Spin-resolved photoemission of surface states of W(110)-(1x1)H
International Nuclear Information System (INIS)
Hochstrasser, M.; Tobin, J.G.; Rotenberg, Eli; Kevan, S.D.
2002-01-01
The surface electronic states of W(110)-(1x1)H have been measured using spin- and angle-resolved photoemission. We directly demonstrate that the surface bands are both split and spin-polarized by the spin-orbit interaction in association with the loss of inversion symmetry near a surface. We observe 100 percent spin polarization of the surface states, with the spins aligned in the plane of the surface and oriented in a circular fashion relative to the S-bar symmetry point. In contrast, no measurable polarization of nearby bulk states is observed
110GHz-500kW long-pulse gyrotron with built-in quasi-optical mode converter
International Nuclear Information System (INIS)
Sakamoto, Keishi; Kariya, Tsuyoshi; Hayashi, Ken-ichi.
1994-01-01
We have designed, fabricated, and tested a 110 GHz-500 kW long-pulse gyrotron. The gyrotron incorporates a quasi-optical mode converter which transforms the oscillation mode, TE 22,2 , into a Gaussian radiation beam. The adoption of a built-in mode converter enabled us to design the electron beam collector so as to be capable of tolerating a 2 MW heat load. Attention was also paid to designing the gyrotron cavity and output window so as to permit long-pulse operations. In an experiment, we observed a maximum output power of 550 kW and achieved 1.3 s operation at a power level of 410 kW. (author)
33 CFR 110.87 - Henderson Harbor, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Henderson Harbor, N.Y. 110.87... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.87 Henderson Harbor, N.Y. (a) Area A. The area in the... latitude 43°51′08.8″ N, longitude 76°12′08.9″ W, thence to latitude 43°51′09.0″ N, longitude 76°12′19.0″ W...
DEFF Research Database (Denmark)
Pang, Xiaodan; Caballero Jambrina, Antonio; Dogadaev, Anton Konstantinovich
2012-01-01
In this paper, we demonstrate a photonic up-converted 25 Gbit/s fiber-wireless quadrature phase shift-keying (QPSK) data transmission link at the W-band (75–110 GHz). By launching two free-running lasers spaced at 87.5 GHz into a standard single-mode fiber (SSMF) at the central office, a W...
Directory of Open Access Journals (Sweden)
Rabea eMüller
2013-03-01
Full Text Available In cells cultured from neocortex of newborn rats, phosphoinositide-3-kinases of class I regulate the DNA synthesis in a subgroup of astroglial cells. We have studied the location of these cells as well as the kinase isoforms which facilitate the S phase entry. Using dominant negative isoforms as well as selective pharmacological inhibitors we quantified S phase entry by nuclear labeling with bromodeoxyuridine. Only in astroglial cells harvested from the marginal zone of the neocortex inhibition of phosphoinositide-3-kinases reduced the nuclear labeling with bromodeoxyuridine, indicating that neocortical astroglial cells differ in the regulation of proliferation. The two kinase isoforms p110 and p110were essential for S phase entry. p110 diminished the level of the p27Kip1 which inactivates the complex of cyclin E and CDK2 necessary for entry into the S phase. p110phosphorylated and inhibited glycogen synthase kinase-3which can prevent S-phase entry. Taken together, both isoforms mediated S phase in a subgroup of neocortical astroglial cells and acted via distinct pathways.
Fermi surface and quantum well states of V(110) films on W(110)
International Nuclear Information System (INIS)
Krupin, Oleg; Rotenberg, Eli; Kevan, S D
2007-01-01
Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface
Fermi surface and quantum well states of V(110) films on W(110)
Energy Technology Data Exchange (ETDEWEB)
Krupin, Oleg [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Rotenberg, Eli [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Kevan, S D [Department of Physics, University of Oregon, Eugene, OR 97403 (United States)
2007-09-05
Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface.
Substrate strain induced interaction of adatoms on W (110)
Kappus, W.
1980-09-01
The interaction of adatoms due to elastic strains created in an elastically isotropic substrate is investigated. For cases where the adatoms occupy sites with low symmetry, an angular dependent interaction results which falls off as s-3 at large distances. An exact expression is given for the long range interaction in terms of an anisotropy parameter of the force dipole tensor. The short range interaction is calculated by introducing a smooth cutoff. Interactions of adatoms on near neighbour sites on W (110) are given.
11 CFR 110.11 - Communications; advertising; disclaimers (2 U.S.C 441d).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Communications; advertising; disclaimers (2 U.S... AND EXPENDITURE LIMITATIONS AND PROHIBITIONS § 110.11 Communications; advertising; disclaimers (2 U.S... through radio or television, or through any broadcast, cable, or satellite transmission, must comply with...
Real-time simulation of an F110/STOVL turbofan engine
Drummond, Colin K.; Ouzts, Peter J.
1989-01-01
A traditional F110-type turbofan engine model was extended to include a ventral nozzle and two thrust-augmenting ejectors for Short Take-Off Vertical Landing (STOVL) aircraft applications. Development of the real-time F110/STOVL simulation required special attention to the modeling approach to component performance maps, the low pressure turbine exit mixing region, and the tailpipe dynamic approximation. Simulation validation derives by comparing output from the ADSIM simulation with the output for a validated F110/STOVL General Electric Aircraft Engines FORTRAN deck. General Electric substantiated basic engine component characteristics through factory testing and full scale ejector data.
STS-110 Extravehicular Activity (EVA)
2002-01-01
STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.
The interaction of He with 1/2 110 edge dislocation in W and Mo
International Nuclear Information System (INIS)
Hosson, J.Th.M. de; Sleeswyk, A.W.; Caspers, L.M.; Heugten, W. van; Veen, A. van.
1976-01-01
The positions of the metal atoms around a 1/2 [110] edge dislocation in Mo and W are calculated using the Wilson-Johnson potentials. The boundary conditions are given by anisotropic elasticity theory. The He-metal potential, also developed by Wilson and Johnson, is used to calculate the position with maximum energy gain for a He-atom. (author)
Energy Technology Data Exchange (ETDEWEB)
Maru, H. C.; Singhal, S. C.; Stone, C.; Wheeler, D.
2010-11-01
This independent review examines the status and technical potential of 1-10 kW stationary combined heat and power fuel cell systems and analyzes the achievability of the DOE cost, efficiency, and durability targets for 2012, 2015, and 2020.
Fiber Wireless Transmission of 8.3 Gb/s/ch QPSK-OFDM Signals in 75-110 GHz Band
DEFF Research Database (Denmark)
Deng, Lei; Beltrán Ramírez, Marta; Pang, Xiaodan
2012-01-01
In this paper, we present a scalable high speed Wband (75-110 GHz) fiber wireless communication system. By using an optical frequency comb generator, 3-channel 8.3 Gb/s/ch optical orthogonal frequency division multiplexing (OOFDM) baseband signals in a 15 GHz bandwidth are seamlessly translated f...
Energy Technology Data Exchange (ETDEWEB)
Kassiou, M.; Giboureau, N. [Sydney Univ., Brain and Mind Research Institute, NSW (Australia); Chellapan, S.; Wei, Z.L.; Kozikowski, A. [Illinois Univ., Chicago, Dept. of Medicinal Chemistry and Pharmacognosy, IL (United States); Henderson, D.; Fulton, R. [RPAH Sydney, Dept. PET and Nuclear Medicine (Australia); Xiao, Y.; Kellar, K. [Georgetown Univ., Dept. of Pharmacology, School of Medicine, Washington, DC (United States); Guilloteau, D.; Emond, P. [Institut National de la Sante et de la Recherche Medicale (INSERM), U619, 37 - Tours (France); Dolle, F. [Service Hospitalier Frederic Joliot, CEA/DSV, Institut d' Imagerie BioMedicale, 91 - Orsay (France)
2008-02-15
Central nicotinic acetylcholine receptors (n.A.Ch.R.s) have been implicated in learning memory processes and neuro-psychiatric disorders. Recently it was reported that the introduction of a substituted alkynyl group into the C-5 position of the pyridinyl ring of A-84543, significantly increased the selectivity for the n.A.Ch.R. containing {beta}{sub 2} subunits over {beta}{sub 4} subunits. Two selected candidates, Z.W.-90 and Z.W.-110 were labelled with carbon{sup 11} and evaluated in vivo.{sup 11}C Z.W.-90 penetrated rapidly into the brain, with maximum uptake in the thalamus and cerebellum 2 min post injection followed by clearance. The washout from cerebellum was faster than from thalamus, suggesting that specific binding can be optimally measured at 20 min post injection; Pretreatment of the baboon with nicotine resulted in markedly decreased uptake of the radioligand. {sup 11}C Z.W.-110 also penetrated rapidly into the brain, with a high evident uptake in the thalamus within 5 min. Surprisingly there was also considerable uptake in the striatum. Pretreatment with nicotine resulted in inhibition of uptake of 8 and 1%, in the thalamus and cerebellum, respectively. In pretreatment studies using unlabelled Z.W.-110, 32% inhibition of radioligand uptake was observed in the thalamus and striatum while uptake in the cerebellum was reduced by 24 %.While further work will be necessary in the development of optimal imaging agents for n.A.Ch.Rs, efforts will be made to examine the potential of these newly developed radioligands to serve diagnostic agents in the early detection of neurological disorders. (N.C.)
Directory of Open Access Journals (Sweden)
Jianbo Sun
2016-03-01
Full Text Available The novel Cr-containing low alloy steels have exhibited good corrosion resistance in CO2 environment, mainly owing to the formation of Cr-enriched corrosion film. In order to evaluate whether it is applicable to the CO2 and H2S coexistence conditions, the corrosion behavior of low-chromium steels in CO2-H2S environment with high pressure and high temperature was investigated using weight loss measurement and surface characterization. The results showed that P110 steel suffered localized corrosion and both 3Cr-P110 and 5Cr-P110 steels exhibited general corrosion. However, the corrosion rate of 5Cr-P110 was the highest among them. The corrosion process of the steels was simultaneously governed by CO2 and H2S. The outer scales on the three steels mainly consisted of FeS1−x crystals, whereas the inner scales on Cr-containing steels comprised of amorphous FeS1−x, Cr(OH3 and FeCO3, in contrast with the amorphous FeS1−x and FeCO3 mixture film of P110 steel. The more chromium the steel contains, the more chromium compounds the corrosion products contain. The addition of chromium in steels increases the uniformity of the Cr-enriched corrosion scales, eliminates the localized corrosion, but cannot decrease the general corrosion rates. The formation of FeS1−x may interfere with Cr-enriched corrosion scales and lowering the corrosion performance of 3Cr-P110 and 5Cr-P110 steels.
Sun, Jianbo; Sun, Chong; Lin, Xueqiang; Cheng, Xiangkun; Liu, Huifeng
2016-01-01
The novel Cr-containing low alloy steels have exhibited good corrosion resistance in CO2 environment, mainly owing to the formation of Cr-enriched corrosion film. In order to evaluate whether it is applicable to the CO2 and H2S coexistence conditions, the corrosion behavior of low-chromium steels in CO2-H2S environment with high pressure and high temperature was investigated using weight loss measurement and surface characterization. The results showed that P110 steel suffered localized corrosion and both 3Cr-P110 and 5Cr-P110 steels exhibited general corrosion. However, the corrosion rate of 5Cr-P110 was the highest among them. The corrosion process of the steels was simultaneously governed by CO2 and H2S. The outer scales on the three steels mainly consisted of FeS1−x crystals, whereas the inner scales on Cr-containing steels comprised of amorphous FeS1−x, Cr(OH)3 and FeCO3, in contrast with the amorphous FeS1−x and FeCO3 mixture film of P110 steel. The more chromium the steel contains, the more chromium compounds the corrosion products contain. The addition of chromium in steels increases the uniformity of the Cr-enriched corrosion scales, eliminates the localized corrosion, but cannot decrease the general corrosion rates. The formation of FeS1−x may interfere with Cr-enriched corrosion scales and lowering the corrosion performance of 3Cr-P110 and 5Cr-P110 steels. PMID:28773328
Induced Rashba splitting of electronic states in monolayers of Au, Cu on a W(110) substrate
International Nuclear Information System (INIS)
Shikin, A M; Rybkina, A A; Rybkin, A G; Marchenko, D; Korshunov, A S; Kudasov, Yu B; Frolova, N V; Sánchez-Barriga, J; Varykhalov, A; Rader, O
2013-01-01
The paper sums up a theoretical and experimental investigation of the influence of the spin–orbit coupling in W(110) on the spin structure of electronic states in deposited Au and Cu monolayers. Angle-resolved photoemission spectroscopy reveals that in the case of monolayers of Au and Cu spin–orbit split bands are formed in a surface-projected gap of W(110). Spin resolution shows that these states are spin polarized and that, therefore, the spin–orbit splitting is of Rashba type. The states evolve from hybridization of W 5d, 6p-derived states with the s, p states of the deposited metal. Interaction with Au and Cu shifts the original W 5d-derived states from the edges toward the center of the surface-projected gap. The size of the spin–orbit splitting of the formed states does not correlate with the atomic number of the deposited metal and is even higher for Cu than for Au. These states can be described as W-derived surface resonances modified by hybridization with the p, d states of the adsorbed metal. Our electronic structure calculations performed in the framework of the density functional theory correlate well with the experiment and demonstrate the crucial role of the W top layer for the spin–orbit splitting. It is shown that the contributions of the spin–orbit interaction from W and Au act in opposite directions which leads to a decrease of the resulting spin–orbit splitting in the Au monolayer on W(110). For the Cu monolayer with lower spin–orbit interaction the resulting spin splitting is higher and mainly determined by the W. (paper)
41 CFR 115-1.110 - Deviations.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...
catena-Poly[[bis(μ3-5-hydroxyisophthalatobis(pyrazino[2,3-f][1,10]phenanthrolinedicadmium] dihydrate
Directory of Open Access Journals (Sweden)
Peng-Cheng Zhao
2012-04-01
Full Text Available The title coordination polymer, {[Cd2(C8H4O52(C14H8N42]·2H2O}n, has a layered structure. The asymmetric unit contains two CdII ions, two pyrazino[2,3-f][1,10]phenanthroline, two 5-hydroxyisophthalate (hip ligands and two lattice water molecules. Each CdII ion is coordinated by two N atoms from a chelating pyrazino[2,3-f][1,10]phenanthroline and four O atoms from three different hip ligands, resulting in a distorted CdN2O4 octahedral coordination environment. The hip ligand connects adjacent CdII ions, forming forming layers parallel to (010. Intralayer O—H...O hydrogen bonds involving the hydroxy groups and solvent water molecules consolidate the crystal packing.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviation. 105-1.110 Section 105-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.110 Deviation. (a...
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Deviation. 101-1.110 Section 101-1.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.110 Deviation...
A novel 1,10-seco withanolide from Physalis peruviana.
Fang, Sheng-Tao; Liu, Ji-Kai; Li, Bo
2010-07-01
A novel 1,10-seco withanolide, 1,10-seco withaperuvin C (1), together with four known withanolides, 4 beta-hydroxywithanolide E (2), visconolide (3), withanolide F (4), and withaphysanolide (5), was isolated from the aerial parts of Physalis peruviana. The structures of compounds 1-5 were determined on the basis of spectroscopic methods including extensive 1D and 2D NMR analysis. In addition, the possible biogenetic relationships among these five withanolides are discussed.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Default. 110.110 Section 110.110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Hearings § 110.110 Default. When a participant fails to act within a specified time, the presiding officer may consider him in default, issue an...
Synthesis of Responses to Vatican Statement from 110 U.S. Catholic Colleges.
Gallin, Sr. Alice
1986-01-01
The situation of U.S. Catholic colleges and universities is outlined, and the responses of 110 American Catholic college and university presidents to the Vatican's statement concerning the role and relationships of Catholic universities worldwide are synthesized. (MSE)
1 CFR 500.110 - Self-evaluation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 500.110 Section 500.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL COMMISSION FOR EMPLOYMENT POLICY § 500.110 Self-evaluation... or organizations representing handicapped persons, to participate in the self-evaluation process by...
1 CFR 457.110 - Self-evaluation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 457.110 Section 457.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.110 Self-evaluation. (a... organizations representing handicapped persons, to participate in the self-evaluation process by submitting...
Angevin, Eric; Isambert, Nicolas; Trillet-Lenoir, Véronique; You, Benoit; Alexandre, Jérôme; Zalcman, Gérard; Vielh, Philippe; Farace, Françoise; Valleix, Fanny; Podoll, Thomas; Kuramochi, Yu; Miyashita, Itaru; Hosono, Osamu; Dang, Nam H; Ohnuma, Kei; Yamada, Taketo; Kaneko, Yutaro; Morimoto, Chikao
2017-04-25
YS110 is a humanised IgG1 monoclonal antibody with high affinity to the CD26 antigen. YS110 demonstrated preclinical anti-tumour effects without significant side effects. This FIH study was designed to determine the maximal tolerated dose (MTD) and recommended phase 2 dose (RP2D) to assess the tolerance, pharmacokinetics (PK) and pharmacodynamics profiles of YS110 and preliminary efficacy. YS110 were initially administered intravenously once every 2 weeks (Q2W) for three doses and then, based on PK data, once every week (Q1W) for five doses in patients with CD26-expressing solid tumours. Thirty-three patients (22 mesothelioma) received a median of 3 (range 1-30) YS110 infusions across six dose levels (0.1-6 mg kg -1 ). MTD was not reached and two dose-limiting toxicities (infusion hypersensitivity reactions) led to the institution of a systemic premedication. Low-grade asthenia (30.3%), hypersensitivity (27.3%), nausea (15.2%), flushing (15.2%), chills (12.1%) and pyrexia (12.1%) were reported as ADRs. Pharmacokinetic parameters (AUC and C max ) increased in proportion with the dose. sCD26/DPPIV assays indicated CD26 modulation. Prolonged stable diseases were observed in 13 out of 26 evaluable patients. YS110 is well tolerated up to 6 mg kg -1 Q1W, which has been defined as the RP2D, with encouraging prolonged disease stabilisations observed in a number of patients with advanced/refractory mesothelioma.
