or two cuts per year (first cut on July 15th, next cuts after 90 days.
Czech Academy of Sciences Publication Activity Database
Gomez, A.; Petrželková, Klára Judita; Yeoman, C. J.; Vlčková, K.; Mrázek, Jakub; Koppová, Ingrid; Carbonero, F.; Ulanov, A.; Modrý, D.; Todd, A.; Torralba, M.; Nelson, K.; Gaskins, H. R.; Wilson, B.; Stumpf, R. M.; White, B. A.; Leigh, S. R.
2015-01-01
Roč. 24, č. 10 (2015), s. 2551-2565 ISSN 0962-1083 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : western lowland gorillas * microbiome * metabolomics * foraging ecology * anthropogenic interactions Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 5.947, year: 2015
Czech Academy of Sciences Publication Activity Database
Ježková, Jana; Horčičková, Michaela; Hlásková, Lenka; Sak, Bohumil; Květoňová, Dana; Novák, J.; Hofmannová, L.; McEvoy, J.; Kváč, Martin
2016-01-01
Roč. 63, October 14 (2016), č. článku 035. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : morphology * transmission studies * taxonomy * new species * molecular phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.082, year: 2016
Czech Academy of Sciences Publication Activity Database
Marigo, A. M.; Levron, Céline; Bâ, Ch. T.; Miquel, J.
2012-01-01
Roč. 251, č. 2 (2012), s. 147-159 ISSN 0044-5231 R&D Projects: GA AV ČR KJB600960813 Institutional research plan: CEZ:AV0Z60220518 Keywords : Spermiogenesis * Spermatozoon * Ultrastructure * Barsonella lafoni * Proteocephalinae * Proteocephalidae * Proteocephalidea * Cestoda Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.400, year: 2012
Czech Academy of Sciences Publication Activity Database
Kvach, Yuriy; Bryjová, A.; Sasal, P.; Winkler, H. M.
2017-01-01
Roč. 116, č. 7 (2017), s. 1973-1980 ISSN 0932-0113 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Aphalloides * Taxonomic revision * Zoogeography * Molecular study Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 2.329, year: 2016
Accurate DFT-D3 Calculations in a Small Basis Set
Czech Academy of Sciences Publication Activity Database
Hostaš, Jiří; Řezáč, Jan
2017-01-01
Roč. 13, č. 8 (2017), s. 3575-3585 ISSN 1549-9618 R&D Projects: GA ČR(CZ) GJ16-11321Y Institutional support: RVO:61388963 Keywords : density functional theory * molecular orbital methods * quantum chemical methods Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016
Czech Academy of Sciences Publication Activity Database
Vávra, Jiří; Becnel, J. J.
2007-01-01
Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007
Czech Academy of Sciences Publication Activity Database
Sedlák, Robert; Řezáč, Jan
2017-01-01
Roč. 13, č. 4 (2017), s. 1638-1646 ISSN 1549-9618 R&D Projects: GA ČR(CZ) GJ16-11321Y Institutional support: RVO:61388963 Keywords : intermolecular interaction energies * der Waals interactions * basis set convergence Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016
Czech Academy of Sciences Publication Activity Database
Feng, Y.; Yang, W.; Ryan, U. M.; Zhang, L.; Kváč, Martin; Koudela, Břetislav; Modrý, David; Li, N.; Fayer, R.; Xiao, L.
2011-01-01
Roč. 49, č. 1 (2011), s. 34-41 ISSN 0095-1137 Institutional research plan: CEZ:AV0Z60220518 Keywords : ASTERN UNITED-STATES * RIBOSOMAL-RNA GENE * PHYLOGENETIC ANALYSIS * MOLECULAR ANALYSIS * NATURAL INFECTION * DAIRY- CATTLE * PREVALENCE * GENOTYPES * HUMANS * KENYA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.153, year: 2011
Czech Academy of Sciences Publication Activity Database
González-Solís, David; Mariaux, J.
2017-01-01
Roč. 124, č. 1 (2017), s. 1-8 ISSN 0035-418X R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : new species * nematode * Brycinus * Xenocharax Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 0.380, year: 2016
Czech Academy of Sciences Publication Activity Database
Wijová, Martina; Moravec, František; Horák, Aleš; Lukeš, Julius
2006-01-01
Roč. 36, č. 9 (2006), s. 1067-1075 ISSN 0020-7519 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Nematoda * Spirurina * SSU rRNA gene sequences Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.337, year: 2006
Czech Academy of Sciences Publication Activity Database
Široký, P.; Kubelová, M.; Modrý, David; Erhart, Jan; Literák, I.; Špitálská, E.; Kocianová, E.