Management of Contracts for F110 Engine Procurements
National Research Council Canada - National Science Library
Granetto, Paul
2001-01-01
This audit was performed in response to an allegation to the Defense Hotline that the Wright-Patterson Air Force Base Procurement Contracting Office made poor procurement decisions on F110 aircraft engine contracts...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv
International Nuclear Information System (INIS)
Zhang, Zhongyu; Bi, Caifeng; Fan, Yuhua; Zhang, Xia; Zhang, Nan; Yan, Xingchen; Zuo, Jian
2014-01-01
A novel complex [Zn(phen)(o-AB) 2 ] [phen: 1,10-phenanthroline o-AB: o-aminobenzoic acid] was synthesized and characterized by elemental analysis and X-ray diffraction single-crystal analysis. The crystal crystallizes in monoclinic, space group P2(1)/c with a = 7.6397(6) A, b = 16.8761(18) A, c = 17.7713(19) A, α = 90 .deg., β = 98.9570(10) .deg., γ = 90 .deg., V = 2.2633(4) nm 3 , Z = 4, F(000) = 1064, S = 1.058, Dc = 1.520 g·cm -3 , R 1 = 0.0412, wR 2 = 0.0948, μ = 1.128 mm -1 . The Zn(II) is six coordinated by two nitrogen and four oxygen atoms from the 1,10-phenanthroline and o-aminobenzoic acid to furnish a distorted octahedron geometry. The complex exhibits intense fluorescence at room temperature. Theoretical studies of the title complex were carried out by density functional theory (DFT) B3LYP method. CCDC: 898291
Novel and simple synthesis of brominated 1,10-phenanthrolines
Czech Academy of Sciences Publication Activity Database
Výprachtický, Drahomír; Kaňková, Dana; Pokorná, Veronika; Kmínek, Ivan; Dzhabarov, Vagif; Cimrová, Věra
2014-01-01
Roč. 67, č. 6 (2014), s. 915-921 ISSN 0004-9425 R&D Projects: GA ČR GAP106/12/0827; GA ČR(CZ) GA13-26542S Institutional support: RVO:61389013 Keywords : 1,10-phenanthroline * electrophilic aromatic substitution * bromination Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.558, year: 2014
Studies of biological effects of fluoride stannous and UV short in Escherichia coli BH110
Energy Technology Data Exchange (ETDEWEB)
Ferreira da C, R., E-mail: rogercosta1@hotmail.com [Federal Institute of Education, Science and Technology of Goias, Campus Uruacu, Rua Formosa Qd 28 e 29, Loteamento Santana, 76400-000 Uruacu, Goias (Brazil)
2015-10-15
Full text: The amount of UV rays on the Earth's surface has increased due to depletion of the ozone layer, and this has worried society, since these radiation although not considered ionizing can cause damage to biological membrane and especially to DNA. The DNA has cell repair mechanisms that can work in lesions caused by electromagnetic radiation such as ultraviolet -short (UV C)and agents causing oxidative stress, such as tin salts. Among the repair mechanisms can highlight the adaptive repair, which consists of smaller doses to cells pre-exposure of an oxidizing agent, and when these cells are exposed to larger doses of the agent even if there is a reduction in mortality rate which leads to complete that repair mechanisms are activated in the pre-exposure reducing cell mortality. Several publications have shown the genotoxic effects of stannous salts such as stannous fluoride (SnF{sub 2}), which shows the importance of the study, since these salts are widely used in industry as components in toothpastes and mouthwashes. So we check whether pretreatment with UV C is able to induce adaptive response reducing the cytotoxic effects caused by exposure of the strains to SnF{sub 2}. We use a strain of Escherichia coli BH110 (BH110 E. coli) deficient in three genes (fpg, nfo and xth) involved in the excision repair bases. To verify the induction of adaptive response to strain BH110 was exposed to various doses of UV C and then treated with SnF{sub 2} a concentration of 110 u M. Our results showed that the LD10 of strain BH110 is 20 J/m{sup 2} and pre-treatment with UV C does not seem to induce adaptive repair in BH110 strains. (Author)
El Hamdani, H.; El Amane, M.; Duhayon, C.
2018-03-01
Co-crystal of 1,10-phenanthrolin-1-ium-caffeine-hexafluorophosphate was synthesized, studied by FTIR, 1H, 13C NMR, DSC and X-ray structure and crystallized in the monoclinic space group C2/c. The unit cell parameters are a = 19.3761 (3), b = 17.9548 (3), c = 13.8074 (3) with β = 117.8132 (10). The final R value is 0.069 for 29,522 measured reflections. The co-crystal structure analysis indicate the 1,10-phenanthroline is protonated by one nitrogen atom and formed the 1,10-phenanthrolin-1-ium cation, which is stabilized by hydrogen bonds N+-H…Odbnd C interaction with carbonyl and imidazol ring in caffeine molecule. The intermolecular hydrogen bonds: Csbnd H...O, Csbnd H...N, Nsbnd H...O, Csbnd H...F and intramolecular hydrogen bond: C1sbnd H12...O14, together play a vital role in stabilizing the structure of co-crystal. The X-ray structural analysis confirm the assignments of the structure from infrared, 1H, 13C NMR, spectroscopic data DSC and molar conductivity analysis. The antimicrobial activity of the co-crystal was studied.
Multigigabit W-Band (75–110 GHz) Bidirectional Hybrid Fiber-Wireless Systems in Access Networks
DEFF Research Database (Denmark)
Pang, Xiaodan; Lebedev, Alexander; Vegas Olmos, Juan José
2014-01-01
compare the transmission performances in terms of achievable wireless distances with and without using a high-frequency electrical power amplifier at the wireless transmitter. A downlink 16-Gbit/s QPSK signal and an uplink 1.25-Gbit/s ASK signal transmission over the two implementations are experimentally......We experimentally demonstrate multigigabit capacity bidirectional hybrid fiber-wireless systems with RF carrier frequencies at the W-band (75-110 GHz) that enables the seamless convergence between wireless and fiber-optic data transmission systems in access networks. In this study, we evaluate...... the transmission performances in two scenarios: a fiber-wireless access link that directly provide high-speed connections to wireless end users, and a fiber-wireless-fiber signal relay where a high capacity wireless link can be used to bridge two access fiber spans over physical obstacles. In both scenarios, we...
21 CFR 226.110 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR TYPE A MEDICATED ARTICLES Records and Reports § 226.110 Distribution records. Complete records shall be maintained for each shipment of Type A medicated article(s) in... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 226.110 Section 226.110 Food...
International Nuclear Information System (INIS)
Morawek, W.
1991-07-01
In the framework of this thesis the excitation functions of the systems 110 Pd + 110 Pd and 110 Pd + 104 Ru could be measured. The evaporation-residual-nucleus cross sections is deviating from lighter systems dominated by channels, which arise from evaporation of α particles. In the reaction 110 Pd + 110 Pd no xn channels were observed. In comparison to other reactions qualitatively a strong fusion hindrance of this system is shown. (orig./HSI) [de
Controlling Self-Assembly in Al(110) Homoepitaxy
Tiwary, Yogesh; Fichthorn, Kristen
2010-03-01
Homoepitaxial growth on Al(110) exhibits nanoscale self-assembly into huts with well-defined (100) and (111) facets [1]. Although some of the diffusion mechanisms underlying this kinetic self-assembly were identified and incorporated into a two-dimensional model [2], we used density-functional theory (DFT) to identify many other mechanisms that are needed to describe the three-dimensional assembly seen experimentally [3]. We developed a three-dimensional kinetic Monte Carlo (KMC) model of Al(110) homoepitaxy. The inputs to the model were obtained from DFT [3,4]. Our model is in agreement with experimentally observed trends for this system. We used KMC to predict self-assembly under various growth conditions. To achieve precise placement of Al nanohuts, we simulated thermal-field-directed assembly [5]. Our results indicate that this technique can be used to create uniform arrays of nanostructures. [1] F. Buatier de Mongeot, W. Zhu, A. Molle, R. Buzio, C. Boragno, U. Valbusa, E. Wang, and Z. Zhang, Phys. Rev. Lett. 91, 016102 (2003). [2] W. Zhu, F. Buatier de Mongeot, U. Valbusa, E. G. Wang, and Z. Y. Zhang, Phys. Rev. Lett. 92, 106102 (2004). [3] Y. Tiwary and K. A. Fichthorn, submitted to Phys. Rev. B. [4] Y. Tiwary and K. A. Fichthorn, Phys. Rev. B 78, 205418 (2008). [5] C. Zhang and R. Kalyanaraman, Appl. Phys. Lett. 83, 4827 (2003).
International Nuclear Information System (INIS)
Schultz, P.J.; Lynn, K.G.; Frieze, W.E.; Vehanen, A.
1983-01-01
Positron emission from a W(110) single crystal has been studied as a function of copper coverage utilizing a variable-energy positron beam in conjunction with low-energy electron diffraction and Auger-electron spectroscopy. Evidence is presented that indicates that sig- p nificant positron localization occurs at defects associated with the Cu/W(110) interface, which can be removed by high-temperature annealing. Our data also reveal new information about the islanding of copper on tungsten, providing a reliable means of identifying and quantifying the relative two-dimensional coverage of the surface by these islands
Directory of Open Access Journals (Sweden)
S. Karslıoğlu
2017-07-01
Full Text Available A new imidazo[4,5-f][1,10]phenanthroline (imp derivative imidazo-N5,N6-bis((4-(1H-imidazo[4,5-f][1,10]phenanthroline-2-ylphenylmethylene-1,10-phenanthroline-5,6-diamine (impap was synthesized in five steps starting from bare phenanthroline (phen precursors. The novel compound was fully characterized by 1H-NMR, IR, elemental analysis and electrospray ionization mass spectroscopy (ESI-MS techniques. Solid state emission spectrum of impap showed two distinct strong emission maxima with large Stokes shifts. The ground state gas phase geometry of impap was predicted by DFT calculations. Excited state properties of the molecule were examined through TD-DFT calculations conducted at the optimized geometry. Responsible transitions for the strong fluorescence of impap were assigned to single component charge transfer transitions with large oscillator strengths based on the ground state calculated molecular orbital contributions.
Directory of Open Access Journals (Sweden)
Makino Takuya
2012-07-01
Full Text Available Abstract Background Cyanobacteria possess several cytochrome P450s, but very little is known about their catalytic functions. CYP110 genes unique to cyanaobacteria are widely distributed in heterocyst-forming cyanobacteria including nitrogen-fixing genera Nostoc and Anabaena. We screened the biocatalytic functions of all P450s from three cyanobacterial strains of genus Nostoc or Anabaena using a series of small molecules that contain flavonoids, sesquiterpenes, low-molecular-weight drugs, and other aromatic compounds. Results Escherichia coli cells carrying each P450 gene that was inserted into the pRED vector, containing the RhFRed reductase domain sequence from Rhodococcus sp. NCIMB 9784 P450RhF (CYP116B2, were co-cultured with substrates and products were identified when bioconversion reactions proceeded. Consequently, CYP110E1 of Nostoc sp. strain PCC 7120, located in close proximity to the first branch point in the phylogenetic tree of the CYP110 family, was found to be promiscuous for the substrate range mediating the biotransformation of various small molecules. Naringenin and (hydroxyl flavanones were respectively converted to apigenin and (hydroxyl flavones, by functioning as a flavone synthase. Such an activity is reported for the first time in prokaryotic P450s. Additionally, CYP110E1 biotransformed the notable sesquiterpene zerumbone, anti-inflammatory drugs ibuprofen and flurbiprofen (methylester forms, and some aryl compounds such as 1-methoxy and 1-ethoxy naphthalene to produce hydroxylated compounds that are difficult to synthesize chemically, including novel compounds. Conclusion We elucidated that the CYP110E1 gene, C-terminally fused to the P450RhF RhFRed reductase domain sequence, is functionally expressed in E. coli to synthesize a robust monooxygenase, which shows promiscuous substrate specificity (affinity for various small molecules, allowing the biosynthesis of not only flavones (from flavanones but also a variety of
International Nuclear Information System (INIS)
Cary, W.P.; Allen, J.C.; Callis, R.W.; Doane, J.L.; Harris, T.E.; Moetler, C.P.; Neren, A.; Prater, P.; Rensen, D.
1992-01-01
This paper reports on a new high power electron cyclotron heating (ECH) system which has been introduced on DIII-D. This system is designed to operate at 110 GHz with a total output power of 2 MW. The system consists of four Varian VGT-8011 gyrotrons (output power of 500 kW), and their associated support equipment. All components have been designed for up to a 10 second pulse duration. The 110 GHz system is intended to further progress in rf current drive experiments on DIII-D when used in conjunction with the existing 60 GHz ECH (1. 6 MW) , and the 30-60 MHz ICH (2MW) systems. H-mode physics, plasma stabilization experiments and transport studies are also to be conducted at 110 GHz
Energies controlling nucleation and growth processes: The case of Ag/W(110)
DEFF Research Database (Denmark)
Jones, G. W.; Marcano, J. M.; Nørskov, Jens Kehlet
1990-01-01
The nucleation density Nx(T) of Ag islands on the 2-monolayer-thick silver intermediate layer on W(110) is measured by UHV scanning electron microscopy and compared with kinetic nucleation equations. This yields a well-determined value of Ed+2Eb=0.65±0.03 eV, with pair-binding energy Eb=0...
Seeking asymmetric rotors in mass region A∼100-110
International Nuclear Information System (INIS)
Varshney, Mani; Gupta, D K; Singh, M; Singh, Yuvraj; Bihari, Chhail; Varshney, A K; Gupta, K K
2011-01-01
The staggering indices S(I, I-1, I-2) versus spin (I) graphs have been plotted using known experimental data along with empirical calculations of Varshney et al (2007 Phys. Scr. 75 451) in some nuclei of mass region A∼100-110. Most of the transional nuclei of Mo, Ru and Pd isotopes have been found to be triaxial. The known B(E2) values of these nuclei are also close to the triaxial rotor model predictions (Davydov A S and Filippov G F 1958 Nucl. Phys. 8 237).
Sup(110)Sn/110In - a new generator system for positron emission tomography
International Nuclear Information System (INIS)
Lundqvist, H.; Einarsson, L.; Malmborg, P.; Scott-Robson, S.
1991-01-01
A generator system, 110 Sn/ 110 In, is suggested for use in the labelling of leukocytes with this short-lived (t 1/2 = 1.15 h) positron emitting (62%) isotope of indium. The half-life gives the labelled leukocytes time to be adequately distributed but is short enough to allow repeated studies within a few hours. The mother radionuclide 110 Sn (t 1/2 = 4.15 h) is produced by the reaction nat In(p, xn) 110 Sn which has a maximum cross-section of 110 mb at approx. 70 MeV and a practical yield of 400 MBq/μAh. (author)
DEFF Research Database (Denmark)
Deng, Lei; Pang, Xiaodan; Beltrán, Marta
2012-01-01
We demonstrate scalable optical comb- and heterodyning-based generation, optical and 1.3-m wireless transmission, and electrical heterodyne detection of multiband OFDM up to 38.2 Gb/s occupying 14.4-GHz RF bandwidth, for high-capacity optical-wireless links in 75-110 GHz....
29 CFR 1978.110 - Judicial review.
2010-07-01
... Labor, shall not be subject to judicial review in any criminal or other civil proceedings (49 U.S.C... law judge, shall be transmitted by the Administrative Review Board, United States Department of Labor... 29 Labor 9 2010-07-01 2010-07-01 false Judicial review. 1978.110 Section 1978.110 Labor...
2010-10-01
....C. 450m-1] does the term contract include compacts, funding agreements, and construction project... the term contract include compacts, funding agreements, and construction project agreements entered into under Title V? Yes, for the purposes of section 110 of the Act [25 U.S.C. 450m-1] the term...
Interaction of actinide ions with [NaP5W30O110]14- and [P2W18O62]6-
International Nuclear Information System (INIS)
Choppin, G.R.; Wall, D.E.
2003-01-01
Stability constants (log β 101 ) of Th 4+ , UO 2 2+ , NpO 2 + and Am 3+ with [NaP 5 W 30 O 110 ] 14- were determined by solvent extraction (μ = 0.1M NaCl) and found to be 6.18 ± 0.07, 3.80 ± 0.06, 2.98 ± 0.04, and 5.85 ± 0.05, respectively. The order of stability constants: Th 4+ > Am 3+ > UO 2 2+ > NpO 2 + is due to electrostatic repulsion between the actinyl oxygens and oxygens on the polyoxometalate surface. The order of stability constants for metal complexes with [P 2 W 18 O 62 ] 6- is Th 4+ > UO 2 2+ > Eu 3+ >NpO 2 + because the steric repulsion between actinyl oxygens and oxygens on polyoxometalate are less important. Enthalpies of complexation were measured by calorimetric titration of Th 4+ , UO 2 2+ , Nd 3+ with [NaP 5 W 30 O 110 ] 14- and [P 2 W 18 O 62 ] 6- . The results indicate that the conformation and charge distribution of the microscopic surface structures are important factors in the formation of pseudocolloids. (author)
Rajebhosale, Bharati S; Dongre, Shivali N; Deshpande, Sameer S; Kate, Anup N; Kumbhar, Anupa A
2017-10-01
The reaction of aryl imidazo[4,5f] [1,10]phenanthrolines with Cu(NO 3 ) 2 lead to the formation of Cu(II) complexes of the type [Cu(L)(NO 3 ) 2 ] where L=PIP, 2-(phenyl) [4,5f] imidazo phenanthroline; HPIP=2-(2-hydroxyphenyl)imidazo [4,5f] phenanthroline and NIP=2-(naphthyl) [4,5f] imidazo phenanthroline. The interaction of these complexes with calf thymus DNA has been studied using viscosity measurements, UV-visible and fluorescence spectroscopy. Chemical nuclease activity of these complexes has also been investigated. All complexes cleave DNA via oxidative pathway involving singlet oxygen. Molecular docking studies revealed that these complexes bind to DNA through minor groove. Copyright © 2017 Elsevier Inc. All rights reserved.
cis-Difluoridobis(1,10-phenanthroline)chromium(III) perchlorate monohydrate
DEFF Research Database (Denmark)
Birk, Torben; Bendix, Jesper; Weihe, Högni
2008-01-01
The title complex, [CrF(2)(C(12)H(8)N(2))(2)]ClO(4)·H(2)O, displays a slightly distorted octa-hedral coordination geometry around the central chromium(III) ion. The Cr environment is composed of a cis arrangement of two 1,10-phenanthroline [average Cr(III)-N = 2.0726 (10) Å] and two fluoride [ave...
49 CFR 110.110 - After-grant requirements.
2010-10-01
... PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.110 After-grant requirements. The Associate... must submit all financial, performance, and other reports required as a condition of the grant, within...
Dutta, R; Kashyap, V K
2001-04-01
Genetic variation at four minisatellite loci D1S7, D4S139, D5S110 and D17S79 in three predominant population groups of eastern India, namely Brahmin, Kayastha and Garo, are reported in this study. The Brahmin and Kayastha are of Indo-Caucasoid origin while the Garo community represents the Indo-Mongoloid ethnic group. The methodology employed comprised generation of HaeIII-restricted fragments of isolated DNA, Southern blotting, and hybridization using chemiluminescent probes MS1, pH30, LH1 and V1 for the four loci. All four loci were highly polymorphic in the population groups. Heterozygosity values for the four loci ranged between 0.68 and 0.95. Neither departure from Hardy Weinberg expectations nor evidence of any association across alleles among the selected loci was observed. The gene differentiation value among the loci is moderate (GST = 0.027). A neighbour-joining tree constructed on the basis of the generated data shows very low genetic distance between the Brahmin and Kayastha communities in relation to the Garo. Our results based on genetic distance analysis are consistent with results of earlier studies based on serological markers and linguistic as well as morphological affiliations of these populations and their Indo-Caucasoid and Indo-Mongoloid origin. The minisatellite loci studied here were found to be not only useful in showing significant genetic variation between the populations but also to be suitable for human identity testing among eastern Indian populations.
Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test
Energy Technology Data Exchange (ETDEWEB)
Komine, Kuniaki [Nuclear Power Engineering Corp., Tokyo (Japan); Konno, Mutsuo
1999-07-01
NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)
STS-110 M.S. Ross in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-110 Mission Specialist Jerry Ross waits his turn at driving the M-113 armored personnel carrier, part of Terminal Countdown Demonstration Test activities. In the background, right, is Mission Specialist Lee Morin. TCDT includes emergency egress training and a simulated launch countdown, and is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
Effects of quenched impurities on surface diffusion, spreading, and ordering of O/W(110)
DEFF Research Database (Denmark)
Nikunen, P.; Vattulainen, Ilpo Tapio; Ala-Nissila, T.