2010-01-01
Roč. 107, č. 6 (2010), s. 1515-1520 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : BURGDORFERI SENSU-LATO * SOUTH-KANARA DISTRICT * COWDRIA-RUMINANTIUM * BACTERIAL DISEASES * ESTUDO-GRAECA * UTTAR-PRADESH * SLOVAKIA * POIKILOTHERMS * RICKETTSIAE * HEARTWATER Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010
The effect of diazinon on blood plasma biochemistry in carp (Cyprinus carpio L.)
Czech Academy of Sciences Publication Activity Database
Lusková, Věra; Svoboda, M.; Kolářová, J.
Roc. 71, č. 1 (2002), s. 117-123 ISSN 0001-7213 Institutional research plan: CEZ:AV0Z6093917 Keywords : common carp * acute toxicity * haematology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.370, year: 2002 http://vfu-www.vfu.cz/acta-vet/vol71/pdf/71_117.pdf
Czech Academy of Sciences Publication Activity Database
Moravec, František; Justine, J.-L.
2014-01-01
Roč. 21, MAY 19 2014 (2014), s. 21 ISSN 1252-607X R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * Marine fish * Alepes * Epinephelus * Selar * New Caledonia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.092, year: 2014
Cryptosporidium Pig Genotype II in Immunocompetent Man
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Květoňová, Dana; Sak, Bohumil; Ditrich, Oleg
2009-01-01
Roč. 15, č. 6 (2009), s. 982-983 ISSN 1080-6040 R&D Projects: GA ČR GP523/07/P117 Institutional research plan: CEZ:AV0Z60220518 Keywords : immunocompetent patients * cryptosporidiosis * Cryptosporidium pig genotype II Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 6.794, year: 2009
Czech Academy of Sciences Publication Activity Database
Simoes, S. B. E.; Scholz, Tomáš; Barbosa, H. S.; Santos, C. P.
2006-01-01
Roč. 92, č. 3 (2006), s. 501-508 ISSN 0022-3395 R&D Projects: GA AV ČR IAA6022404; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Digenea * Heterophyidae * taxonomy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.300, year: 2006
Czech Academy of Sciences Publication Activity Database
Caira, J. N.; Kuchta, Roman; Desjardins, L.
2010-01-01
Roč. 96, č. 6 (2010), s. 1185-1190 ISSN 0022-3395 R&D Projects: GA AV ČR KJB600960902; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Taiwan * catshark * Trypanorhyncha Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.208, year: 2010
Thermoresponsive polymer nanoparticles co-deliver RSV F trimers with a TLR-7/8 adjuvant
Czech Academy of Sciences Publication Activity Database
Francica, J. R.; Lynn, G. M.; Laga, Richard; Joyce, M. G.; Ruckwardt, T. J.; Morabito, K. M.; Chen, M.; Chaudhuri, R.; Zhang, B.; Sastry, M.; Druz, A.; Ko, K.; Choe, M.; Pechar, Michal; Georgiev, I. S.; Kueltzo, L. A.; Seymour, L. W.; Mascola, J. R.; Kwong, P. D.; Graham, B. S.; Seder, R. A.
2016-01-01
Roč. 27, č. 10 (2016), s. 2372-2385 ISSN 1043-1802 R&D Projects: GA ČR(CZ) GJ16-14957Y; GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : thermoresponsive polymers * polymer vaccines * toll-like receptor agonists Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.818, year: 2016
Empirical Self-Consistent Correction for the Description of Hydrogen Bonds in DFTB3
Czech Academy of Sciences Publication Activity Database
Řezáč, Jan
2017-01-01
Roč. 13, č. 10 (2017), s. 4804-4817 ISSN 1549-9618 R&D Projects: GA ČR(CZ) GJ16-11321Y Institutional support: RVO:61388963 Keywords : density functional theory * tight-binding method * including dispersion corrections Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.245, year: 2016
Czech Academy of Sciences Publication Activity Database
Alama-Bermejo, G.; Raga, J. A.; Holzer, Astrid S.