2002-01-01
We study how quenched impurities affect the surface diffusion and ordering of strongly interacting adsorbate atoms on surfaces. To this end, we carry out Monte Carlo simulations for a lattice-gas model of O/W(110), including small concentrations of immobile impurities which block their adsorption...
2 CFR 182.110 - What do subparts A through F of this part do?
2010-01-01
... FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.110 What do subparts A through F of this part do? Subparts A through F...
PS1-10bzj: A FAST, HYDROGEN-POOR SUPERLUMINOUS SUPERNOVA IN A METAL-POOR HOST GALAXY
Energy Technology Data Exchange (ETDEWEB)
Lunnan, R.; Chornock, R.; Berger, E.; Milisavljevic, D.; Drout, M.; Sanders, N. E.; Challis, P. M.; Czekala, I.; Foley, R. J.; Fong, W.; Kirshner, R. P.; Leibler, C.; Marion, G. H.; Narayan, G. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Huber, M. E. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); McCrum, M.; Smartt, S. J. [Astrophysics Research Centre, School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Rest, A. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Roth, K. C. [Gemini Observatory, 670 N. Aohoku Place, Hilo, HI 96720 (United States); Scolnic, D., E-mail: rlunnan@cfa.harvard.edu [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); and others
2013-07-10
We present observations and analysis of PS1-10bzj, a superluminous supernova (SLSN) discovered in the Pan-STARRS Medium Deep Survey at a redshift z = 0.650. Spectroscopically, PS1-10bzj is similar to the hydrogen-poor SLSNe 2005ap and SCP 06F6, though with a steeper rise and lower peak luminosity (M{sub bol} {approx_equal} -21.4 mag) than previous events. We construct a bolometric light curve, and show that while PS1-10bzj's energetics were less extreme than previous events, its luminosity still cannot be explained by radioactive nickel decay alone. We explore both a magnetar spin-down and circumstellar interaction scenario and find that either can fit the data. PS1-10bzj is located in the Extended Chandra Deep Field South and the host galaxy is imaged in a number of surveys, including with the Hubble Space Telescope. The host is a compact dwarf galaxy (M{sub B} Almost-Equal-To -18 mag, diameter {approx}< 800 pc), with a low stellar mass (M{sub *} Almost-Equal-To 2.4 Multiplication-Sign 10{sup 7} M{sub Sun }), young stellar population ({tau}{sub *} Almost-Equal-To 5 Myr), and a star formation rate of {approx}2-3 M{sub Sun} yr{sup -1}. The specific star formation rate is the highest seen in an SLSN host so far ({approx}100 Gyr{sup -1}). We detect the [O III] {lambda}4363 line, and find a low metallicity: 12 + (O/H) = 7.8 {+-} 0.2 ({approx_equal} 0.1 Z{sub Sun }). Together, this indicates that at least some of the progenitors of SLSNe come from young, low-metallicity populations.
A study on behaviour of 110mAg in marine environment
International Nuclear Information System (INIS)
Xie Yunmian; Tang Wenqiao; Meng Jianyi
2000-01-01
The author describes a study on the behaviour of 110m Ag in marine environment. It includes the chemical species of 110m Ag in seawater, the absorption factor K d in/on sea sediment and biological concentration factor B f of marine biome for 110m Ag. The experiment and theoretical calculation indicate that 110 Ag exists as 110m AgCl 2 - : 110m Ag + ≅10 5 in seawater and AgCl precipitation is formed when [Ag + ][Cl - ]≥1.56 x 10 -10 . K d in/on sediment decreases with increasing of temperature and/or liquid/solid ratio. The effect of water nature on K d is very considerable. And the K d on sediment is in the order of 10 2 mL/g under the seawater atmosphere, which is two orders lower than under the freshwater atom sphere, 110m Ag is concentrated by marine biome strongly. B f is in the range of 10 2 -10 4 depending on different kind of marine biome
DEFF Research Database (Denmark)
Sambaraju, R.; Zibar, Darko; Caballero Jambrina, Antonio
2010-01-01
Record wireless signal capacity of up to 40 Gb/s is demonstrated in the 75-110 GHz band. All-optical OFDM and photonic up-conversion are used for generation and digital coherent detection for demodulation....
33 CFR 110.150 - Block Island Sound, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Block Island Sound, N.Y. 110.150... ANCHORAGE REGULATIONS Anchorage Grounds § 110.150 Block Island Sound, N.Y. (a) The anchorage ground. A 3/4... following coordinates: latitude 41°06′12″ N., longitude 72°00′05″ W., latitude 41°07′40″ N., longitude 72°01...
33 CFR 118.110 - Daymarks and lateral lighting on bridges.
2010-07-01
... bridges. 118.110 Section 118.110 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LIGHTING AND OTHER SIGNALS § 118.110 Daymarks and lateral lighting on bridges. (a... through bridges with U.S. aids to navigation system lateral marks and lights installed on the...
11 CFR 110.13 - Candidate debates.
2010-01-01
... debates include at least two candidates; and (2) The staging organization(s) does not structure the... PROHIBITIONS § 110.13 Candidate debates. (a) Staging organizations. (1) Nonprofit organizations described in 26..., subparts D and E. (b) Debate structure. The structure of debates staged in accordance with this section and...
Energy Technology Data Exchange (ETDEWEB)
Acosta, D.; Affolder, Anthony A.; Albrow, M.G.; Ambrose, D.; Amidei, D.; Anikeev, K.; Antos, J.; Apollinari, G.; Arisawa, T.; Artikov, A.; Ashmanskas, W.; Azfar, F.; Azzi-Bacchetta, P.; Bacchetta, N.; Bachacou, H.; Badgett, W.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Baroiant, S.; Barone, M.; /Taiwan, Inst. Phys. /Argonne /INFN,
2005-04-01
We present the first measurement of the A{sub 2} and A{sub 3} angular coefficients of the W boson produced in proton-antiproton collisions. We study W {yields} ev{sub e} and W {yields} {mu}{nu}{sub {mu}} candidate events produced in association with at least one jet at CDF, during Run Ia and Run Ib of the Tevatron at {radical}s = 1.8 TeV. The corresponding integrated luminosity was 110 pb{sup -1}. The jet balances the transverse momentum of the W and introduces QCD effects in W boson production. The extraction of the angular coefficients is achieved through the direct measurement of the azimuthal angle of the charged lepton in the Collins-Soper rest-frame of the W boson. The angular coefficients are measured as a function of the transverse momentum of the W boson. The electron, muon, and combined results are in good agreement with the Standard Model prediction, up to order {alpha}{sub s}{sup 2} in QCD.
Geometric factors in f.c.c. and b.c.c. metal-on-metal epitaxy
International Nuclear Information System (INIS)
Bruce, L.A.; Jaeger, H.
1978-01-01
Deposits of Ni, Au and Ag formed by condensing metal vapour in U.H.V. onto (001)W, held at a temperature Tsub(s) in the range 300K< Tsub(s)<1200 K, always form epitaxial layers. However, while Au and Ag form (001) epitaxial layers of f.c.c. single crystals, (001)d parallel to (001)s with, say, [110]d parallel to [010]s, Ni and Cu occur in two orthogonal domains, each characterized by an exclusive set of fault (or twin) planes. Within a fault plane, atoms are hexagonally close-packed and, within a domain, fault planes are normal to either [1-1-0]s or [1-10]s and a close-packed direction in the planes is normal to the substrate. The lateral stacking of the fault planes may range from random at low values of Tsub(s) to that of, say, (11-1-) planes in heavily faulted and/or twinned (110) epitaxed f.c.c. material, or of basal planes in (110) epitaxed h.c.p. material at high values of Tsub(s). The results are readily explained on the basis of a growth model developed for deposits of Ni and Cu on (001) Ag. (author)
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Evaluation. 6.110 Section 6.110 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.110 Evaluation. (a) Within one year of... persons, including handicapped persons and organizations representing handicapped persons, and evaluation...
Directory of Open Access Journals (Sweden)
Parreira Kleber Simônio
2002-01-01
Full Text Available Fixed bin frequencies for the VNTR loci D2S44, D4S139, D5S110, and D8S358 were determined in a Minas Gerais population sample. The data were generated by RFLP analysis of HaeIII-digested genomic DNA and chemiluminescent detection. The four VNTR loci have met Hardy-Weinberg equilibrium, and there was no association of alleles among VNTR loci. The frequency data can be used in forensic analyses and paternity tests to estimate the frequency of a DNA profile in the general Brazilian population.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Mediation. 110.32 Section 110.32 Education Regulations..., Conciliation, and Enforcement Procedures § 110.32 Mediation. (a) ED promptly refers to the Federal Mediation and Conciliation Service or to the mediation agency designated by the Secretary of Health and Human...
2010-04-01
... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Roads. 1710.110 Section 1710.110... (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.110 Roads. (a) Access to the subdivision. (1) Is access to the subdivision provided by public or private roads? What...
Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test
International Nuclear Information System (INIS)
Komine, Kuniaki; Konno, Mutsuo
1999-01-01
NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)
Gao, Jie; Wang, Zhi-Ping; Yuan, Cui-Li; Jia, Hai-Shun; Wang, Ke-Zhi
2011-09-01
A new Ru(II) complex of [Ru(bpy) 2(Hmspip)]Cl 2 {in which bpy = 2,2'-bipyridine, Hmspip = 2-(4-(methylsulfonyl)phenyl)-1 H-imidazo[4,5- f][1,10]phenanthroline} have been synthesized and characterized. The ground- and excited-state acid-base properties of [Ru(bpy) 2(Hmspip)]Cl 2 and its parent complex of [Ru(bpy) 2(Hpip)]Cl 2 {Hpip = 2-phenyl-1H-imidazo[4,5- f][1,10]phenanthroline} have been studied by UV-visible (UV-vis) and emission spectrophotometric pH titrations. [Ru(bpy) 2(Hmspip)]Cl 2 acts as a calf thymus DNA intercalators with a binding constant of 4.0 × 10 5 M -1 in buffered 50 mM NaCl, as evidenced by UV-vis and luminescence titrations, steady-state emission quenching by [Fe(CN) 6] 4-, DNA competitive binding with ethidium bromide, reverse salt titrations and viscosity measurements.
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Fraud. 235.110 Section 235.110 Public Welfare... PROGRAMS § 235.110 Fraud. State plan requirements: A State plan under title I, IV-A, X, XIV, or XVI of the Social Security Act must provide: (a) That the State agency will establish and maintain: (1) Methods and...
PROPER MOTIONS OF THE HH 110/270 SYSTEM
Energy Technology Data Exchange (ETDEWEB)
Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)
2012-05-15
We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.
49 CFR 174.110 - Car magazine.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Car magazine. 174.110 Section 174.110...) Materials § 174.110 Car magazine. When specially authorized by the carrier, Division 1.1 or 1.2 (explosive... packages of Class 1 (explosive) materials are placed in a “magazine” box made of sound lumber not less than...
DEFF Research Database (Denmark)
Deng, Lei; Pang, Xiaodan; Zhang, Xu
2013-01-01
We report on the transmission of 8 Gb/s 0 dB PAPR 16QAM-OFDM W-band (75-110 GHz) signals over 22.8km SMF without phase noise compensation by using a phase modulator in the optical heterodyne up-convertor....
Fine structure of the 1s5f and 1s5g levels of He I
International Nuclear Information System (INIS)
Kriescher, Y.; Hilt, O.; Oppen, G. v.
1994-01-01
The fine structure of the 1s 5f and 1s 5g levels of He I was measured using microwave spectroscopy. The helium atoms were excited by ion impact, and the eleven allowed 1s 5f 2S+1 F J -1s 5g 2S'+1 G J , transitions near ν∼15 GHz were induced and detected by measuring the 1s 4d-1s 2p or 1s 3d-1s 2p spectral-line intensities of the impact radiation as a function of the microwave frequency. The measured transition frequencies are in accord with theoretical values and, except for one transition frequency, with earlier experimental data. The existing discrepancy between these earlier data and theory could be solved. (orig.)
Nuclear-physical properties of 105,106m,110mAg
International Nuclear Information System (INIS)
Popov, Yu. S.; Zakharova, L. V.; Sadulin, V. V.; Andreev, O. I.; Pakhomov, A. N.
2005-01-01
The nuclear-physical properties of the nuclides 105,106m,110m Ag, which are concomitant nuclides in reactor production of 103 Pd and 109 Cd used in metrology of ionizing radiations and in nuclear medicine, were studied. The following quantities were determined by semiconductor X-ray and γ-ray spectrometry: the parameter K α /K β of X-ray K radiation accompanying the decay of 110m Ag and the intensities of γ-ray quanta with the energies of 280 and 345 keV ( 105 Ag); 430, 451, and 512 keV ( 106m Ag); 658, 764, 885, 938, and 1384 keV ( 110m Ag). The half-lives determined using the above γ-ray lines are as follows: T 1/2 ( 105 Ag) = 41.2 ± 0.1 days; T 1/2 ( 106m Ag) = 8.30 ± 0.07 days. The errors are given for 95% confidence level [ru
International Nuclear Information System (INIS)
Dehnbostel, C.; Feltgen, R.; Hoffmann, G.
1990-01-01
The radiative deexcitation cross section for He * (2 1 S) in collisions with He has been measured in the collision energy range from 40 to 110 meV. The experimental results agree well with quantal distorted-wave calculations of Zygelman and Dalgarno [Phys. Rev. A 38, 1877 (1988)]. The measured radiative quenching cross sections for the systems He * (2 1 S)+Ar,Kr,Xe manifest a scaling law for fixed collision energy with α 2 as the scaling parameter, where α is the static dipole polarizability of the heavier rare gas
International Nuclear Information System (INIS)
Kusakabe, Kiyoko; Yokoyama, Kunihiko; Ito, Koichi
2012-01-01
This study was undertaken to measure the radiation exposure level of caregivers following outpatient NaI (I-131) 1,110 MBq therapy for remnant thyroid ablation after total thyroidectomy in patients with differentiated thyroid cancer, and to evaluate the influence of activities of daily living on radiation exposure level, with the goal of proposing an optimum method of I-131 therapy. The study included 37 patients with differentiated thyroid cancer, who had undergone total thyroidectomy and received outpatient based remnant thyroid ablation using NaI (I-131) 1,110 MBq, who were satisfying the following requirements: patients who have no evidence of distant metastases, whose living environments were appropriate for outpatient I-131 (1,110 MBq) therapy, and patients who gave written informed consent. The dose rate at a distance of 1 m from the body surface of the patient at the moment of release was measured using survey meters of the GM type or ionization chamber type. The dose level for the caregiver was measured with a personal dosimeter in all cases. The dose rate at a distance of 1 m from the patient's body surface 1 h after I-131 administration was in the range of 29-115 μSv/h (mean 63.8 μSv/h). The 7-day cumulative effective dose of caregivers was 0.11±0.08 mSv, on an average, in 34 dosimeters. In 31 of 34 dosimeters, cumulative effective dose of caregivers was below 0.2 mSv. Dose levels exceeding 0.2 mSv were recorded in 3 cases (0.21, 0.35 and 0.43 mSv in one case each). These results suggest that the exposure level of family members (caregiver and others) was minimal and is lower than the radiation levels affecting human environments. Outpatient-based remnant thyroid ablation with I-131 (1,110 MBq) performed after total thyroidectomy in patients with differentiated thyroid cancer is safe if applied in accordance with the appropriate supervision and guidance by experts with certain qualifications. (author)
Shi, Ruili; Wang, Pengju; Tang, Lingli; Huang, Xiaoming; Chen, Yonggang; Su, Yan; Zhao, Jijun
2018-04-05
Using a genetic algorithm incorporated in density functional theory, we explore the ground state structures of fluoride anion-water clusters F - (H 2 O) n with n = 1-10. The F - (H 2 O) n clusters prefer structures in which the F - anion remains at the surface of the structure and coordinates with four water molecules, as the F - (H 2 O) n clusters have strong F - -H 2 O interactions as well as strong hydrogen bonds between H 2 O molecules. The strong interaction between the F - anion and adjacent H 2 O molecule leads to a longer O-H distance in the adjacent molecule than in an individual water molecule. The simulated infrared (IR) spectra of the F - (H 2 O) 1-5 clusters obtained via second-order vibrational perturbation theory (VPT2) and including anharmonic effects reproduce the experimental results quite well. The strong interaction between the F - anion and water molecules results in a large redshift (600-2300 cm -1 ) of the adjacent O-H stretching mode. Natural bond orbital (NBO) analysis of the lowest-energy structures of the F - (H 2 O) 1-10 clusters illustrates that charge transfer from the lone pair electron orbital of F - to the antibonding orbital of the adjacent O-H is mainly responsible for the strong interaction between the F - anion and water molecules, which leads to distinctly different geometric and vibrational properties compared with neutral water clusters.
49 CFR 28.110 - Self-evaluation.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Self-evaluation. 28.110 Section 28.110 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.110 Self-evaluation...
42 CFR 136.110 - Facilities construction.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Facilities construction. 136.110 Section 136.110..., DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH Grants for Development, Construction, and Operation of Facilities and Services § 136.110 Facilities construction. In addition to other requirements of this subpart...
9 CFR 3.110 - Veterinary care.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Veterinary care. 3.110 Section 3.110 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Mammals Animal Health and Husbandry Standards § 3.110 Veterinary care. (a) Newly acquired marine mammals...
11 CFR 110.17 - Price index increase.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Price index increase. 110.17 Section 110.17... PROHIBITIONS § 110.17 Price index increase. (a) Price index increases for party committee expenditure... 11 CFR 109.32 and 110.8 shall be increased by the percent difference between the price index, as...
STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
20 CFR 365.110 - Self-evaluation.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Self-evaluation. 365.110 Section 365.110... § 365.110 Self-evaluation. (a) The agency shall, by December 27, 1989, evaluate its current policies and... self-evaluation process by submitting comments (both oral and written). (c) The agency shall, until at...
21 CFR 165.110 - Bottled water.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...
Temperature-programmed desorption study of NO reactions on rutile TiO2(110)-1×1
Energy Technology Data Exchange (ETDEWEB)
Kim, Boseong; Dohnalek, Zdenek; Szanyi, Janos; Kay, Bruce D.; Kim, Yu Kwon
2016-10-01
Systematic temperature-programmed desorption (TPD) studies of NO adsorption and reactions on rutile TiO2(110)-1×1 surface reveal several distinct reaction channels in a temperature range of 50 – 500 K. NO readily reacts on TiO2(110) to form N2O which desorbs between 50 and 200 K (LT N2O channels), which leaves the TiO2 surface populated with adsorbed oxygen atoms (Oa) as a byproduct of N2O formation. In addition, we observe simultaneous desorption peaks of NO and N2O at 270 K (HT1 N2O) and 400 K (HT2 N2O), respectively, both of which are attributed to reaction-limited processes. No N-derived reaction product desorbs from TiO2(110) surface above 500 K or higher, while the surface may be populated with Oa’s and oxidized products such as NO2 and NO3. The adsorbate-free TiO2 surface with oxygen vacancies can be regenerated by prolonged annealing at 850 K or higher. Detailed analysis of the three N2O desorption yields reveals that the surface species for the HT channels are likely to be various forms of NO dimers.
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0112885 includes chemical, meteorological, physical and time series data collected from MOORING_TAO110W and MOORING_TAO110W0N in the North Pacific...
DEFF Research Database (Denmark)
Zibar, Darko; Sambaraju, Rakesh; Caballero Jambrina, Antonio
2010-01-01
We report on the first demonstration of QPSK based Wireless-over-Fibre link in 75-110GHz band with a record capacity of up to 16Gb/s. Photonic wireless signal generation by heterodyne beating of free-running lasers and baud-rate digital coherent detection are employed....
46 CFR 110.15-1 - Definitions.
2010-10-01
... vessel that normally navigates the waters of any ocean or the Gulf of Mexico 20 nautical miles or less... 110.10-1), section 4-8-3/11. Ocean vessel means a vessel that navigates the waters of any ocean or the... means a vessel that navigates exclusively on the Great Lakes and their connecting and tributary waters...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL
2010-04-01
... entered into under the Indian Self-Determination and Education Assistance Act (25 U.S.C. § 450f et seq.). ... 25 Indians 1 2010-04-01 2010-04-01 false Can these regulations be administered by tribes, on the... INTERIOR LAND AND WATER LEASES AND PERMITS General Provisions § 162.110 Can these regulations be...
X-ray diffraction investigation of the sulphur induced 4x1 reconstruction of Ni(110)
DEFF Research Database (Denmark)
Foss, M.; Feidenhans'l, R.; Nielsen, M.
1993-01-01
The atomic structure of the Ni(110)4 x 1-S reconstruction has been determined on the basis of surface X-ray diffraction measurements. An analysis of the in-plane diffraction data shows that the model consists of Ni rows along the [001] direction, two for every 4 x 1 unit cell, corresponding to 0....
THE EFFICACY OF THE CABLES OF 6–110 KW WITH XLPE INSULATION. Part 2
Directory of Open Access Journals (Sweden)
M. A. Korotkevich
2017-01-01
Full Text Available The assessment of the suitability of cables of 6–110 kW with XLPE insulation in comparison with cables of the same voltage but possessing paper-oil insulation has been fulfilled on the basis of the method of multi-objective optimization that makes it possible to account not only the quantitative characteristics (of reduced costs, but also qualitative ones. As an indicator of the reliability of the cable line the maximum mean time to failure (the value inversely proportional to the parameter of succession of failures, which is an order more for cable lines with XLPE insulation than for cable lines with paper insulation, is adopted. A comprehensive assessment of the convenience of installation of cable lines revealed that the installation of cable with XLPE insulation features a 1.2–1.6 times easier installation as compared to three-wire (voltage 10 kW and 1.4 times easier installation as compared to single-core oil-filled cables (voltage of 110 kW. The efficacy of the cables 6–110 kW with XLPE insulation is proved on the basis on the method of multi-objective optimization, that took into account as the costs for the construction and operation of cable lines and the reliability of its operation, ease of its installation and other quality indicators. If the goals taken into account are considered as equally important, the polyethylene-insulated cables for a voltage of 10–110 kW is more efficient as compared to three-wire (voltage 10 kW and solid (110 kW cables with paper insulation. Herewith, the cost of the cable with XLPE insulation may exceed the cost of cable with paper insulation up to two times. If the most important aim is to provide the minimum reduced costs for the construction and operation of the cable line, the use of cables with XLPE insulation for voltage of 10 kW is most advisable in individual cases.
Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J H; Okkenhaug, Klaus; Vanhaesebroeck, Bart
2008-06-17
The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110alpha, p110beta, and p110delta) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110alpha and p110delta to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110gamma class IB PI3K lack SH2 domains and instead couple p110gamma to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110beta and cells derived from a p110beta-deficient mouse line, that p110beta is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110beta and p110gamma contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110beta but not p110gamma, p110beta mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110gamma in these cells reduced the contribution of p110beta to GPCR signaling. Taken together, these data show that p110beta and p110gamma can couple redundantly to the same GPCR agonists. p110beta, which shows a much broader tissue distribution than the leukocyte-restricted p110gamma, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110gamma expression is low or absent.
Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J. H.; Okkenhaug, Klaus; Vanhaesebroeck, Bart
2008-01-01
The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110α, p110β, and p110δ) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110α and p110δ to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110γ class IB PI3K lack SH2 domains and instead couple p110γ to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110β and cells derived from a p110β-deficient mouse line, that p110β is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110β and p110γ contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110β but not p110γ, p110β mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110γ in these cells reduced the contribution of p110β to GPCR signaling. Taken together, these data show that p110β and p110γ can couple redundantly to the same GPCR agonists. p110β, which shows a much broader tissue distribution than the leukocyte-restricted p110γ, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110γ expression is low or absent. PMID:18544649
An investigation of Oxygen adsorption on W(110) using reflectance anisotropy spectroscopy
International Nuclear Information System (INIS)
Zeybek, O.
2004-01-01
The probe of metal surface electronic structure and results of the oxidation of a BCC material and the first Joint Density of States interpretation of the spectrum from same metal have been presented. The surface sensitivity of RAS has been exploited when applied to a cubic single crystal to study the surface electronic structure of W(110) and the resulting chemisorption-induced changes upon exposure to oxygen. Oxidation of the surface is monitored until a final exposure of 10 Langmuirs is reached. A decrease of reflectance anisotropy signal is obtained with increasing oxygen coverage on the substrate and a coverage of ∼0.75 ML results in zero anisotropy over the reflectance anisotropy energy range
An investigation of Oxygen adsorption on W(110) using reflectance anisotropy spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Zeybek, O [Department of Physics, Balikesir University, Balikesir (Turkey)
2004-07-01
The probe of metal surface electronic structure and results of the oxidation of a BCC material and the first Joint Density of States interpretation of the spectrum from same metal have been presented. The surface sensitivity of RAS has been exploited when applied to a cubic single crystal to study the surface electronic structure of W(110) and the resulting chemisorption-induced changes upon exposure to oxygen. Oxidation of the surface is monitored until a final exposure of 10 Langmuirs is reached. A decrease of reflectance anisotropy signal is obtained with increasing oxygen coverage on the substrate and a coverage of {approx}0.75 ML results in zero anisotropy over the reflectance anisotropy energy range.
PROPER MOTIONS OF THE HH 110/270 SYSTEM
International Nuclear Information System (INIS)
Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.
2012-01-01
We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.
Epitaxial graphene-encapsulated surface reconstruction of Ge(110)
Campbell, Gavin P.; Kiraly, Brian; Jacobberger, Robert M.; Mannix, Andrew J.; Arnold, Michael S.; Hersam, Mark C.; Guisinger, Nathan P.; Bedzyk, Michael J.
2018-04-01
Understanding and engineering the properties of crystalline surfaces has been critical in achieving functional electronics at the nanoscale. Employing scanning tunneling microscopy, surface x-ray diffraction, and high-resolution x-ray reflectivity experiments, we present a thorough study of epitaxial graphene (EG)/Ge(110) and report a Ge(110) "6 × 2" reconstruction stabilized by the presence of epitaxial graphene unseen in group-IV semiconductor surfaces. X-ray studies reveal that graphene resides atop the surface reconstruction with a 0.34 nm van der Waals (vdW) gap and provides protection from ambient degradation.
33 CFR 110.25 - Salem Sound, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Salem Sound, Mass. 110.25 Section 110.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.25 Salem Sound, Mass. (a) Beverly Harbor, north of Salem...
33 CFR 110.238 - Apra Harbor, Guam.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. 110.238 Section 110.238 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.238 Apra Harbor, Guam. (a) The anchorage grounds (Datum: WGS...
2010-07-01
... DISABILITIES Disability Ratings The Digestive System § 4.110 Ulcers. Experience has shown that the term “peptic ulcer” is not sufficiently specific for rating purposes. Manifest differences in ulcers of the stomach... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Ulcers. 4.110 Section 4...
12 CFR 1.110 - Taxing powers of a State or political subdivision.
2010-01-01
... impact of any possible limitations regarding the State's or political subdivision's taxing powers, as... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Taxing powers of a State or political subdivision. 1.110 Section 1.110 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY...
27 CFR 1.10 - Meaning of terms.
2010-04-01
..., NONINDUSTRIAL USE OF DISTILLED SPIRITS AND WINE, BULK SALES AND BOTTLING OF DISTILLED SPIRITS Definitions § 1.10... the Federal Alcohol Administration Act, Nonindustrial Use of Distilled Spirits and Wine, Bulk Sales... to engage in activities at a particular location. Brandy. Brandy or wine spirits for addition to...
24 CFR 110.15 - Location of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Location of posters. 110.15 Section 110.15 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF... HOUSING POSTER Requirements for Display of Posters § 110.15 Location of posters. All fair housing posters...
37 CFR 1.10 - Filing of correspondence by “Express Mail.”
2010-07-01
... Office to Addressee” service of the United States Postal Service (USPS) will be considered filed with the...Express Mail.â 1.10 Section 1.10 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions General...
46 CFR 7.110 - Mamala Bay, HI.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Mamala Bay, HI. 7.110 Section 7.110 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Hawaii § 7.110 Mamala Bay, HI. A line drawn from Barbers Point Light to Diamond Head Light. Pacific Coast ...
Efficient reduction of Cys110 thiyl radical by glutathione in human myoglobin
Nagao, Satoshi; Asami, Osamu; Yasui, Hiroyuki; Hirota, Shun
2011-01-01
Human myoglobin (hMb) possesses a cysteine (Cys) residue which is rare among mammalian Mbs. To investigate the effects of this unique Cys residue at the amino acid position 110 (Cys110) on hMb reactions, we studied the reactions of wild type (WT) methMb and its alanine mutant at Cys110 (C110A) with H2O2, particularly in the presence of reduced glutathione (GSH) which is well known as a reducing agent. The formation rates of the ferryloxo (Fe(IV) = O) species by H2O2 under air were about the s...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.110 Section 28... Manufacturing Bonded Warehouse Losses § 28.110 Losses. Where there has been a loss of distilled spirits while in... of subpart O of this part, with respect to losses of spirits after withdrawal without payment of tax...
International Nuclear Information System (INIS)
Chernov, Sergii
2016-01-01
Recent experiments discovered a new class of materials called topological insulators and started an extensive investigation in order to find more materials of such type and to understand and explore the opening perspectives in fundamental science and application. These materials exhibit a Dirac-type (massless) electronic state, bridging the fundamental band gap. Surprisingly, a strongly spin-polarized surface state with linear dispersion resembling that of Dirac type was found on the already well-investigated W(110) surface. This rose the question of the existence of the same non-trivial electron state on other metal surfaces. The present work describes the investigation of surface electronic states on the Mo(110) surface, their dispersion and transformation upon surface oxidation. This system is isoelectronic to the case of W(110) but due to the lower atomic number the spin-orbit interaction responsible for local band gap formation is substantially decreased by a factor of 5. The Mo(110) surface was shown to exhibit a linearly dispersing state quite similar to the one on W(110), but within a smaller energy range of 120 meV, with the Dirac point lying in the center of a local band gap in k-space. The experimental investigations were performed with the help of momentum microscopy, using a Ti:sapphire laser in the lab and synchrotron radiation at BESSY II, Berlin. The results show good agreement with theoretical calculations of the band structure and photoemission patterns for clean Mo(110). The fully parallel 3D acquisition scheme allowed to visualize the full surface Brillouin zone of the sample up to few eV binding energy within a single exposure of typically less than 30 min. This opens the door to future time-resolved experiments with maximum detection efficiency.
Energy Technology Data Exchange (ETDEWEB)
Chernov, Sergii
2016-04-20
Recent experiments discovered a new class of materials called topological insulators and started an extensive investigation in order to find more materials of such type and to understand and explore the opening perspectives in fundamental science and application. These materials exhibit a Dirac-type (massless) electronic state, bridging the fundamental band gap. Surprisingly, a strongly spin-polarized surface state with linear dispersion resembling that of Dirac type was found on the already well-investigated W(110) surface. This rose the question of the existence of the same non-trivial electron state on other metal surfaces. The present work describes the investigation of surface electronic states on the Mo(110) surface, their dispersion and transformation upon surface oxidation. This system is isoelectronic to the case of W(110) but due to the lower atomic number the spin-orbit interaction responsible for local band gap formation is substantially decreased by a factor of 5. The Mo(110) surface was shown to exhibit a linearly dispersing state quite similar to the one on W(110), but within a smaller energy range of 120 meV, with the Dirac point lying in the center of a local band gap in k-space. The experimental investigations were performed with the help of momentum microscopy, using a Ti:sapphire laser in the lab and synchrotron radiation at BESSY II, Berlin. The results show good agreement with theoretical calculations of the band structure and photoemission patterns for clean Mo(110). The fully parallel 3D acquisition scheme allowed to visualize the full surface Brillouin zone of the sample up to few eV binding energy within a single exposure of typically less than 30 min. This opens the door to future time-resolved experiments with maximum detection efficiency.
7 CFR 917.110 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 917.110 Section 917.110 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... CALIFORNIA Rules and Regulations General § 917.110 Communications. Unless otherwise prescribed in this...
Energy Technology Data Exchange (ETDEWEB)
Martin-Gondre, L. [Institut UTINAM-CNRS UMR 6213, Université de Franche-Comté, 16 Route de Gray, 25030 Besançon Cedex (France); Donostia International Physics Center (DIPC), Paseo Manuel de Lardizabal 4, 20018 Donostia-San Sebastián (Spain); Juaristi, J. I. [Departamento de Física de Materiales, Facultad de Químicas (UPV/EHU), Apartado 1072, 20080 Donostia-San Sebastián (Spain); Centro de Física de Materiales CFM/MPC (CSIC-UPV/EHU), Paseo Manuel de Lardizabal 5, 20018 Donostia-San Sebastián (Spain); Donostia International Physics Center (DIPC), Paseo Manuel de Lardizabal 4, 20018 Donostia-San Sebastián (Spain); Blanco-Rey, M. [Departamento de Física de Materiales, Facultad de Químicas (UPV/EHU), Apartado 1072, 20080 Donostia-San Sebastián (Spain); Donostia International Physics Center (DIPC), Paseo Manuel de Lardizabal 4, 20018 Donostia-San Sebastián (Spain); Díez Muiño, R.; Alducin, M. [Centro de Física de Materiales CFM/MPC (CSIC-UPV/EHU), Paseo Manuel de Lardizabal 5, 20018 Donostia-San Sebastián (Spain); Donostia International Physics Center (DIPC), Paseo Manuel de Lardizabal 4, 20018 Donostia-San Sebastián (Spain)
2015-02-21
Using ab initio molecular dynamics (AIMD) calculations, we investigate the role of the van der Waals (vdW) interaction in the dissociative adsorption of N{sub 2} on W(110). Hitherto, existing classical dynamics calculations performed on six-dimensional potential energy surfaces based on density functional theory (DFT), and the semi-local PW91 and RPBE [Hammer et al. Phys. Rev. B 59, 7413 (1999)] exchange-correlation functionals were unable to fully describe the dependence of the initial sticking coefficient on the molecular beam incidence conditions as found in experiments. N{sub 2} dissociation on W(110) was shown to be very sensitive not only to short molecule-surface distances but also to large distances where the vdW interaction, not included in semilocal-DFT, should dominate. In this work, we perform a systematic study on the dissociative adsorption using a selection of existing non-local functionals that include the vdW interaction (vdW-functionals). Clearly, the inclusion of the non-local correlation term contributes in all cases to correct the unrealistic energy barriers that were identified in the RPBE at large molecule-surface distances. Among the tested vdW-functionals, the original vdW-DF by Dion et al. [Phys. Rev. Lett. 92, 246401 (2004)] and the ulterior vdW-DF2 give also an adequate description of the N{sub 2} adsorption energy and energy barrier at the transition state, i.e., of the properties that are commonly used to verify the quality of any exchange-correlation functional. However, the results of our AIMD calculations, which are performed at different incidence conditions and hence extensively probe the multi-configurational potential energy surface of the system, do not seem as satisfactory as the preliminary static analysis suggested. When comparing the obtained dissociation probabilities with existing experimental data, none of the used vdW-functionals seems to provide altogether an adequate description of the N{sub 2}/W(110) interaction at
High-temperature oxidation kinetics of sponge-based E110 cladding alloy
Yan, Yong; Garrison, Benton E.; Howell, Mike; Bell, Gary L.
2018-02-01
Two-sided oxidation experiments were recently conducted at 900°C-1200 °C in flowing steam with samples of sponge-based Zr-1Nb alloy E110. Although the old electrolytic E110 tubing exhibited a high degree of susceptibility to nodular corrosion and experienced breakaway oxidation rates in a relatively short time, the new sponge-based E110 demonstrated steam oxidation behavior comparable to Zircaloy-4. Sample weight gain and oxide layer thickness measurements were performed on oxidized E110 specimens and compared to oxygen pickup and oxide layer thickness calculations using the Cathcart-Pawel correlation. Our study shows that the sponge-based E110 follows the parabolic law at temperatures above 1015 °C. At or below 1015 °C, the oxidation rate was very low when compared to Zircaloy-4 and can be represented by a cubic expression. No breakaway oxidation was observed at 1000 °C for oxidation times up to 10,000 s. Arrhenius expressions are given to describe the parabolic rate constants at temperatures above 1015 °C and cubic rate constants are provided for temperatures below 1015 °C. The weight gains calculated by our equations are in excellent agreement with the measured sample weight gains at all test temperatures. In addition to the as-fabricated E110 cladding sample, prehydrided E110 cladding with hydrogen concentrations in the 100-150 wppm range was also investigated. The effect of hydrogen content on sponge-based E110 oxidation kinetics was minimal. No significant difference was found between as-fabricated and hydrided samples with regard to oxygen pickup and oxide layer thickness for hydrogen contents below 150 wppm.
33 CFR 110.208 - Buffalo Harbor, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...
The DIII-D 3 MW, 110 GHz ECH System
International Nuclear Information System (INIS)
Callis, R.W.; Lohr, J.; Ponce, D.; O'Neill, R.C.; Prater, R.; Luce, T.C.
1999-01-01
Three 110 GHz gyrotrons with nominal output power of 1 MW each have been installed and are operational on the DIII-D tokamak. One gyrotron is built by Gycom and has a nominal rating of 1 MW and a 2 s pulse length, with the pulse length being determined by the maximum temperature allowed on the edge cooled Boron Nitride window. The second and third gyrotrons were built by Communications and Power Industries (CPI). The first CPI gyrotron uses a double disc FC-75 cooled sapphire window which has a pulse length rating of 0.8 s at 1 MW, 2s at 0.5 MW and 10s at 0.35 MW. The second CPI gyrotron, utilizes a single disc chemical-vapor-deposition diamond window, that employs water cooling around the edge of the disc. Calculation predict that the diamond window should be capable of full 1 MW cw operation. All gyrotrons are connected to the tokamak by a low-loss-windowless evacuated transmission line using circular corrugated waveguide for propagation in the HEl 1 mode. Each waveguide system incorporates a two mirror launcher which can steer the rf beam poloidally from the center to the outer edge of the plasma. Central current drive experiments with the two gyrotrons with 1.5 MW of injected power drove about 0.17 MA. Results from using the three gyrotron systems will be reported as well as the plans to upgrade the system to 6 MW
33 CFR 110.85 - Niagara River, Youngstown, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River, Youngstown, N.Y... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.85 Niagara River, Youngstown, N.Y. (a) Area 1... of the Niagara River at latitude 43°14′33″ N, longitude 79°03′7.5″ W; thence westerly to a point at...