2011-01-01
Roč. 182, 2/4 (2011), s. 181-192 ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60220518 Keywords : Myxozoa * Ceratomyxa puntazzi * Diplodus puntazzo * Sparus aurata and Diplodus annularis * Histopathology * SSU rDNA phylogeny * Transmission electron microscopy Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.579, year: 2011
Comparative Ultrastructure of Langerhans-Like Cells in Spleens of Ray-Finned Fishes (Actinopterygii)
Czech Academy of Sciences Publication Activity Database
Lovy, J.; Wright, G. M.; Speare, D. J.; Tyml, Tomáš; Dyková, Iva
2010-01-01
Roč. 271, č. 10 (2010), s. 1229-1239 ISSN 0362-2525 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish * cyprinidae * halibut * dendritic cells * Langerhans cell * Birbeck granules * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.773, year: 2010
Czech Academy of Sciences Publication Activity Database
Kvach, Yuriy; Kutsokon, Y.; Stepien, C. A.; Markovych, M.
2016-01-01
Roč. 71, č. 8 (2016), s. 941-951 ISSN 0006-3088 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Chinese sleeper * enemy release hypothesis * invasive species * parasites * Perccottus glenii Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.759, year: 2016
Czech Academy of Sciences Publication Activity Database
Mendoza-Franco, Edgar F.; Scholz, Tomáš
2009-01-01
Roč. 95, č. 4 (2009), s. 865-870 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Monogenea * taxonomy * fish * Neotropical Region * Ancyrocephalinae * redescriptions * Auchenipteridae * Pimelodidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009
Czech Academy of Sciences Publication Activity Database
Drabinová, Adéla; Martinková, Patrícia
2017-01-01
Roč. 54, č. 4 (2017), s. 498-517 ISSN 0022-0655 R&D Projects: GA ČR GJ15-15856Y Institutional support: RVO:67985807 Keywords : differential item functioning * non-linear regression * logistic regression * item response theory Subject RIV: AM - Education OBOR OECD: Statistics and probability Impact factor: 0.979, year: 2016
Czech Academy of Sciences Publication Activity Database
Filek, M.; Rudolphi-Skórska, E.; Sieprawska, A.; Kvasnica, Miroslav; Janeczko, A.
2017-01-01
Roč. 128, DEC (2017), s. 37-45 ISSN 0039-128X R&D Projects: GA ČR GJ15-08202Y Institutional support: RVO:61389030 Keywords : 24-Epibrassinolide * 24-Epicastasterone * Galactolipids * Phospholipids * Progesterone * Seedlings * Winter wheat Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 2.282, year: 2016
Czech Academy of Sciences Publication Activity Database
Turner, G. G.; Meteyer, C. U.; Barton, H.; Gumbs, J. F.; Reeder, D. M.; Overton, B.; Banďouchová, H.; Bartonička, T.; Martínková, Natália; Pikula, J.; Zukal, Jan; Blehert, D. S.
2014-01-01
Roč. 50, č. 3 (2014), s. 566-573 ISSN 0090-3558 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:68081766 Keywords : bats * Chiroptera * dermatomycosis * fungal infection * ultraviolet (UV) fluorescence * white-nose syndrome Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.355, year: 2014
Czech Academy of Sciences Publication Activity Database
Pakandl, Michal; Sewald, B.; Drouet-Viard, F.
2006-01-01
Roč. 98, č. 4 (2006), s. 310-316 ISSN 0932-0113 R&D Projects: GA ČR GA524/05/2328 Institutional research plan: CEZ:AV0Z60220518 Keywords : rabbit coccidia * sporozoites * intra- and extraintestinal migration Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.140, year: 2006
Czech Academy of Sciences Publication Activity Database
Justine, J.-L.; Beveridge, I.; Boxshall, G.A.; Bray, R. A.; Moravec, František; Whittington, I.D.
2010-01-01
Roč. 2691, - (2010), s. 1-40 ISSN 1175-5326 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish * new host records * new geographical records * inventory * biogeography * South Pacific Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.853, year: 2010
Czech Academy of Sciences Publication Activity Database
Blasco-Costa, I.; Balbuena, J. A.; Raga, J. A.; Kostadinova, Aneta; Olson, P. D.
2010-01-01
Roč. 137, č. 2 (2010), s. 287-302 ISSN 0031-1820 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Digenea * Haploporidae * Saccocoelium * Mugilidae * cryptic species * molecules * morphology * rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.522, year: 2010
Shocks in the relativistic transonic accretion with low angular momentum
Czech Academy of Sciences Publication Activity Database
Suková, Petra; Charzynski, S.; Janiuk, A.