Shake-up transitions in S 2p, S 2s and F 1s photoionization of the SF6 molecule
International Nuclear Information System (INIS)
Decleva, P; Fronzoni, G; Kivimaeki, A; Alvarez Ruiz, J; Svensson, S
2009-01-01
Shake-up transitions occurring upon core photoionization in the SF 6 molecule have been studied experimentally and theoretically. The S 2p, S 2s and F 1s shake-up satellite photoelectron spectra were measured using Al Ka radiation at 1487 eV photon energy. They have been interpreted with the aid of ab initio configuration interaction calculations in the sudden-limit approximation. For the S 2p spectrum, conjugate shake-up transitions were also calculated. Clear evidence of conjugate processes is observed in the S 2p shake-up spectrum measured at 230 eV photon energy. The experimental and theoretical S 2p and S 2s shake-up spectra show very similar structures mainly due to orbital relaxation involving S 3s and 3p participation. For the calculation of the F 1s shake-up spectrum, the symmetry lowering of the molecule in the final states was considered, resulting in a good agreement with the experiment.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Pilots. 230.110 Section 230.110 Transportation... and Equalizing System § 230.110 Pilots. (a) General provisions. Pilots shall be securely attached... clearance. The minimum clearance of pilot above the rail shall be 3 inches and the maximum clearance shall...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk. 131.110 Section 131.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.110 Milk. (a...
Simple countermeasures against the TM110-beam-blowup-mode in biperiodic structures
International Nuclear Information System (INIS)
Euteneuer, H.; Herminghaus, H.; Schoeler, H.
1984-01-01
The two fundamental methods of fighting beam blow-up in rf-accelerating-structures are staggered detuning and selective Q-spoiling of their higher order modes. Biperiodic structures offer a very simple way of applying the latter technique of the most dangerous TM 110 -like blowup mode at 1.7 times the accelerating frequency: letting this mode propagate but giving a large gap to the TM 110 -passband. This gap must be positive for electric coupling (f(phi=0) =1.7c. With asymmetric coupling elements between the cavities of a structure, one has a simple tool for staggered detuning: a change of the relative orientation of these elements spreads the resonance frequencies not only of the TM 110 -mode, but of at least all dipole modes. (orig.)
27 CFR 21.110 - Gasoline, unleaded.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Gasoline, unleaded. 21.110....110 Gasoline, unleaded. Conforms to specifications as established by the American Society for Testing...-79. Any of the “seasonal and geographical” volatility classes for unleaded gasoline are considered...
44 CFR 16.110 - Self-evaluation.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Self-evaluation. 16.110... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.110 Self-evaluation. (a) The agency... handicaps or organizations representing individuals with handicaps, to participate in the self-evaluation...
p110α and p110β isoforms of PI3K signaling: are they two sides of the same coin?
Singh, Paramjeet; Dar, Mohd Saleem; Dar, Mohd Jamal
2016-09-01
Class-1 phosphatidylinositol-3-kinases (PI3Ks) are activated by a variety of extracellular stimuli and have been implicated in a wide range of cellular processes. p110α and p110β are the two most studied isoforms of the class-1A PI3K signaling pathway. Although these two isoforms are ubiquitously expressed and play multiple redundant roles, they also have distinct functions within the cell. More recently, p110α and p110β isoforms have been shown to translocate into the nucleus and play a role in DNA replication and repair, and in cell cycle progression. In the following Review article, we discuss the overlapping and unique roles of p110α and p110β isoforms with a particular focus on their structure, expression analysis, subcellular localization, and signaling contributions in various cell types and model organisms. © 2016 Federation of European Biochemical Societies.
Chang, Shu-Wei; Chang-Hasnain, Connie J.; Wang, Hailin
2005-03-01
The electromagnetically induced transparency from spin coherence has been proposed in [001] quantum wells recently. [1] The spin coherence is a potential candidate to demonstrate semiconductor-based slow light at room temperature. However, the spin coherence time is not long enough to demonstrate a significant slowdown factor in [001] quantum wells. Further, the required transition of light-hole excitons lies in the absorption of heavy-hole continuum states. The extra dephasing and absorption from these continuum states are drawbacks for slow light. Here, we propose to use [110] strained quantum wells instead of [001] quantum wells. The long spin relaxation time in [110] quantum wells at room temperature, and thus more robust spin coherence, [2] as well as the strain-induced separation [3, 4] of the light-hole exciton transition from the heavy-hole continuum absorption can help to slow down light in quantum wells. [1] T. Li, H. Wang, N. H. Kwong, and R. Binder, Opt. Express 11, 3298 (2003). [2] Y. Ohno, R. Terauchi, T. Adachi, F. Matsukura, and H. Ohno, Phys. Rev. Lett. 83, 4196 (1999). [3] C. Y. P. Chao and S. L. Chuang, Phys. Rev. B 46, 4110 (1992). [4] C. Jagannath, E. S. Koteles, J. Lee, Y. J. Chen, B. S. Elman, and J. Y. Chi, Phys. Rev. B 34, 7027 (1986).
Poopal, Ashwini C; Schroeder, Lindsay M; Horn, Paul S; Bassell, Gary J; Gross, Christina
2016-01-01
Dysfunctions in the PI3K/mTOR pathway have gained a lot of attention in autism research. This was initially based on the discovery of several monogenic autism spectrum disorders with mutations or defects in PI3K/mTOR signaling components. Recent genetic studies corroborate that defective PI3K/mTOR signaling might be a shared pathomechanism in autism disorders of so far unknown etiology, but functional molecular analyses in human cells are rare. The goals of this study were to perform a functional screen of cell lines from patients with idiopathic autism for defects in PI3K/mTOR signaling, to test if further functional analyses are suitable to detect underlying molecular mechanisms, and to evaluate this approach as a biomarker tool to identify therapeutic targets. We performed phospho-S6- and S6-specific ELISA experiments on 21 lymphoblastoid cell lines from the AGRE collection and on 37 lymphoblastoid cell lines from the Simons Simplex Collection and their healthy siblings. Cell lines from one individual with increased S6 phosphorylation and his multiplex family were analyzed in further detail to identify upstream defects in PI3K signaling associated with autism diagnosis. We detected significantly increased S6 phosphorylation in 3 of the 21 lymphoblastoid cell lines from AGRE compared to a healthy control and in 1 of the 37 lymphoblastoid cell lines from the Simons Simplex Collection compared to the healthy sibling. Further analysis of cells from one individual with elevated S6 phosphorylation showed increased expression of the PI3K catalytic subunit p110δ, which was also observed in lymphoblastoid cells from other autistic siblings but not unaffected members in his multiplex family. The p110δ-selective inhibitor IC87114 reduced elevated S6 phosphorylation and protein synthesis in this cell line. Our results suggest that functional analysis of PI3K/mTOR signaling is a biomarker tool to identify disease-associated molecular defects that could serve as therapeutic
Development of axial asymmetry in the neutron-rich nucleus {sup 110}Mo
Energy Technology Data Exchange (ETDEWEB)
Watanabe, H., E-mail: hiroshi@ribf.riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yamaguchi, K.; Odahara, A. [Department of Physics, Osaka University, Machikaneyama-machi 1-1, Osaka 560-0043 Toyonaka (Japan); Sumikama, T. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Nishimura, S. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yoshinaga, K. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Li, Z. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Miyashita, Y. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Sato, K. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Prochniak, L. [Institute of Physics, Maria Curie-Sklodowska University, pl. M. Curie-Sklodowskiej 1, 20-031 Lublin (Poland); Baba, H. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Berryman, J.S. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Blasi, N. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Bracco, A.; Camera, F. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Dipartimento di Fisica, Universita di Milano, via Celoria 16, I-20133 Milano (Italy); Chiba, J. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Doornenbal, P. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Go, S.; Hashimoto, T.; Hayakawa, S. [Center for Nuclear Study, University of Tokyo, Hirosawa 2-1, Wako, Saitama 351-0198 (Japan)
2011-10-19
The neutron-rich nucleus {sup 110}Mo has been investigated by means of {gamma}-ray spectroscopy following the {beta}-decay of {sup 110}Nb, produced using in-flight fission of a {sup 238}U beam at 345 MeV/nucleon at the RIBF facility. In addition to the ground-band members reported previously, spectroscopic information on the low-lying levels of the quasi-{gamma} band built on the second 2{sup +} state at 494 keV has been obtained for the first time. The experimental finding of the second 2{sup +} state being lower than the yrast 4{sup +} level suggests that axially-asymmetric {gamma} softness is substantially enhanced in this nucleus. The experimental results are compared with model calculations based on the general Bohr Hamiltonian method. The systematics of the low-lying levels in even-even A{approx}110 nuclei is discussed in comparison with that in the neutron-rich A{approx}190 region, by introducing the quantity E{sub S}/E(2{sub 1}{sup +}), E{sub S}=E(2{sub 2}{sup +})-E(4{sub 1}{sup +}), as a global signature of the structural evolution involving axial asymmetry.
Experimental results for a 1.5 MW, 110 GHz gyrotron oscillator with reduced mode competition
Choi, E. M.; Marchewka, C. D.; Mastovsky, I.; Sirigiri, J. R.; Shapiro, M. A.; Temkin, R. J.
2006-02-01
A new result from a 110GHz gyrotron at MIT is reported with an output power of 1.67MW and an efficiency of 42% when operated at 97kV and 41A for 3μs pulses in the TE22,6 mode. These results are a major improvement over results obtained with an earlier cavity design, which produced 1.43MW of power at 37% efficiency. These new results were obtained using a cavity with a reduced output taper angle and a lower ohmic loss when compared with the earlier cavity. The improved operation is shown experimentally to be the result of reduced mode competition from the nearby TE19,7 mode. The reduced mode competition agrees well with an analysis of the startup scenario based on starting current simulations. The present results should prove useful in planning long pulse and CW versions of the 110GHz gyrotron.
Experimental results for a 1.5 MW, 110 GHz gyrotron oscillator with reduced mode competition
International Nuclear Information System (INIS)
Choi, E.M.; Marchewka, C.D.; Mastovsky, I.; Sirigiri, J.R.; Shapiro, M.A.; Temkin, R.J.
2006-01-01
A new result from a 110 GHz gyrotron at MIT is reported with an output power of 1.67 MW and an efficiency of 42% when operated at 97 kV and 41 A for 3 μs pulses in the TE 22,6 mode. These results are a major improvement over results obtained with an earlier cavity design, which produced 1.43 MW of power at 37% efficiency. These new results were obtained using a cavity with a reduced output taper angle and a lower ohmic loss when compared with the earlier cavity. The improved operation is shown experimentally to be the result of reduced mode competition from the nearby TE 19,7 mode. The reduced mode competition agrees well with an analysis of the startup scenario based on starting current simulations. The present results should prove useful in planning long pulse and CW versions of the 110 GHz gyrotron
Characterization of Rh films on Ta(110)
International Nuclear Information System (INIS)
Jiang, L.Q.; Ruckman, M.W.; Strongin, M.
1989-01-01
The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low energy electron diffraction and low energy ion scattering. From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh/Ta(110) appears to grow in the Stranski-Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at 1.2 and 2. 5 eV binding energy during the initial phase of thin film growth (0 3.7 ML). Photoemission data for CO covered surfaces show that CO dissociates on the Rh/Ta(110) surface for Rh coverages less than 2.5 ML and also show that the Rh clusters develop at least one site capable of molecular CO adsorption above 0.3 ML Rh coverage. 38 refs., 5 figs
International Nuclear Information System (INIS)
Haase, R.W.; Dirl, R.
1986-01-01
Explicit rank-dependent expressions have been obtained for some symmetric group (S/sub f/) 6j symbols and some S/sub f/containsS/sub f/ 1 x S/sub f/ 2 3jm symbols using Butler's recursion method. A key point in deriving these results is the use of the reduced notation introduced by Murnaghan to label irreps. Various symmetries of the 6j and 3jm symbols have been imposed. These include the complex conjugation, permutation, and transpose conjugation. We incorporate a new symmetry that arises from the occurrence of the two isomorphic direct product groups S/sub f/ 1 x S/sub f/ 2 and S/sub f/ 2 x S/sub f/ 1 as subgroups of S/sub f/. In relation to the tables of 6j and 3jm symbols presented, a discussion is given of the symmetric group-unitary group duality
Directory of Open Access Journals (Sweden)
Rafael Alves de Aguiar
2013-03-01
Full Text Available O presente estudo comparou o tempo mantido acima de 90% (t90VO2max e de 95% VO2max (t95VO2max em três diferentes intensidades de exercício. Após a realização de um teste incremental para determinar o VO2max, oito estudantes de educação física ativos (23 ± 3 anos executaram três sessões de exercícios intermitentes (100, 110 e 120% da velocidade do VO2max (vVO2max com razão esforço:recuperação de 30s:15s. O t95VO2max foi significantemente maior em 110%vVO2max (EI110% (218,1 ± 81,6 s quando comparado a 100%vVO2max (EI100% (91,9 ± 75,2s e a 120%vVO2max (EI120% (126,3 ± 29,4 s, porém sem diferença entre EI100% e EI120%. O t90VO2max somente apresentou diferença significante entre EI110% e EI120%. Portanto, conclui-se que durante exercício intermitente com razão 30s:15s, a intensidade de 110%vVO2max apresenta-se mais adequada para manter o VO2 próximo ou no VO2max por um tempo maior.The present study compared the time maintained above 90% (t90VO2max or 95% VO2max (t95VO2max in three different exercise intensities. After performing an incremental test to determine VO2max, eight physical education active students (23 ± 3 years performed three intermittent exercise sessions (100, 110 e 120% velocity of VO2max (vVO2max with ratio effort:recovery of 30s:15s. The t95%VO2max was significantly higher at 110%vVO2max (EI110% (218.1 ± 81.6s compared to 100% vVO2max (EI100% (91.9 ± 75.2s and 120%vVO2max (EI120% (126.3 ± 29.4s, but without differences between EI100% and EI120%. The t90%vVO2max was significantly different only between EI110% and 120%. Therefore, we conclude that during intermittent exercise with ratio 30s:15s, the intensity of 110%vVO2max appears more appropriate to maintain VO2max for a longer time.
First observation of the decay $B_s^0 \\rightarrow \\phi \\bar{K}^{*0}$
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Holtrop, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A
2013-11-12
A first observation of the decay $B_s^0 \\rightarrow \\phi \\bar{K}^{*0}$ is reported from an analysis based on a data sample, corresponding to an integrated luminosity of 1.0 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s} = 7 TeV$, collected with the LHCb detector. A yield of $30 \\pm 6$ $B_s^0 \\to (KK)(K\\pi)$ candidates is found in the mass windows $1012.5 < M(KK) < 1026.5 MeV/c^2$ and $746 < M(K\\pi)< 1046 MeV/c^2$, corresponding to a signal significance of 6.1 standard deviations. The candidates are found to be dominated by $B_s^0 \\rightarrow \\phi \\bar{K}^{*0}$ decays, and the branching fraction is measured to be $BF( B_s^0 \\rightarrow \\phi \\bar{K}^{*0} ) = (1.10 \\pm 0.24 (stat) \\pm 0.14 (syst) \\pm 0.08 (f_d/f_s ) ) \\times 10^{-6}$, where the uncertainties are statistical, systematic and from the ratio of fragmentation fractions $f_d/f_s$ which accounts for the different production rate of $B^0$ and $B_s^0$ mesons. The fraction of longitudinal polarization in $B_s^0 \\rightarrow \\phi \\bar{K}^{*0}$ decay...
32 CFR 865.110 - Decision process.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Decision process. 865.110 Section 865.110...-GENERAL PERSONNEL REVIEW BOARDS Air Force Discharge Review Board § 865.110 Decision process. (a) The DRB... decision making process. ...
31 CFR 17.110 - Self-evaluation.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Self-evaluation. 17.110 Section 17... § 17.110 Self-evaluation. (a) The agency shall, by two years after the effective date of this part... handicaps, to participate in the self-evaluation process. (c) The agency shall, until three years following...
5 CFR 950.110 - Prohibited discrimination.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Prohibited discrimination. 950.110 Section 950.110 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.110 Prohibited discrimination. Discrimination for...
Identification of an isomer in 110Ag at 1-keV excitation energy
International Nuclear Information System (INIS)
Clark, D.D.; Kostroun, V.O.; Siems, N.E.
1975-01-01
The existence of a new isomeric state in 110 Ag at approx. 1 keV excitation has been established in two experiments using a new instrument, the inner-shell-vacancy (ISV) detector. In the first experiment, a transition with a half-life of 660 plus-or-minus 40 ns was observed to follow the well-known 116-keV M4 transition that depopulates the 6 + 250-day isomeric level in 110 Ag; the energy of the new transition was deduced to be 109 Ag(n, γ) 110 Ag reaction to follow γ transitions previously assigned by others to populate a 1-keV excited state. The two results indicate the existence of a 2 - 660-ns isomer at 1.11 keV. Under the assumption that the newly observed transition is from a 2 - 1.11-keV state to the 1 + ground state, its hindrance factor with respect to the Moszkowski estimate is approx. 2.6 times 10 3 . Possible chemical-state perturbations of the measured half-life are estimated to be much smaller than the measurement error. In both experiments the approx. 1-keV transition was detected with the ISV detector, a new device based on the well-established atomic effect that within approx. 10 -14 s after the formation of an inner shell vacancy an atom will undergo a multiple loss of []lectrons ranging from several to 20 or more, the number being a function of Z and subshell. The emitted electrons, which are very soft, are collected with an accelerating and focusing electrostatic lens and detected with a plastic scintillator and a photomultiplier tube. Nuclear transitions that cause ISVs can thus be sensed. Experiments are described that show the detector is fast, sensitive, selective, and efficient in responding to ISVs.
International Nuclear Information System (INIS)
Kardinal, I.
1998-01-01
The complementary techniques of HR-XPS and HREELS have been applied to two distinct problems. The first studies adsorption and dissociation of C 2 N 2 on Ni (110) at room temperature (RT) and at 90 K and its co-adsorption with CO. At RT C 2 N 2 dissociates and forms a c(2x2)-CN structure. The resulting CN is found to be bound in the grooves of the (110) surface yielding the lowest C-N vibrational energy yet observed. C 2 N 2 was found to dissociate even at 90 K however the resulting CN overlayer after warming to RT showed remarkable differences to that of the RT adsorption. As well as the in-groove species a number of adsorption sites on the ridges with a bond order higher have been identified. Preadsorbed CO is completely driven of the Ni (110) surface by co-adsorption of CN at RT. HREELS indicates that first CO is desorbed from the on-top-sites and then from the bridge-sites of the (110)-ridges involving a considerable increase of the HREELS cross section for the CO on the bridge-sites. Also the signal intensity of the coadsorbed CN is suppressed by the CO present on the surface. The second study investigated the adsorption of bithiophene (BiT) on clean Ni (110) and the S-modified c(2x2)-S-Ni (110) and p(4x1)-S-Ni (110). The latter provided a strongly structured substrate which forced the assembly of the adsorbed BiT-molecules. The high degree of order of this adsorbate/substrate system was obvious in both the HR-XPS results and the BREELS results with strong azimuthal anisotropy. This system was used to asses the ability to use the HREELS impact selection rules to determine molecular orientation of a reasonably complex adsorbate overlayer. (author)
29 CFR 825.110 - Eligible employee.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Eligible employee. 825.110 Section 825.110 Labor... employee. (a) An “eligible employee” is an employee of a covered employer who: (1) Has been employed by the... worksite where 50 or more employees are employed by the employer within 75 miles of that worksite. (See...
Characterization of Rh films on Ta(110)
International Nuclear Information System (INIS)
Jiang, L.Q.; Ruckman, M.W.; Strongin, M.
1990-01-01
The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low-energy electron diffraction (LEED) and low-energy ion scattering (LEIS). From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh appears to grow in the Stranski--Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at -1.5 and -2.5 eV binding energy during the initial phase of thin-film growth (0 3.7 ML). CO dissociates on the Rh/Ta(110) surface for Rh coverages<2.5 ML and the surface develops a site capable of molecular CO adsorption above 0.3-ML Rh coverage
GREEN CHEMISTRY APPLICATION FOR THE SYNTHESIS OF (1-N-4’-METHOXYBENZYL-1,10-PHENANTHROLINIUM BROMIDE
Directory of Open Access Journals (Sweden)
Maulidan Firdaus
2010-06-01
Full Text Available A simple, energy-efficient, and relatively quick synthetic procedure for the synthesis of (1-N-4'-methoxybenzyl-1,10-phenanthrolinium bromide, based on green chemistry principles has been carried out. The synthesis was started by solvent-free reduction of p-anisaldehyde with NaBH4 to give 4-methoxybenzyl alcohol in 98% yield to be followed by solvent-free treatment of the resulted alcohol with PBr3 to yield 4-methoxybenzyl bromide (86%. Furthermore, the obtained bromide was reacted with 1,10-phenanthroline in acetone at reflux for 12 h to give the phenanthrolinium salt target in 68% yield. Keywords: green chemistry, p-anisaldehyde, (1-N-4'-methoxybenzyl-1,10-phenanthrolinium bromide
Characteristic electron energy loss in lanthanum films adsorbed on tungsten (110) single crystal
International Nuclear Information System (INIS)
Gorodetskij, D.A.; Gorchinskij, A.D.; Kobylyanskij, A.V.
1988-01-01
The spectrum of electron energy loss (ELS) in a wide range of energy loss 0-150 eV has been studied for La films adsorbed on W(110) single crystal with the coverage Θ from submonolayer to a few monolayers. The concentration dependence of loss energy peaks amplitude of different nature has been studied for the adsorption of rare earth element on refractory substrate. It has been shown that the essential information for the interpretation of the energy loss nature may be obtained by the investigation of such dependences for La adsorption on W(110). It is found that the surface and bulk plasmons peaks appear in ELS of La-W(110) system before the completion of the physical monolayer. Thus, the collectivization of valence electrons in the rare earth element film at the transition metal surface ensues for the submonolayer coverage like in the case of collective processes in alkali and alkaline earth element films
Bias Dependent Spin Relaxation in a [110]-InAs/AlSb Two Dimensional Electron System
Hicks, J.; Holabird, K.
2005-03-01
Manipulation of electron spin is a critical component of many proposed semiconductor spintronic devices. One promising approach utilizes the Rashba effect by which an applied electric field can be used to reduce the spin lifetime or rotate spin orientation through spin-orbit interaction. The large spin-orbit interaction needed for this technique to be effective typically leads to fast spin relaxation through precessional decay, which may severely limit device architectures and functionalities. An exception arises in [110]-oriented heterostructures where the crystal magnetic field associated with bulk inversion asymmetry lies along the growth direction and in which case spins oriented along the growth direction do not precess. These considerations have led to a recent proposal of a spin-FET that incorporates a [110]-oriented, gate-controlled InAs quantum well channel [1]. We report measurements of the electron spin lifetime as a function of applied electric field in a [110]-InAs 2DES. Measurements made using an ultrafast, mid-IR pump-probe technique indicate that the spin lifetime can be reduced from its maximum to minimum value over a range of less than 0.2V per quantum well at room temperature. This work is supported by DARPA, NSERC and the NSF grant ECS - 0322021. [1] K. C. Hall, W. H. Lau, K. Gundogdu, M. E. Flatte, and T. F. Boggess, Appl. Phys. Lett. 83, 2937 (2003).
46 CFR 403.110 - Accounting entities.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting entities. 403.110 Section 403.110 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.110 Accounting entities. Each Association shall be a separate accounting...
7 CFR 922.110 - Container exemption.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Container exemption. 922.110 Section 922.110... COUNTIES IN WASHINGTON Container Exemption; Waivers of Inspection and Certification § 922.110 Container exemption. Whenever container limitations are effective pursuant to § 922.52, a handler may make test...
34 CFR 300.110 - Program options.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Program options. 300.110 Section 300.110 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Other Fape Requirements § 300.110 Program options. The State must ensure that...
Atomic and molecular adsorption on Fe(110)
Xu, Lang; Kirvassilis, Demetrios; Bai, Yunhai; Mavrikakis, Manos
2018-01-01
Iron is the principal catalyst for the ammonia synthesis process and the Fischer-Tropsch process, as well as many other heterogeneously catalyzed reactions. It is thus of fundamental importance to understand the interactions between the iron surface and various reaction intermediates. Here, we present a systematic study of atomic and molecular adsorption behavior over Fe(110) using periodic, self-consistent density functional theory (DFT-GGA) calculations. The preferred binding sites, binding energies, and the corresponding surface deformation energies of five atomic species (H, C, N, O, and S), six molecular species (NH3, CH4, N2, CO, HCN, and NO), and eleven molecular fragments (CH, CH2, CH3, NH, NH2, OH, CN, COH, HCO, NOH, and HNO) were determined on the Fe(110) surface at a coverage of 0.25 monolayer. The binding strengths calculated using the PW91 functional decreased in the following order: C > CH >N > O > S > NH > COH > CN > CH2 > NOH > OH > HNO > HCO > NH2 > H > NO > HCN > CH3 > CO > N2 > NH3. No stable binding structures were observed for CH4. The estimated diffusion barriers and pathways, as well as the adsorbate-surface and intramolecular vibrational modes of all the adsorbates at their preferred binding sites, were identified. Using the calculated adsorption energetics, we constructed the potential energy surfaces for a few surface reactions including the decomposition of methane, ammonia, dinitrogen, carbon monoxide, and nitric oxide. These potential energy surfaces provide valuable insight into the ability of Fe(110) to catalyze common elementary steps.
Isomerization of 2-phospha-4-silabicyclo[1.10]butane
Slootweg, J.C.; Ehlers, A.W.; Lammertsma, K.
2004-01-01
In analogy with the valence isomerism of the hydrocarbons bicyclobutane, 1,3-butadiene and cyclobutene, the rearrangements for 2-phospha-4-sila- bicyclo[1.1.0]butane were studied at the B3LYP/6-311+G** level of theory. The monocyclic 1,2-dihydro-1,2-phosphasilete is shown to be the thermodynamically
33 CFR 110.84b - Buffalo, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo, N.Y. 110.84b Section 110... REGULATIONS Special Anchorage Areas § 110.84b Buffalo, N.Y. The area within the Port of Buffalo known as Port of Buffalo Small Boat Harbor commencing at a point on shore at latitude 42°51′05″ N., longitude 78°51...
Yahweh’s ‘lord’ and Unrestrained Evil: An Exegesis of Psalm 110
Directory of Open Access Journals (Sweden)
Aran J.E. Persaud
2015-08-01
Full Text Available This article consists of an exegetical investigation of Psalm 110 and assumes that the psalms function in one sense as prayers, which can be prayed authentically by modern worshippers. Consequently, the specific images of hostile acts of war present a challenge as prayer. The methodology involves the investigation of the text from a grammatico-historical perspective by using selected sources from the 19th century to the present. The meaning of the violent images of enmity and the defining characteristics of the enemy are determined through understanding the perceived suffering of the psalmist. Special attention is given to the role of the phrase םֻאְנָּהוהְי, the identification of יִֹנדַאל and defining the enemy. The conclusions of the exegesis support a more traditional interpretation of יִֹנדַאל and characterise the recalcitrant enemies in an eschatological framework. Jahwe se ‘heer’ en onbeteuelde boosheid: ’n Eksegese van Psalm 110. Hierdie artikel is ’n eksegetiese ondersoek van Psalm 110 en gaan van die veronderstelling uit dat die psalms in ’n sekere sin gebede is wat deur moderne gelowiges gebid kan word. Die spesifieke uitbeeldings van vyandige oorlogsdade stel egter ’n uitdaging aan dié gebed. Die metodologie behels die ondersoek van die teks vanuit ’n grammaties-historiese perspektief deur uitgesoekte bronne vanaf die negentiende eeu tot tans te gebruik. Die betekenis van die geweldadige uitbeelding van vyandigheid en die omskrywende karaktertrekke van die vyand word bepaal deur die verstaan van die waarneembare lyding van die psalmskrywer. Daar word besondere aandag gegee aan die rol van die frase ָהוְהיּםֻאְנ, die eiening van יִֹנדַאל en die omskrywing van die vyand. Die slotsom van die eksegesis ondersteun ’n meer tradisionele interpretasie van יִֹנדַאל en tipeer die onversetlike vyand in ’n eskatalogiese raamwerk.
34 CFR 1200.110 - Self-evaluation.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Self-evaluation. 1200.110 Section 1200.110 Education Regulations of the Offices of the Department of Education (Continued) NATIONAL COUNCIL ON DISABILITY... COUNCIL ON DISABILITY § 1200.110 Self-evaluation. (a) The agency shall, by November 28, 1994, evaluate its...
49 CFR 807.110 - Self-evaluation.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Self-evaluation. 807.110 Section 807.110... TRANSPORTATION SAFETY BOARD § 807.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...
22 CFR 530.110 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 530.110 Section 530.110 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.110 Self-evaluation. (a) The... representing handicapped persons, to participate in the self-evaluation process by submitting comments (both...
21 CFR 225.110 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records and Reports § 225.110 Distribution records. (a) Distribution records permit the manufacturer to relate complaints to specific batches and/or... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 225.110 Section 225.110 Food...
7 CFR 4290.110 - Qualified management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Qualified management. 4290.110 Section 4290.110... Qualifications for the RBIC Program Organizing A Rbic § 4290.110 Qualified management. An Applicant must show, to the satisfaction of the Secretary, that its current or proposed management team is qualified and has...
cis-Dichloridobis(1,10-phenanthrolinechromium(III chloride
Directory of Open Access Journals (Sweden)
Xiaoli Gao
2011-02-01
Full Text Available In the title complex, [CrCl2(C12H8N22]Cl, the CrIII ion is situated on a twofold rotation axis and displays a slightly distorted octahedral CrCl2N4 coordination geometry. The Cr environment is composed of a cis arrangement of two 1,10-phenanthroline and two chloride ligands. The chloride counter-anion exhibits half-occupation and is equally disordered over two positions.
22 CFR 711.110 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 711.110 Section 711.110 Foreign... CORPORATION § 711.110 Self-evaluation. (a) The agency shall, by September 6, 1989, evaluate its current... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...
19 CFR 201.110 - Self-evaluation.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...
11 CFR 110.18 - Voting age population.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Voting age population. 110.18 Section 110.18 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CONTRIBUTION AND EXPENDITURE LIMITATIONS AND... population of the United States, of each State, and of each Congressional district. The term voting age...
Ma, Yan; Cao, Wei; Qiao, Shuang; Liu, Wenwen; Yang, Jinghe
2011-01-01
Chemiluminescence (CL) detection for the determination of estrogen benzoate, using the reaction of tris(1,10-phenanthroline)ruthenium(II)-Na(2)SO(3)-permanganate, is described. This method is based on the CL reaction of estrogen benzoate (EB) with acidic potassium permanganate and tris(1,10-phenanthroline)ruthenium(II). The CL intensity is greatly enhanced when Na(2)SO(3) is added. After optimization of the different experimental parameters, a calibration graph for estrogen benzoate is linear in the range 0.05-10 µg/mL. The 3 s limit of detection is 0.024 µg/mL and the relative standard deviation was 1.3% for 1.0 µg/mL estrogen benzoate (n = 11). This proposed method was successfully applied to commercial injection samples and emulsion cosmetics. The mechanism of CL reaction was also studied. Copyright © 2011 John Wiley & Sons, Ltd.
33 CFR 110.170 - Lockwoods Folly Inlet, N.C.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...
12 CFR 410.110 - Self-evaluation.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Self-evaluation. 410.110 Section 410.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.110 Self...
Targeting GPR110 in HER2-Overexpressing Breast Cancers
2015-10-01
34assay"using"the"transwell" inserts"with" (A)"or"without" (B)"matrigel" for"SKBR3" cells "transfected"with"nonAtarge1ng"( NT1 )"orŗ"independent"GPR110"siRNAs...HER2 drug resistant cells and in tumorigenic population using a broad panel of cell line models. We have successfully generated inducible lentiviral...plasmids with GPR110 cDNA and cell lines that inducibly overexpress GPR110. Generation of cell lines with lentiviral plasmids containing GPR110
33 CFR 110.128b - Island of Hawaii, Hawaii.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Hawaii, Hawaii. 110.128b Section 110.128b Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128b Island of Hawaii, Hawaii. (a) Hilo Bay...
PS1-10jh CONTINUES TO FOLLOW THE FALLBACK ACCRETION RATE OF A TIDALLY DISRUPTED STAR
Energy Technology Data Exchange (ETDEWEB)
Gezari, S. [Department of Astronomy, University of Maryland, Stadium Drive, College Park, MD 20742-2421 (United States); Chornock, R. [Astrophysical Institute, Department of Physics and Astronomy, 251B Clippinger Lab, Ohio University Athens, OH 45701 (United States); Lawrence, A. [Institute for Astronomy, University of Edinburgh Scottish Universities Physics Alliance, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Rest, A. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Jones, D. O. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Berger, E.; Challis, P. M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Narayan, G., E-mail: suvi@astro.umd.edu [NOAO, 950 North Cherry Avenue, Tucson, AZ 85719 (United States)
2015-12-10
We present late-time observations of the tidal disruption event candidate PS1-10jh. UV and optical imaging with Hubble Space Telescope/WFC3 localize the transient to be coincident with the host galaxy nucleus to an accuracy of 0.023 arcsec, corresponding to 66 pc. The UV flux in the F225W filter, measured 3.35 rest-frame years after the peak of the nuclear flare, is consistent with a decline that continues to follow a t{sup −5/3} power-law with no spectral evolution. Late epochs of optical spectroscopy obtained with MMT ∼ 2 and 4 years after the peak, enable a clean subtraction of the host galaxy from the early spectra, revealing broad helium emission lines on top of a hot continuum, and placing stringent upper limits on the presence of hydrogen line emission. We do not measure Balmer Hδ absorption in the host galaxy that is strong enough to be indicative of a rare, post-starburst “E+A” galaxy as reported by Arcavi et al. The light curve of PS1-10jh over a baseline of 3.5 years is best modeled by fallback accretion of a tidally disrupted star. Its strong broad helium emission relative to hydrogen (He iiλ4686/Hα > 5) could be indicative of either the hydrogen-poor chemical composition of the disrupted star, or certain conditions in the tidal debris of a solar-composition star in the presence of an optically thick, extended reprocessing envelope.
10 CFR 110.64 - Civil penalty.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Civil penalty. 110.64 Section 110.64 Energy NUCLEAR... Enforcement § 110.64 Civil penalty. (a) In response to a violation, the Commission may institute a proceeding to impose a civil penalty under section 234 of the Atomic Energy Act by issuing a notice to the...
14 CFR 1250.110 - Judicial review.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1250.110 Section 1250.110... PROGRAMS OF NASA-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 1250.110 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603...
21 CFR 168.110 - Dextrose anhydrous.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose anhydrous. 168.110 Section 168.110 Food... Table Sirups § 168.110 Dextrose anhydrous. (a) Dextrose anhydrous is purified and crystallized D-glucose... solids content is not less than 98.0 percent m/m. (b) The name of the food is “Dextrose anhydrous” or...
Optical properties of new 5-(4-phenylethynyl)-substituted-1,10-phenanthroline derivatives
International Nuclear Information System (INIS)
Guerin, Juliette; Aronica, Christophe; Boeuf, Gaelle; Chauvin, Jerome; Moreau, Juliette; Lemercier, Gilles
2011-01-01
The synthesis and optical properties of a novel family of 5-substituted-1,10-phenanthroline derivatives are reported herein. One carbon-carbon triple-bond function was introduced using a Sonogashira cross-coupling reaction. The effects on optical properties, of the substitution with electro-withdrawing or -donating substituents in the 5th position of the 1,10-phenanthroline are investigated. Experimental chemical structure-polarisability relationship is analyzed according to the Lippert-Mataga correlation and compared to a theoretical study carried out with DFT calculations. These compounds are promising candidates for a fine-tuning of the internal charge-transfers but also as potential nonlinear chromophores and ligands within multifunctional coordination complexes. - Highlights: → Synthesis and optical properties of new 5-substituted-1,10-phenanthroline derivatives. → Sonogashira reaction was used for the substitution. → Structure-polarisability relationship analyzed according to Lippert-Mataga correlation. → Theoretical study was carried out with DFT calculations. → Fine-tuning of the internal charge-transfers within nonlinear compounds.
Kim, Kyung-Ju; Lee, Tae Hun; Kim, Jung Ho; Cho, Nam-Yun; Kim, Woo Ho; Kang, Gyeong Hoon
2017-09-01
Deletion of the HSP110 T 17 mononucleotide repeat has recently been identified as a prognostic marker that is correlated with wild-type HSP110 (HSP110wt) expression in microsatellite instability-high (MSI-H) colorectal cancers. The aim of this study was to assess the correlation between deletion of the HSP110 T 17 repeat and expression of HSP110wt using DNA testing and immunohistochemistry and to determine the prognostic implications of HSP110 T 17 deletion in MSI-H advanced gastric cancers (GCs). The status of HSP110wt expression was evaluated by immunohistochemistry using an HSP110wt-specific antibody in 142 MSI-H advanced GCs. The size of the HSP110 T 17 repeat deletion was analyzed in 96 MSI-H advanced GCs; deletions were divided into small (0-2base pairs) and large deletions (3-5base pairs). Low and high expressions of HSP110wt were detected in 38 (26.8%) and 104 (73.2%) of the 142 cases, respectively. The HSP110 T 17 deletion was observed in 45 (46.9%) of the 96 MSI-H GC samples. Tumors with high expression of HSP110wt showed a tendency to have small or no deletion of HSP110 T 17 . In Kaplan-Meier survival analysis, tumors with a large HSP110 T 17 deletion were associated with favorable overall survival and disease-free survival compared with those with small/no deletion of HSP110 T 17 . However, HSP110 T 17 deletion size was not an independent prognostic factor in multivariate analysis. In summary, deletion of the HSP110 T 17 repeat was frequently observed in MSI-H GCs, and HSP110 T 17 deletion size was inversely correlated with HSP110wt expression status. Large HSP110 T 17 was not a prognostic indicator in MSI-H GCs. Copyright © 2017 Elsevier Inc. All rights reserved.
33 CFR 110.128c - Island of Kauai, Hawaii.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Kauai, Hawaii. 110.128c Section 110.128c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128c Island of Kauai, Hawaii. (a) Nawiliwili Bay. The...