2017-01-01
Roč. 472, č. 4 (2017), s. 4327-4342 ISSN 0035-8711 R&D Projects: GA ČR(CZ) GJ17-06962Y Institutional support: RVO:67985815 Keywords : accretion discs * hydrodynamics * shock waves Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016
Ultra-rapid auxin metabolite profiling for high-throughput mutant screening in Arabidopsis
Czech Academy of Sciences Publication Activity Database
Pěnčík, Aleš; Casanova-Sáez, R.; Pilařová, V.; Žukauskaitė, Asta; Pinto, R.; Micol, J.L.; Ljung, K.; Novák, Ondřej
2018-01-01
Roč. 69, č. 10 (2018), s. 2569-2579 ISSN 0022-0957 R&D Projects: GA ČR(CZ) GJ17-21581Y Institutional support: RVO:61389030 Keywords : Arabidopsis thaliana * auxin * metabolite profiling * multivariate data analysis * mutant * screening Subject RIV: ED - Physiology OBOR OECD: Plant sciences, botany Impact factor: 5.830, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Jirků, Miloslav; Charo-Karisa, H.; Mašová, Š.
2009-01-01
Roč. 105, č. 4 (2009), s. 1047-1052 ISSN 0932-0113 R&D Projects: GA MŠk LC522; GA AV ČR KJB600960813 Institutional research plan: CEZ:AV0Z60220518 Keywords : Mexiconema * Auchenoglanis * Kenya Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.721, year: 2009
Warner, E. S.; Zhang, Y.; Newmark, R. L.
2012-12-01
average sugarcane ethanol system producing ethanol and electricity can save about 13 Mg CO2eq/ha of land compared to 12 in the early 2000s, while a recent average corn ethanol system saves about 6.2 Mg CO2eq/ha compared to near zero GHG savings in the early 2000s. The net energy balance (i.e., energy produced minus energy consumed) per ha for a recent average sugarcane ethanol system producing both ethanol and electricity is about 160 GJ/ha compared to 140 GJ/ha in early 2000s, while the recent average corn ethanol system achieves a net energy production of about 90 GJ/ha compares to only 30 GJ/ha in the early 2000s. The land use efficiency of corn and sugarcane ethanol systems, especially future systems, can vary depending on factors such as the assumed technologies, the suite of co-products produced, field practices, and technological learning. For example, projected future (2020) advanced sugarcane ethanol systems could save 22 Mg CO2eq/ha while an advanced corn ethanol system using integrated gasification of corn stover for electricity production could save 9.3Mg CO2eq/ha. Future advanced sugarcane ethanol systems could produce 210 GJ of net energy/ha while an advanced corn ethanol system using integrated gasification of corn stover for electricity production could achieve 110 GJ/ha.
Kobuviral Non-structural 3A Proteins Act as Molecular Harnesses to Hijack the Host ACBD3 Protein
Czech Academy of Sciences Publication Activity Database
Klíma, Martin; Chalupská, Dominika; Rozycki, B.; Humpolíčková, Jana; Řežábková, L.; Šilhán, Jan; Bäumlová, Adriana; Dubánková, Anna; Bouřa, Evžen
2017-01-01
Roč. 25, č. 2 (2017), s. 219-230 ISSN 0969-2126 R&D Projects: GA ČR(CZ) GJ17-07058Y Institutional support: RVO:61388963 Keywords : RNA replication * poliovirus 3A * Aichi virus Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.945, year: 2016 https://www.sciencedirect.com/science/article/pii/S096921261630363X?via%3Dihub
A MRCC study of the isomerisation of cyclopropane
Czech Academy of Sciences Publication Activity Database
Lang, Jakub; Švaňa, Matěj; Demel, Ondřej; Brabec, Jiří; Kedžuch, S.; Noga, J.; Kowalski, K.; Pittner, Jiří
2017-01-01
Roč. 115, č. 21-22 (2017), s. 2743-2754 ISSN 0026-8976 R&D Projects: GA ČR GJ15-00058Y; GA ČR GA16-12052S Grant - others:Ga MŠk(CZ) LM2015070 Institutional support: RVO:61388955 Keywords : Coupled cluster * LPNO, trimethylene * universal state selective * multireference Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.870, year: 2016
Czech Academy of Sciences Publication Activity Database
Georgieva, Simona; Kostadinova, Aneta; Skirnisson, K.
2012-01-01
Roč. 82, č. 3 (2012), s. 177-183 ISSN 0165-5752 R&D Project s: GA ČR GAP505/10/1562; GA ČR GD206/09/H026 Institutional support: RVO:60077344 Keywords : TREMATODA * GENES * DNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.260, year: 2012 http://link.springer.com/content/pdf/10.1007%2Fs11230-012-9354-y
Czech Academy of Sciences Publication Activity Database
Hengster-Movric, K.; Šebek, M.; Čelikovský, Sergej
2016-01-01
Roč. 353, č. 14 (2016), s. 3457-3486 ISSN 0016-0032 R&D Projects: GA ČR GA13-20433S Grant - others:GA ČR(CZ) GJ16-25493Y Institutional support: RVO:67985556 Keywords : Multi-agent nonlinear systems * structured Lyapunov functions Subject RIV: BC - Control Systems Theory Impact factor: 3.139, year: 2016 http://library.utia.cas.cz/separaty/2016/TR/celikovsky-0462691.pdf
Natural infection with two genotypes of Cryptosporidium in red squirrels (Sciurus vulgaris) in Italy
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Hofmannová, L.; Bertolino, S.; Wauters, L.; Tosi, G.; Modrý, David
2008-01-01
Roč. 55, č. 2 (2008), s. 95-99 ISSN 0015-5683 R&D Projects: GA ČR GP523/07/P117; GA ČR GA524/05/0992 Institutional research plan: CEZ:AV0Z60220518 Keywords : Cryptosporidium * Sciurus vulgaris * 18S rRNA * oocyst morphology * infectivity * red squirrel Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.307, year: 2008
Phosphatidylinositol 4-kinases: Function, structure, and inhibition
Czech Academy of Sciences Publication Activity Database
Bouřa, Evžen; Nencka, Radim
2015-01-01
Roč. 337, č. 2 (2015), s. 136-145 ISSN 0014-4827 R&D Projects: GA ČR GJ15-21030Y; GA MŠk LO1302; GA ČR GA15-09310S EU Projects: European Commission(XE) 333916 - STARPI4K Institutional support: RVO:61388963 Keywords : phosphatidylinositol 4-kinase * inhibitor * crystal structure * virus Subject RIV: CC - Organic Chemistry Impact factor: 3.378, year: 2015
Czech Academy of Sciences Publication Activity Database
Míčová, P.; Klevstig, Martina; Holzerová, Kristýna; Vecka, M.; Žurmanová, J.; Neckář, Jan; Kolář, František; Nováková, Olga; Novotný, J.; Hlaváčková, Markéta
2017-01-01
Roč. 95, č. 8 (2017), s. 920-927 ISSN 0008-4212 R&D Projects: GA ČR(CZ) GJ16-12420Y; GA ČR(CZ) GA13-10267S Institutional support: RVO:67985823 Keywords : heart * chronic intermittent hypoxia * oxidative stress * phospholipases A(2) * tempol Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery OBOR OECD: Biochemistry and molecular biology Impact factor: 1.822, year: 2016
Areva as of December 31, 2011; Areva au 31 decembre 2011
Energy Technology Data Exchange (ETDEWEB)
Marie, Patricia; Briand, Pauline; Michaut, Maxime; Scorbiac, Marie de; Repaire, Philippine du
2012-01-26
In 2011, AREVA's consolidated revenue came to 8.872 billion euros, down slightly (-2.6%) compared with 2010 (-1.2% like for like). The decrease in revenue in nuclear operations was partially offset by significant growth in the renewable energies business. Foreign exchange and changes in the scope of consolidation had respectively a negative impact of 113 million euros and 16 million euros over the period. Revenue totaled 2.922 billion euros in the fourth quarter of 2011, stable compared with the fourth quarter of 2010 (-0.5% on a reported basis and -0.5% like for like). Foreign exchange had a negligible impact during the period. Led by nuclear operations, the group's backlog was 45.6 billion euros at December 31, 2011, up 3.1% year on year and 6.7% in relation to September 30, 2011. Order cancellations since Fukushima were limited to 464 million euros as of December 31, 2011. In accordance with the requirements of IFRS 8, AREVA's business segment information is presented for each operating Business Group (BG), which is the level of information examined by the group's governance bodies. Subsequent to the establishment of a subsidiary combining all of the group's mining operations, data for the Mining Business Group are now reported separately from those of the Front End Business Group. Data used for comparisons with 2010 were restated to reflect this new organization. The business segment information therefore corresponds to AREVA's five operating Business Groups: Mining, Front End, Reactors and Services, Back End and Renewable Energies
Factors that influencing veterinary drug’s metabolisation
Directory of Open Access Journals (Sweden)
Cristina, Romeo T.
2007-12-01
Full Text Available The paper wants to make a recall for the vet practitioners, of the main veterinary drug's metabolism rate influencing factors. Among the most important physiological factors (pharmacokinetics, sanguine flow and urinary ones, plasmatic proteins binding, enzymatic induction and inhibition are essential. Between the animal’s bounded factors more important are: species, individuality, age, sex, pregnancy, alimentation, genetic factors, and health status and from exogenous factors, daily rhythm, influences of chemical compounds and of the stress are presented.