Host material induced hyperfine structure of F{sup +} centres EPR spectra in CaS
Energy Technology Data Exchange (ETDEWEB)
Seeman, Viktor, E-mail: viktor.seeman@ut.ee; Dolgov, Sergei; Maaroos, Aarne
2017-05-15
The hyperfine structure (HFS) of F{sup +} centres in CaS single crystals due to the interaction with {sup 33}S and {sup 43}Ca nuclei was observed in EPR spectra for the first time. Angular variations of the HFS were measured for rotation of magnetic field in {100} and {110} crystallographic planes. Using measured orientation-dependent EPR spectra and the EPR NMR program, the parameters of the spin Hamiltonian were determined. In case of {sup 33}S nucleus there is a strong dependence of the F{sup +} centre EPR spectrum on the quadrupole term whereas for {sup 43}Ca nucleus this dependence is insignificant.
33 CFR 110.77 - Amistad Reservoir, Tex.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Amistad Reservoir, Tex. 110.77... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.77 Amistad Reservoir, Tex. (a) Diablo East, Tex. That portion of the Amistad Reservoir enclosed by a line connecting the following points, excluding a 300-foot...
24 CFR 110.20 - Availability of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Availability of posters. 110.20... HOUSING FAIR HOUSING POSTER Requirements for Display of Posters § 110.20 Availability of posters. All persons subject to this part may obtain fair housing posters from the Department's regional and area...
28 CFR 34.110 - Management of peer reviews.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Management of peer reviews. 34.110 Section 34.110 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES... the peer review process. ...
An Analysis of the Populations of the Air Force’s Medical and Professional Officer Corps
2010-01-01
42t 19 Optometry 42e 139 Pharmacy 43P 222 Physical therapy 42B 150 Physician assistance 42G 285 Podiatry 42F 17 Public health 43h 179 Social work 42S...41 1 150 Physician assistance 33 193 3 1 55 285 Podiatry 0 0 17 0 0 17 Public health 14 72 89 3 1 179 Social work 6 195 3 15 4 223 BSC total 386...0.5 0.8 82.4 Podiatry 1.1 1.1 0.0 2.3 Public health 4.7 12.0 2.0 18.8 Social work 11.0 2.5 0.8 14.2 nOte: numbers may not total due to rounding
BeppoSAX Observations of MKN 110
Nicastro, Fabrizio; Oliversen, Ronald J. (Technical Monitor)
2002-01-01
Mkn 110 is a bright, nearby Seyfert 1 galaxy, which underwent a long optical monitoring campaign, during the past 12 years. Optical observations show that Mkn 110 vary, both in flux and spectral shape. The intensity and width of its Broad Emission Lines (BELs) also vary, from typical Seyfert 1, to typical Narrow Line Seyfert 1 (NLSyl) values, so suggesting that this could be the first supermassive black holes where accretion state related transitions, as frequently observed in stellar-size black holes, have finally been observed. To verify these suggestions we asked to monitor Mkn 110 with BeppoSAX with three 50 ksec observations six months apart. The goal of the proposal was to observe spectral variations in X-ray, already suggested by previous, existing ROSAT (Roentgen Satellite) and ASCA (Advanced Satellite for Cosmology and Astrophysics) observations of the same source. The first of these three SAX (Satellite per Astronomia X) observations was taken on May 2000, and lacks the Low-Energy instrument (0.1-2 keV is the band in which NLSy1 and Sy1 X-ray spectra differ most).
Gleńska-Olender, J; Durlik, K; Konieczna, I; Kowalska, P; Gawęda, J; Kaca, W
2017-11-01
Bacteria of the genus Proteus of the family Enterobacteriaceae are facultative human pathogens responsible mainly for urinary tract and wound infections, bacteremia and the development of rheumatoid arthritis (RA). We have analyzed and compared by ELISA the titer of antibodies in plasmas of healthy individuals and in sera of rheumatoid arthritis patients recognizing a potential host cross-reactive epitope (lysine-galacturonic acid epitopes) present in Proteus lipopolysaccharide (LPS). In our experiments LPSs isolated from two mutants of smooth Proteus mirabilis 1959 (O3), i.e. strains R110 and R45, were used. R110 (Ra type mutant) is lacking the O-specific polysaccharide, but possesses a complete core oligosaccharide, while R45 (Re type) has a reduced core oligosaccharide and contains two 3-deoxy-D-manno-oct-2-ulosonic acid residues and one of 4-amino-4-deoxy-L-arabinopyranose residues. Titer of P. mirabilis S1959 LPS-specific-antibodies increased with the age of blood donors. RA and blood donors' sera contained antibodies against S and Ra and Re type of P. mirabilis O3 LPSs. Antibodies recognizing lysine-galacturonic acid epitopes of O3 LPS were detected by ELISA in some plasmas of healthy individuals and sera of rheumatoid arthritis patients. RA patients antibodies reacting with P. mirabilis S1959 S and R LPSs may indicate a potential role of anti-LPS antibodies in molecular mimicry in RA diseases.
2,2',-bipyridine and 1,10-phenanthroline complexes of lanthanide(III) trifluoroacetates
International Nuclear Information System (INIS)
Misra, S.N.; Singh, M.
1983-01-01
The syntheses and characterization of lanthanide(III) triflloroacetate complexes with 2,2'-bipyridine and 1,10-phenanthroline are reported. Lanthanide(III) trifluoroacetates yield compounds of the type Ln(CF 3 COO) 3 .bipy or phen with 2,2'-bipyridine and 1,10-phenanthroline. Their properties and structures have been studied using chemical analyses. electronic and infrared spectra. Thermal analysis of a few complexes have also been done. The infrared data show that the trifluoroacetate group acts as a bidentate ligand making the coordination number of lanthanide eight. (author)
24 CFR 110.25 - Description of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Description of posters. 110.25... HOUSING FAIR HOUSING POSTER Requirements for Display of Posters § 110.25 Description of posters. (a) The fair housing poster shall be 11 inches by 14 inches and shall bear the following legend: EC12OC91.008...
VUV spectroscopy of Tm3+ and Mn2+ doped LiSrAlF6
International Nuclear Information System (INIS)
True, M.; Kirm, M.; Negodine, E.; Vielhauer, S.; Zimmerer, G.
2004-01-01
LiSrAlF 6 (LiSAF) crystals doped with either Tm 3+ or Mn 2+ were obtained by solid-state reaction and investigated spectroscopically using synchrotron radiation in the vacuum-ultra-violet and ultra-violet spectral regions. In the Tm 3+ doped LiSAF crystals, the slow spin-forbidden 5d-4f emission peaking at 166 nm with a lifetime of at least 1 μs was observed. The respective excitation spectrum consists of several bands in the range of 160-110 nm arising due to the 4f-5d absorption. The f-f emissions of Tm 3+ are well excited in the range of 135-110 nm, but not under excitation into the lower lying d-bands. The excitation mechanisms of different emissions will be discussed including the F - to Tm 3+ charge transfer excitation peaking at 127 nm in LiSAF. The characteristic broad 4 T 1 → 6 A 1 emission band of Mn 2+ peaking at 508 (504) nm was observed in LiSAF:Mn 2+ crystal at 10 (300) K. Three intense excitation bands, tentatively ascribed to the 3d-4s transitions of Mn 2+ , were revealed in the range of 170-110 nm
Bismuth on copper (110): analysis of the c(2x2) and p(4x1) structures by surface x-ray diffraction
DEFF Research Database (Denmark)
Lottermoser, L.; Buslaps, T.; Johnson, R.L.
1997-01-01
Surface X-ray diffraction has been used to analyze the atomic structures of the Cu(110)-c(2 x 2)-Bi and Cu(110)-p(4 x 1)-Bi reconstructions with submonolayer coverages. A quasi-hexagonal c(2 x 2) adlayer structure is formed when half a monolayer of bismuth is deposited; the coverage corresponds...... to 1.08 x 10(-15) atoms cm(-2). There is one Bi atom per c(2 x 2) surface unit cell, and the nearest-neighbor distance on the planar overlayer was found to be 4.43 Angstrom. In the case of the p(4 x 1) reconstruction formed at a coverage of 0.75 monolayers, both the in-plane and out-of-plane data...
Ghost field realizations of the spinor $W_{2,s}$ strings based on the linear W(1,2,s) algebras
Liu, Yu-Xiao; Zhang, Li-Jie; Ren, Ji-Rong
2005-01-01
It has been shown that certain W algebras can be linearized by the inclusion of a spin-1 current. This Provides a way of obtaining new realizations of the W algebras. In this paper, we investigate the new ghost field realizations of the W(2,s)(s=3,4) algebras, making use of the fact that these two algebras can be linearized. We then construct the nilpotent BRST charges of the spinor non-critical W(2,s) strings with these new realizations.
Ghost field realizations of the spinor W2,s strings based on the linear W1,2,s algebras
International Nuclear Information System (INIS)
Liu Yuxiao; Ren Jirong; Zhang Lijie
2005-01-01
It has been shown that certain W algebras can be linearized by the inclusion of a spin-1 current. This provides a way of obtaining new realizations of the W algebras. In this paper, we investigate the new ghost field realizations of the W 2,s (s=3,4) algebras, making use of the fact that these two algebras can be linearized. We then construct the nilpotent BRST charges of the spinor non-critical W 2,s strings with these new realizations. (author)
48 CFR 249.110 - Settlement negotiation memorandum.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...
WR 110: A SINGLE WOLF-RAYET STAR WITH COROTATING INTERACTION REGIONS IN ITS WIND?
International Nuclear Information System (INIS)
Chene, A.-N.; Moffat, A. F. J.; Fahed, R.; St-louis, N.; Muntean, V.; Chevrotiere, A. De La; Cameron, C.; Matthews, J. M.; Gamen, R. C.; Lefevre, L.; Rowe, J. F.; Guenther, D. B.; Kuschnig, R.; Weiss, W. W.; Rucinski, S. M.; Sasselov, D.
2011-01-01
A 30 day contiguous photometric run with the Microvariability and Oscillations of STars (MOST) satellite on the WN5-6b star WR 110 (HD 165688) reveals a fundamental periodicity of P = 4.08 ± 0.55 days along with a number of harmonics at periods P/n, with n ∼ 2, 3, 4, 5, and 6, and a few other possible stray periodicities and/or stochastic variability on timescales longer than about a day. Spectroscopic radial velocity studies fail to reveal any plausible companion with a period in this range. Therefore, we conjecture that the observed light-curve cusps of amplitude ∼0.01 mag that recur at a 4.08 day timescale may arise in the inner parts, or at the base, of a corotating interaction region (CIR) seen in emission as it rotates around with the star at constant angular velocity. The hard X-ray component seen in WR 110 could then be a result of a high velocity component of the CIR shock interacting with the ambient wind at several stellar radii. Given that most hot, luminous stars showing CIRs have two CIR arms, it is possible that either the fundamental period is 8.2 days or, more likely in the case of WR 110, there is indeed a second weaker CIR arm for P = 4.08 days, that occurs ∼two-thirds of a rotation period after the main CIR. If this interpretation is correct, WR 110 therefore joins the ranks with three other single WR stars, all WN, with confirmed CIR rotation periods (WR 1, WR 6, and WR 134), albeit with WR 110 having by far the lowest amplitude photometric modulation. This illustrates the power of being able to secure intense, continuous high-precision photometry from space-based platforms such as MOST. It also opens the door to revealing low-amplitude photometric variations in other WN stars, where previous attempts have failed. If all WN stars have CIRs at some level, this could be important for revealing sources of magnetism or pulsation in addition to rotation periods.
Observation of the hadronic transitions χb1,2(2P)→ωΥ(1S)
International Nuclear Information System (INIS)
Cronin-Hennessy, D.; Park, C.S.; Park, W.; Thayer, J.B.; Thorndike, E.H.; Coan, T.E.; Gao, Y.S.; Liu, F.; Stroynowski, R.; Artuso, M.; Boulahouache, C.; Blusk, S.; Dambasuren, E.; Dorjkhaidav, O.; Mountain, R.; Muramatsu, H.; Nandakumar, R.; Skwarnicki, T.; Stone, S.; Wang, J.C.
2004-01-01
The CLEO Collaboration has made the first observations of hadronic transitions among bottomonium (bb-bar) states other than the dipion transitions among Υ(nS) states. In our study of Υ(3S) decays, we find a significant signal for Υ(3S)→γωΥ(1S) that is consistent with radiative decays Υ(3S)→γχ b1,2 (2P), followed by χ b1,2 (2P)→ωΥ(1S). The branching ratios we obtain are B[χ b1 (2P)→ωΥ(1S)]=(1.63 -0.31-0.15 +0.35+0.16 )% and B[χ b2 (2P)→ωΥ(1S)]=(1.10 -0.28-0.10 +0.32+0.11 )%, in which the first error is statistical and the second is systematic.
7 CFR 29.110 - Method of sampling.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Method of sampling. 29.110 Section 29.110 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Regulations Inspectors, Samplers, and Weighers § 29.110 Method of sampling. In sampling tobacco...
Chantana, Jakapan; Kato, Takuya; Sugimoto, Hiroki; Minemoto, Takashi
2018-04-04
Development of Cd-free Cu(In,Ga)(S,Se) 2 (CIGSSe)-based thin-film solar cells fabricated by an all-dry process is intriguing to minimize optical loss at a wavelength shorter than 520 nm owing to absorption of the CdS buffer layer and to be easily integrated into an in-line process for cost reduction. Cd-free CIGSSe solar cells are therefore prepared by the all-dry process with a structure of Zn 0.9 Mg 0.1 O:Al/Zn 0.8 Mg 0.2 O/CIGSSe/Mo/glass. It is demonstrated that Zn 0.8 Mg 0.2 O and Zn 0.9 Mg 0.1 O:Al are appropriate as buffer and transparent conductive oxide layers with large optical band gap energy values of 3.75 and 3.80 eV, respectively. The conversion efficiency (η) of the Cd-free CIGSSe solar cell without K-treatment is consequently increased to 18.1%. To further increase the η, the Cd-free CIGSSe solar cell with K-treatment is next fabricated and followed by posttreatment called the heat-light-soaking (HLS) + light-soaking (LS) process, including HLS at 110 °C followed by LS under AM 1.5G illumination. It is disclosed that the HLS + LS process gives rise to not only the enhancement of carrier density but also the decrease in the carrier recombination rate at the buffer/absorber interface. Ultimately, the η of the Cd-free CIGSSe solar cell with K-treatment prepared by the all-dry process is enhanced to the level of 20.0%.
33 CFR 110.155 - Port of New York.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Port of New York. 110.155 Section... ANCHORAGE REGULATIONS Anchorage Grounds § 110.155 Port of New York. (a) Long Island Sound—(1) Anchorage No... northwest corner of the crib icebreaker north of the New York Central Railroad Company drawbridge across...
Tank characterization report for single-shell tank 241-U-110. Revision 1
Energy Technology Data Exchange (ETDEWEB)
Brown, T.M.; Jensen, L.
1993-09-01
Tank 241-U-110 (U-110) is a Hanford Site waste tank that was ;most recently sampled in November and December 1989. Analysis of the samples obtained from tank U-110 was conducted to support the characterization of the contents of this tank and to support Hanford Federal Facility Agreement and Consent Order milestone M-10-00 (Ecology, et al. 1992). Because of incomplete recovery of the waste during sampling, there may be bias in the results of this characterization report.
12 CFR 411.110 - Certification and disclosure.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification and disclosure. 411.110 Section 411.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.110 Certification and disclosure. (a) Each person shall file a certification, and a disclosure...
7 CFR 3565.110 - Insolvency of lender.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Insolvency of lender. 3565.110 Section 3565.110... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Lender Requirements § 3565.110 Insolvency of lender. The... determination of insolvency by the lender. If the lender fails to transfer a loan when required, the guarantee...
33 CFR 110.27 - Lynn Harbor in Broad Sound, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lynn Harbor in Broad Sound, Mass. 110.27 Section 110.27 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.27 Lynn Harbor in Broad Sound, Mass. North of...
33 CFR 110.179 - Skidaway River, Isle of Hope, Ga.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Skidaway River, Isle of Hope, Ga. 110.179 Section 110.179 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.179 Skidaway River, Isle of Hope, Ga. (a) The...
23 CFR 630.110 - Modification of original agreement.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Modification of original agreement. 630.110 Section 630... OPERATIONS PRECONSTRUCTION PROCEDURES Project Authorization and Agreements § 630.110 Modification of original agreement. (a) When changes are needed to the original project agreement, a modification of agreement shall...
A first principles study of adhesion and electronic structure at Fe (110)/graphite (0001) interface
Energy Technology Data Exchange (ETDEWEB)
Liu, Yangzhen; Xing, Jiandong; Li, Yefei, E-mail: yefeili@126.com; Sun, Liang; Wang, Yong
2017-05-31
Highlights: • The surface energy of graphite (0001) and Fe (110) has been calculated and the number of layers of graphite slab and Fe slab has been estimated. • The work of adhesion of Fe (110)/graphite (0001) interface with different interfacial separation d{sub 0} (1.7–3 Å) has been systematically discussed. • The total electron density and electron density difference of Fe (110)/graphite (0001) are used to study the bonding characteristics. • The Interfacial energy and fracture toughness of Fe (110)/graphite (0001) are estimated. - Abstract: Using first–principles calculations, we discuss the bulk properties of bcc Fe and graphite and that of the surface, the work of adhesion, and the electronic structure of Fe (110)/graphite (0001) interface. In this study, the experimental results of the bulk properties of bcc Fe and graphite reveal that our adopted parameters are reliable. Moreover, the results of surface energy demonstrate that nine atomic layers of graphite (0001) and five atomic layers of Fe (110) exhibit bulk–like interiors. The lattice mismatch of Fe (110)/graphite (0001) interface is about 6%. The results also exhibit that the Fe atom residing on top of the second layer of graphite slab (HCP structure) is the preferred stacking sequence. The work of adhesion (W{sub ad}) of the optimized Fe/graphite interface of HCP structure is 1.36 J/m{sup 2}. Electronic structures indicate that the bonding characteristics are a mixture of covalent and ionic bonds in the HCP interface. Moreover, the magnetic moment of atoms at the interface was studied using the spin polarized density of states.
International Nuclear Information System (INIS)
Campbell, C.T.
1984-01-01
The selective oxidation of ethylene to ethylene epoxide (C 2 H 4 +1/2O 2 →C 2 H 4 O) over Ag is the simplest example of kinetically controlled, selective heterogeneous catalysis. We have studied the steady-state kinetics and selectivity of this reaction for the first time on a clean, well-characterized Ag(110) surface by using a special apparatus which allows rapid (approx.20 s) transfer between a high-pressure catalytic microreactor and an ultrahigh vacuum surface analysis (AES, XPS, LEED, TDS) chamber. The effects of temperature and reactant pressures upon the rate and selectivity are virtually identical on Ag(110) and supported, high surface area Ag catalysts. The absolute specific rate (per Ag surface atom) is, however, some 100-fold higher for Ag(110) than for high surface area catalysts. This is related to the well-known structural sensitivity of this reaction. It is postulated that a small percentage of (110) planes (or [110]-like sites) are responsible for most of the catalytic activity of high surface area catalysts. The high activity of the (110) plane is attributed to its high sticking probability for dissociative oxygen adsorption, since the rate of ethylene epoxidation is shown in a related work [Ref. 1: C. T. Campbell and M. T. Paffett, Surf. Sci. (in press)] to be proportional to the coverage of atomically adsorbed oxygen at constant temperature and ethylene pressure
Photochemistry of 1,1,1-Trifluoroacetone on Rutile TiO2(110)
International Nuclear Information System (INIS)
Zehr, Robert T.; Deskins, N. Aaron; Henderson, Michael A.