Wilson's disease: {sup 31}P and {sup 1}H MR spectroscopy and clinical correlation
Energy Technology Data Exchange (ETDEWEB)
Sinha, Sanjib; Taly, A.B.; Prashanth, L.K. [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neurology, Bangalore (India); Ravishankar, S.; Vasudev, M.K. [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neuroimaging and Interventional Radiology, Bangalore (India)
2010-11-15
Proton ({sup 1}H) magnetic resonance spectroscopy (MRS) changes are noted in Wilson's disease (WD). However, there are no studies regarding membrane phospholipid abnormality using {sup 31}P MRS in these patients. We aimed to analyze the striatal spectroscopic abnormalities using {sup 31}P and {sup 1}H MRS in WD. Forty patients of WD (treated, 29; untreated,11) and 30 controls underwent routine MR image sequences and in vivo 2-D {sup 31}P and {sup 1}H MRS of basal ganglia using an image-selected technique on a 1.5-T MRI scanner. Statistical analysis was done using Student's t test. The mean durations of illness and treatment were 6.2 {+-} 7.4 and 4.8 {+-} 5.9 years, respectively. MRI images were abnormal in all the patients. {sup 1}H MRS revealed statistically significant reduction of N-acetyl aspartate (NAA)/choline (Cho) and NAA/creatine ratios in striatum ({sup 1}H MRS) of treated patients compared to controls. The mean values of phosphomonoesters (PME) (p < 0.0001), phosphodiesters (PDE) (p < 0.0001), and total phosphorus (TPh) (p < 0.0001) were elevated in patients compared to controls. Statistically significant elevated levels of ratio of PME/PDE (p = 0.05) observed in the striatum were noted in treated patients as compared to controls in the {sup 31}P MRS study. The duration of illness correlated well with increased PME/PDE [p < 0.001], PME/TPh [p < 0.05], and PDE/TPh [p < 0.05] and decreased NAA/Cho [p < 0.05] ratios. There was correlation of MRI score and reduced NAA/Cho ratio with disease severity. The PME/PDE ratio (right) was elevated in the treated group [p < 0.001] compared to untreated group. There is reduced breakdown and/or increased synthesis of membrane phospholipids and increased neuronal damage in basal ganglia in patients with WD. (orig.)
Cryptosporidium meleagridis and C. baileyi (Apicomplexa) in domestic and wild birds in Algeria
Czech Academy of Sciences Publication Activity Database
Laatamna, A.E.; Holubová, Nikola; Sak, Bohumil; Kváč, Martin
2017-01-01
Roč. 64, JUN 13 (2017), č. článku 018. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : avian cryptosporidia * pcr * epidemiology * Northern Africa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.082, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Santos, C. P.
2009-01-01
Roč. 95, č. 3 (2009), s. 634-638 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Pseudoproleptus * Macrobrachium * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009
Czech Academy of Sciences Publication Activity Database
Moravec, František; Muzzall, P.
2009-01-01
Roč. 95, č. 4 (2009), s. 987-990 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Freitascapillaria * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009
Spermiogenesis in the proteocephalidean cestode Proteocephalus torulosus (Batsch, 1786)
Czech Academy of Sciences Publication Activity Database
Bruňanská, Magdaléna; Nebesářová, Jana; Scholz, Tomáš
2003-01-01
Roč. 90, č. 4 (2003), s. 318-324 ISSN 0932-0113 R&D Projects: GA ČR GA524/01/1314; GA ČR GA206/03/1317 Institutional research plan: CEZ:AV0Z6022909 Keywords : cestoda * spermiogenesis * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2003
Czech Academy of Sciences Publication Activity Database
Pérez-i-García, D.; Constenla, M.; Carrasson, M.; Montero, F. E.; Soler-Membrives, A.; González-Solís, David
2015-01-01
Roč. 64, č. 5 (2015), s. 345-352 ISSN 1383-5769 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Raphidascaris (Raphidascaris) macrouri * deep-water * Macrouridae * Nezumia aequalis * Trachyrincus scabrus * Spain Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.860, year: 2015
Czech Academy of Sciences Publication Activity Database
Rudenko, Natalia; Golovchenko, Maryna; Cihlářová, Věra; Grubhoffer, Libor
2004-01-01
Roč. 48, č. 3 (2004), s. 167-171 ISSN 0001-723X R&D Projects: GA ČR GA524/03/1326 Institutional research plan: CEZ:AV0Z6022909 Keywords : Ixodes ricinus * tick-borne encephalitis virus * RT-PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.605, year: 2004
Czech Academy of Sciences Publication Activity Database
Moravec, František; Muzzall, P.
2007-01-01
Roč. 52, č. 1 (2007), s. 51-57 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.814, year: 2007
The amphibians of Mount Oku, Cameroon: an updated species inventory and conservation review
Czech Academy of Sciences Publication Activity Database
Doherty-Bone, T. M.; Gvoždík, Václav
2017-01-01
Roč. 643, č. 643 (2017), s. 109-139 ISSN 1313-2989 R&D Projects: GA ČR GJ15-13415Y Institutional support: RVO:68081766 Keywords : Biodiversity * caecilians * Cameroon Volcanic Line * Central Africa * frogs * Lake Oku * montane forests and grasslands Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.031, year: 2016
Two new species of philometrids (Nematoda: Philometridae) from marine fishes off South Carolina
Czech Academy of Sciences Publication Activity Database
Moravec, František; de Buron, I.
2009-01-01
Roč. 95, č. 3 (2009), s. 722-727 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Philometroides * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009
Czech Academy of Sciences Publication Activity Database
Dyková, Iva; Hrubá, L.; Kostka, Martin; Pecková, Hana
2009-01-01
Roč. 48, č. 4 (2009), s. 321-327 ISSN 0065-1583 R&D Projects: GA ČR GA524/09/0137; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Filamoeba sp. * intracellular * Legionella sp. Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.775, year: 2009
On integrability of certain rank 2 sub-Riemannian structures
Czech Academy of Sciences Publication Activity Database
Kruglikov, B.S.; Vollmer, A.; Lukes-Gerakopoulos, Georgios
2017-01-01
Roč. 22, č. 5 (2017), s. 502-519 ISSN 1560-3547 R&D Projects: GA ČR(CZ) GJ17-06962Y Institutional support: RVO:67985815 Keywords : sub-Riemannian geodesic flow * Killing tensor * integral Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 1.562, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František; Laoprasert, T.
2008-01-01
Roč. 71, č. 1 (2008), s. 137-143 ISSN 0165-5752 R&D Projects: GA MŠk LC522; GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ichthyouris * Symphysodon * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.927, year: 2008
Czech Academy of Sciences Publication Activity Database
Moravec, František; Taraschewski, H.; Thairungroj Anantaphruti, M.; Maipanich, W.; Laoprasert, T.
2007-01-01
Roč. 66, č. 1 (2007), s. 73-80 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Heliconema * Pisodonophis * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.125, year: 2007
Stray cats are more frequently infected with zoonotic protists than pet cats
Czech Academy of Sciences Publication Activity Database
Kváč, Martin; Hofmannová, L.; Ortega, Y.; Holubová, Nikola; Horčičková, Michaela; Kicia, M.; Hlásková, Lenka; Květoňová, Dana; Sak, Bohumil; McEvoy, J.
2017-01-01
Roč. 64, 6 December (2017), č. článku 034. ISSN 1803-6465 R&D Projects: GA ČR GA15-01090S Institutional support: RVO:60077344 Keywords : Cryptosporidium * Giardia * Encephalitozoon * Enterocytozoon bieneusi * antiparasitics * PCR Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.082, year: 2016
Czech Academy of Sciences Publication Activity Database
Acosta, A.A.; González-Solís, David; Da Silva, R.J.
2017-01-01
Roč. 94, č. 6 (2017), s. 649-656 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : fresh-water fish * southern Mexico * intestine * osorioi * Chiapas Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.181, year: 2016
Infusorial concentration in rumen fluid of red deer, fallow deer, roe deer and moufflon
Czech Academy of Sciences Publication Activity Database
Kamler, Jiří
1999-01-01
Roč. 68, č. 4 (1999), s. 247-252 ISSN 0001-7213 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK2005601 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.227, year: 1999 http://vfu-www.vfu.cz/acta-vet/vol68/pdf/68_247.pdf
Czech Academy of Sciences Publication Activity Database
Gál, P.; Nečas, A.; Plánka, L.; Kecová, H.; Křen, L.; Krupa, P.; Hlučilová, Jana; Usvald, Dušan
2007-01-01
Roč. 76, - (2007), s. 265-275 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Grant - others:MZd(CZ) NR8483 Institutional research plan: CEZ:AV0Z50450515 Keywords : growth plate injury * bone bridge * limb deformity Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.687, year: 2007
Czech Academy of Sciences Publication Activity Database
Bell, R. C.; Parra, J. L.; Badjedjea, G.; Barej, M. F.; Blackburn, D. C.; Burger, M.; Channing, A.; Dehling, J. M.; Greenbaum, E.; Gvoždík, Václav; Kielgast, J.; Kusamba, C.; Lötters, S.; McLaughlin, P. J.; Nagy, Z. T.; Rödel, M.-O.; Portik, D. M.; Stuart, B. L.; VanDerWal, J.; Zassi-Boulou, A.-G.; Zamudio, K. R.
2017-01-01
Roč. 26, č. 19 (2017), s. 5223-5244 ISSN 0962-1083 R&D Projects: GA ČR GJ15-13415Y Institutional support: RVO:68081766 Keywords : climatic refugia * ecological niche modelling * Hyperolius * land-bridge island * lineage divergence * riverine barriers Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 6.086, year: 2016
Czech Academy of Sciences Publication Activity Database
Doležalová, J.; Vallo, Peter; Petrželková, Klára Judita; Foitová, I.; Nurcahyo, W.; Mudakikwa, A.; Hashimoto, C.; Jirků, M.; Lukeš, J.; Scholz, T.; Modrý, D.
2015-01-01
Roč. 142, č. 10 (2015), s. 1278-1289 ISSN 0031-1820 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Bertiella * Anoplocephala * phylogeny * primates * zoonotic potential Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.031, year: 2015
Czech Academy of Sciences Publication Activity Database
Braicovich, P.; Moravec, František; Timi, J. A.
2007-01-01
Roč. 93, č. 2 (2007), s. 353-356 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Moravecia * Percophis * Argentina Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.129, year: 2007
Czech Academy of Sciences Publication Activity Database
González-Solís, D.; Moravec, František; Tuz Paredes, V. M.
2007-01-01
Roč. 93, č. 6 (2007), s. 1132-1135 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * Dentiphilometra * Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.129, year: 2007
Czech Academy of Sciences Publication Activity Database
Isbert, W.; Esteban Montero, F.; Carrasson, M.; González-Solís, David
2015-01-01
Roč. 91, č. 1 (2015), s. 35-47 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : ribosomal dna * marine fishes * pisces * sea * Ascaridoidea * Sciaenidae * morphology * tornquist * parasites * Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.316, year: 2015
Abrupt change in mean using block bootstrap and avoiding variance estimation
Czech Academy of Sciences Publication Activity Database
Peštová, Barbora; Pešta, M.
2018-01-01
Roč. 33, č. 1 (2018), s. 413-441 ISSN 0943-4062 Grant - others:GA ČR(CZ) GJ15-04774Y Institutional support: RVO:67985807 Keywords : Block bootstrap * Change in mean * Change point * Hypothesis test ing * Ratio type statistics * Robustness Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.434, year: 2016
Czech Academy of Sciences Publication Activity Database
Wu, Tao; Bouř, Petr
2018-01-01
Roč. 54, č. 14 (2018), s. 1790-1792 ISSN 1359-7345 R&D Projects: GA ČR(CZ) GJ16-08764Y; GA MŠk(CZ) LTC17012 Institutional support: RVO:61388963 Keywords : sialic acid * MRI * recognition Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.319, year: 2016
Czech Academy of Sciences Publication Activity Database
Moravec, František
2009-01-01
Roč. 56, č. 3 (2009), s. 185-193 ISSN 0015-5683 R&D Projects: GA MŠk LC522; GA AV ČR IA62211 Institutional research plan: CEZ:AV0Z60220518 Keywords : Contracaecum rudolphii * life cycle * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.266, year: 2009
Czech Academy of Sciences Publication Activity Database
Moravec, František; Klimpel, S.
2009-01-01
Roč. 73, č. 1 (2009), s. 37-47 ISSN 0165-5752 R&D Projects: GA MŠk LC522; GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ascarophis * Neoascarophis * Coryphaenoides Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009
Czech Academy of Sciences Publication Activity Database
Moravec, František; Bakenhaster, M.; Fajer-Avila, E.
2010-01-01
Roč. 55, č. 4 (2010), s. 359-368 ISSN 1230-2821 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Parasitic nematode * Philometra * marine fish * Epinephelus * Mycteroperca * Gulf of Mexico * Florida Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.144, year: 2010
Czech Academy of Sciences Publication Activity Database
Moravec, František; Saraiva, A.; Abdullah, S. M. A.; Bilal, S. J.; Rahemo, Z. I. F.
2009-01-01
Roč. 74, č. 2 (2009), s. 125-135 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cyprinidae * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009