2010-01-01
The ultraviolet (UV) photon-induced photodecomposition of 1,1,1-trifluoroacetone (TFA) adsorbed on the rutile TiO2(110) surface has been investigated with photon stimulated desorption (PSD), temperature programmed desorption (TPD) and density functional theory (DFT). TFA adsorbed molecularly on the reduced surface (8% oxygen vacancies) in states desorbing below 300 K with trace thermal decomposition observed in TPD. Adsorption of TFA on a preoxidized TiO2(110) surface (accomplished by pre-exposure with 20 L O2) led to formation of a new TFA desorption state at 350 K, assigned to decomposition of a TFA-diolate species ((CF3)(CH3)COO). No TFA photochemistry was detected on the reduced surface. UV irradiation of TFA on the oxidized surface depleted TFA in the 350 K state, with TFA molecules in other TPD states unaffected. PSD measurements reveal that both carbonyl substituents (CH3 and CF3), as well as CO, were liberated during UV exposure at 95 K. Post-irradiation TPD showed evidence for both acetate (evolving as ketene at 650 K) and trifluoroacetate (evolving as CO2 at 600 K) as surface-bound photodecomposition products. The CO PSD product was not due to adsorbed CO, to mass spectrometer cracking of a CO-containing PSD product, or from background effects, but originated from complete fragmentation of an unidentified adsorbed TFA species. Thermodynamic analysis using DFT indicated that the photodecomposition of the TFA-diolate was likely not driven by thermodynamics alone as both pathways (CH3+trifluoroacetate and CF3+acetate) were detected when thermodynamics shows a clear preference for only one (CF3+acetate). These observations are in contrast to the photochemical behavior of acetone, butanone and acetaldehyde on TiO2(110), where only one of the two carbonyl substituent groups was observed, with a stoichiometric amount of carboxylate containing the other substituent left on the surface. We conclude that fluorination significantly alters the electronic structure of
Do cosmological data rule out f (R ) with w ≠-1 ?
Battye, Richard A.; Bolliet, Boris; Pace, Francesco
2018-05-01
We review the equation of state (EoS) approach to dark sector perturbations and apply it to f (R ) gravity models of dark energy. We show that the EoS approach is numerically stable and use it to set observational constraints on designer models. Within the EoS approach we build an analytical understanding of the dynamics of cosmological perturbations for the designer class of f (R ) gravity models, characterized by the parameter B0 and the background equation of state of dark energy w . When we use the Planck cosmic microwave background temperature anisotropy, polarization, and lensing data as well as the baryonic acoustic oscillation data from SDSS and WiggleZ, we find B0<0.006 (95% C.L.) for the designer models with w =-1 . Furthermore, we find B0<0.0045 and |w +1 |<0.002 (95% C.L.) for the designer models with w ≠-1 . Previous analyses found similar results for designer and Hu-Sawicki f (R ) gravity models using the effective field theory approach [Raveri et al., Phys. Rev. D 90, 043513 (2014), 10.1103/PhysRevD.90.043513; Hu et al., Mon. Not. R. Astron. Soc. 459, 3880 (2016), 10.1093/mnras/stw775]; therefore this hints for the fact that generic f (R ) models with w ≠-1 can be tightly constrained by current cosmological data, complementary to solar system tests [Brax et al., Phys. Rev. D 78, 104021 (2008), 10.1103/PhysRevD.78.104021; Faulkner et al., Phys. Rev. D 76, 063505 (2007), 10.1103/PhysRevD.76.063505]. When compared to a w CDM fluid with the same sound speed, we find that the equation of state for f (R ) models is better constrained to be close to -1 by about an order of magnitude, due to the strong dependence of the perturbations on w .
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Use of TIAs. 603.110 Section 603.110 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS General § 603.110 Use of TIAs. The ultimate goal for using a TIA is to broaden the technology base available to meet DOE mission...
International Nuclear Information System (INIS)
de Hosson, J.T.M.
1976-01-01
The positions of the metal atoms around a 1 / 2 (111) (110) edge dislocation in Mo and W are calculated using the Wilson-Johnson potentials. The boundary conditions are given by anisotropic elasticity theory. After the lattices have been relaxed the potential energy of a He atom was calculated for a grid of positions within a block around the dislocation core, which extends over six planes in the (112) direction. The He-metal potential, also developed by Johnson and Wilson was used to calculate the position with maximum energy gain for a He atom. The binding energies of the He atom in the dislocated lattice for Mo and W were 1.55 eV and 1.53 eV, respectively. The second part of the investigation concerns the Peierls stresses for a 1 / 2 (111) (110) edge dislocation in α-Fe, with and without a carbon atom. The Peierls energy and stress are calculated for this slip-system based on the method originally used by Nabarro. The Peierls stresses (at zero absolute temperature) for the lattice with and without a carbon atom, are 0.006 μ and 0.009 μ, respectively. These calculations were carried out utilizing the Wilson-Johnson potential for the Fe-Fe interaction and the Johnson potential was used for the Fe-C interaction
Wolhart, Walter D.; Thomas, David F., Jr.
1955-01-01
An experimental investigation has been made in the Langley stability tunnel to determine the low-speed yawing, pitching, and static stability characteristics of a 1/10-scale model of the Grumman F9F-9 airplane. Tests were made to determine the effects of duct-entrance-fairing plugs on the static lateral and longitudinal stability characteristics of the complete model in the clean condition. The remaining tests were concerned with determining tail contributions as well as the effect of duct-entrance-fairing plugs, slats, flaps, and landing gear on the yawing and pitching stability derivatives. These data are presented without analysis in order to expedite distribution.
Translocation, accumulation and distribution of 110mAg in carp
International Nuclear Information System (INIS)
Li Chuanzhao; Zhao Wenhu; Xu Shiming
1995-01-01
The experimental carp were raised in the water with 110m Ag specific activity of 3.7 x 10 2 Bq/L, 3.7 x 10 3 Bq/L, 3.7 x 10 4 Bq/L respectively. The carp were sampled after raising 1,2,3,5,7,9,12,15,18,21 and 23 days, and separated into scale, bone, muscle, gill, alimentary canal, heart and heptapancreas for measuring the radioactivity. The results showed that 110m Ag was absorbed rapidly by carp via gill and alimentary canal from water, and distributed into all parts of the body, mainly in soft tissue with blood circulation. 110m Ag accumulation of the body increased with the 110m Ag specific activity in the water in the same raising time. The accumulation of 110m Ag in gill, alimentary canal, heart, muscle and bone appeared mono-peak curves with raising time. There was a linear relationship between the specific activity of 110m Ag in heptapancreas and the carp's raising time in 110m Ag water. The concentration abilities for 110m Ag in all organs were in the order of heptapancreas>gill>alimentary>canal>heart>muscle>bone
33 CFR 110.70a - Northeast River, North East, Md.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast River, North East, Md. 110.70a Section 110.70a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.70a Northeast River, North East, Md. The water...
Directory of Open Access Journals (Sweden)
A. Badoiu
2005-02-01
Full Text Available The 3 2 cycloaddition reaction of 1-(4-phenylphenacyl-1,10-phenanthrolinium ylide with activated alkynes gave pyrrolo[1,2- 4a][1,10]phenanthrolines 6a-d. The "one pot" synthesis of 6a,b,d from 4, activatedalkenes, Et3N and tetrakis-pyridine cobalt (II dichromate (TPCD is described. Thehelical chirality of pyrrolophenanthrolines 6b-d was put in evidence by NMRspectroscopy.
Bench-scale crossflow filtration of Hanford tank C-106, C-107, B-110, and U-110 sludge slurries
International Nuclear Information System (INIS)
Geeting, J.G.H.; Reynolds, B.A.
1997-09-01
Pacific Northwest National Laboratory has a bench-scale crossflow filter installed in a shielded hot cell for testing radioactive feeds. During FY97 experiments were conducted on slurries from radioactive Hanford waste from tanks C-106, C-107, B-110, and U-110. Each tank was tested at three slurry concentrations (8, 1.5, and 0.05 wt% solids). A two-parameter central composite design which tested transmembrane pressure from 5 to 40 psig and axial velocity from 3 to 9 ft/s was used for all feeds. Crossflow filtration was found to remove solids effectively, as judged by filtrate clarity and radiochemical analysis. If the filtrates from these tests were immobilized in a glass matrix, the resulting transuranic and ( 90 Sr) activity would not breach low activity waste glass limits of 100nCi/g (TRU) and 20 μCi/ml ( 90 Sr). Two exceptions were the transuranic activity in filtrates from processing 1.5 and 8 wt% C-106 tank waste. Subsequent analyses indicated that the source of the TRU activity in the filtrate was most likely due to soluble activity, but obviously proved ineffective at removing the soluble plutonium species. Re-testing of the C-106 supported this hypothesis. These data suggest the need to control carbonate and pH when processing tank wastes for immobilization
33 CFR 110.74c - Bahia de San Juan, PR.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bahia de San Juan, PR. 110.74c Section 110.74c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.74c Bahia de San Juan, PR. The waters of San Antonio...
Probing the (110)-Oriented plane of rutile ZnF2: A DFT investigation
Tamijani, Ali Abbaspour; Ebrahimiaqda, Elham
2017-12-01
For many years, rutile-like crystals have given rise to pronounced enthusiasm amongst mineralogists. In this context, rutile-type ZnF2 has found numerous applications across a variety of disciplines, ranging from material sciences to optoelectronics. Surprisingly, very limited literature is concerned with the molecular adsorption on ZnF2 surfaces and related energetics. Additionally, surface probing with small particles is a well-entrenched technique to analyze the interfacial properties. In this regard, small organic species are valuable picks. In the present work, we have employed electronic structure calculations to simulate the adsorption of methane, chloroform, pyrrole, benzene, naphthalene, anthracene, tetracene and pentacene at the (110) plane of rutile ZnF2. Dispersion-corrected DFT method was chosen to predict the binding energies and structures of molecule-adsorbed surfaces. Interestingly, a linear proportionality relationship was found between the binding energies of aromatic adsorbates and their respective molecular lengths. By applying this relationship, we were able to predict the adsorption energy of pentacene on ZnF2 to within 2% of our DFT-based result.
Rumen bacterial diversity of 80 to 110-day-old goats using 16S rRNA sequencing.
Directory of Open Access Journals (Sweden)
Xufeng Han
Full Text Available The ability of rumen microorganisms to use fibrous plant matter plays an important role in ruminant animals; however, little information about rumen colonization by microbial populations after weaning has been reported. In this study, high-throughput sequencing was used to investigate the establishment of this microbial population in 80 to 110-day-old goats. Illumina sequencing of goat rumen samples yielded 101,356,610 nucleotides that were assembled into 256,868 reads with an average read length of 394 nucleotides. Taxonomic analysis of metagenomic reads indicated that the predominant phyla were distinct at different growth stages. The phyla Firmicutes and Synergistetes were predominant in samples taken from 80 to 100-day-old goats, but Bacteroidetes and Firmicutes became the most abundant phyla in samples from 110-day-old animals. There was a remarkable variation in the microbial populations with age; Firmicutes and Synergistetes decreased after weaning, but Bacteroidetes and Proteobacteria increased from 80 to 110 day of age. These findings suggested that colonization of the rumen by microorganisms is related to their function in the rumen digestive system. These results give a better understanding of the role of rumen microbes and the establishment of the microbial population, which help to maintain the host's health and improve animal performance.
Structural and spectroscopic studies of 2,9-dimethyl-1,10 ...
African Journals Online (AJOL)
The crystal structures of the pronated ligand, 2,9-dimethyl-1,10-phenanthrolinium (DPH) cation with selected counter anions (chloride (1), triflate (2), and gold dicyanide (3)) are reported. The role of a hydrogen bond interaction in influencing the solid state p-p stacking found in all three compounds has been investigated.
Bismuth-induced restructuring of the GaSb(110) surface
DEFF Research Database (Denmark)
Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.
1998-01-01
The structure of the GaSb(110)(1 x 2)-Bi reconstruction has been solved using surface x-ray diffraction, scanning tunneling microscopy, and photoelectron spectroscopy. The ideal GaSb(110) surface is terminated with zigzag chains of anions and cations running in the [1 (1) over bar 0] direction...
Directory of Open Access Journals (Sweden)
J. Ojeda
2016-03-01
Full Text Available A tuneable repetition rate extreme ultraviolet source (Harmonium for time resolved photoelectron spectroscopy of liquids is presented. High harmonic generation produces 30–110 eV photons, with fluxes ranging from ∼2 × 1011 photons/s at 36 eV to ∼2 × 108 photons/s at 100 eV. Four different gratings in a time-preserving grating monochromator provide either high energy resolution (0.2 eV or high temporal resolution (40 fs between 30 and 110 eV. Laser assisted photoemission was used to measure the temporal response of the system. Vibrational progressions in gas phase water were measured demonstrating the ∼0.2 eV energy resolution.
The Peierls stress of the moving 1/2{110} screw dislocation in Ta
International Nuclear Information System (INIS)
Liu Ruiping; Wang Shaofeng; Wu Xiaozhi
2009-01-01
The Peierls stress of the moving 1/2 {110} screw dislocation with a planar and non-dissociated core structure in Ta has been calculated. The elastic strain energy which is associated with the discrete effect of the lattice and ignored in classical Peierls-Nabarro (P-N) theory has been taken into account in calculating the Peierls stress, and it can make the Peierls stress become smaller. The Peierls stress we obtain is very close to the experimental data. As shown in the numerical calculations and atomistic simulations, the core structure of the screw dislocation undergoes significant changes under the explicit stress before the screw dislocation moves. Moreover, the mechanism of the screw dislocation is revealed by our results and the experimental data that the screw dislocation retracts its extension in three {110} planes and transforms its dissociated core structure into a planar configuration. Therefore, the core structure of the moving 1/2 {110} screw dislocation in Ta is proposed to be planar.
44 CFR 19.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.110 Remedial and... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 19.110 Section 19.110 Emergency Management and Assistance FEDERAL EMERGENCY...
Quasiparticle interfacial level alignment of highly hybridized frontier levels: H2O on TiO2(110).
Migani, Annapaola; Mowbray, Duncan J; Zhao, Jin; Petek, Hrvoje
2015-01-13
Knowledge of the frontier levels' alignment prior to photoirradiation is necessary to achieve a complete quantitative description of H2O photocatalysis on TiO2(110). Although H2O on rutile TiO2(110) has been thoroughly studied both experimentally and theoretically, a quantitative value for the energy of the highest H2O occupied levels is still lacking. For experiment, this is due to the H2O levels being obscured by hybridization with TiO2(110) levels in the difference spectra obtained via ultraviolet photoemission spectroscopy (UPS). For theory, this is due to inherent difficulties in properly describing many-body effects at the H2O-TiO2(110) interface. Using the projected density of states (DOS) from state-of-the-art quasiparticle (QP) G0W0, we disentangle the adsorbate and surface contributions to the complex UPS spectra of H2O on TiO2(110). We perform this separation as a function of H2O coverage and dissociation on stoichiometric and reduced surfaces. Due to hybridization with the TiO2(110) surface, the H2O 3a1 and 1b1 levels are broadened into several peaks between 5 and 1 eV below the TiO2(110) valence band maximum (VBM). These peaks have both intermolecular and interfacial bonding and antibonding character. We find the highest occupied levels of H2O adsorbed intact and dissociated on stoichiometric TiO2(110) are 1.1 and 0.9 eV below the VBM. We also find a similar energy of 1.1 eV for the highest occupied levels of H2O when adsorbed dissociatively on a bridging O vacancy of the reduced surface. In both cases, these energies are significantly higher (by 0.6 to 2.6 eV) than those estimated from UPS difference spectra, which are inconclusive in this energy region. Finally, we apply self-consistent QPGW (scQPGW1) to obtain the ionization potential of the H2O-TiO2(110) interface.
Magnetic properties of deformed dipole bands in 110,112Te
International Nuclear Information System (INIS)
Evans, A O; Paul, E S; Boston, A J; Chantler, H J; Chiara, C J; Devlin, M; Fletcher, A M; Fossan, D B; LaFosse, D R; Lane, G J; Lee, I Y; Macchiavelli, A O; Nolan, P J; Sarantites, D G; Sears, J M; Semple, A T; Smith, J F; Starosta, K; Vaman, C; Ragnarsson, I; Afanasjev, A V
2006-01-01
A lifetime analysis using the Doppler-shift attenuation method has been performed on the Tellurium isotopes 110,112 Te. The experiment was performed using the Gammasphere array in conjunction with the MICROBALL charged-particle detector. Three strongly coupled bands were previously established in 110,112 Te which were observed up to unusually high spins. In the current experiment, it has been possible to extract lifetime measurements using a Doppler broadened lineshape analysis on one of the ΔI=1 band structures in 110 Te. In contrast to similar ΔI=1 structures in other nuclei in this mass region, the extracted B(M1) values did not rapidly decrease with increasing angular momentum. Instead, the strongly coupled band in 110 Te represents a deformed 1p-1h structure, rather than a weakly deformed structure showing the shears mechanism
41 CFR 101-25.110-3 - Tires accompanying new motor vehicles.
2010-07-01
... motor vehicles. 101-25.110-3 Section 101-25.110-3 Public Contracts and Property Management Federal...-GENERAL 25.1-General Policies § 101-25.110-3 Tires accompanying new motor vehicles. The tire identifications and recordkeeping regulations issued by the Department of Transportation require each motor...
33 CFR 110.233 - Prince William Sound, Alaska.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Prince William Sound, Alaska. 110... ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.233 Prince William Sound, Alaska. (a) The anchorage grounds. In Prince William Sound, Alaska, beginning at a point at latitude 60°40′00″ N., longitude 146°40...
33 CFR 110.120 - San Luis Obispo Bay, Calif.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false San Luis Obispo Bay, Calif. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.120 San Luis Obispo Bay, Calif. (a) Area A-1. Area A-1 is the water area bounded by the San Luis Obispo County wharf, the shoreline, a line drawn...
STS-110 Crew Interview: Jerry Ross
2002-01-01
STS-110 Mission Specialist Jerry Ross is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Ross outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Ross discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.
STS-110 Crew Interview: Stephen Frick
2002-01-01
STS-110 Pilot Stephen Frick is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Frick outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Frick discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.
Atomic and electronic structure of V-Rh(110) near-surface alloy
Czech Academy of Sciences Publication Activity Database
Píš, I.; Stetsovych, V.; Mysliveček, J.; Kettner, M.; Vondráček, Martin; Dvořák, F.; Mazur, D.; Matolín, V.; Nehasil, V.
2013-01-01
Roč. 117, č. 24 (2013), s. 12679-12688 ISSN 1932-7447 Institutional support: RVO:68378271 Keywords : V−Rh(110) near-surface alloy * STM * XPS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.835, year: 2013
Exfoliation and van der Waals heterostructure assembly of intercalated ferromagnet Cr1/3TaS2
Yamasaki, Yuji; Moriya, Rai; Arai, Miho; Masubuchi, Satoru; Pyon, Sunseng; Tamegai, Tsuyoshi; Ueno, Keiji; Machida, Tomoki
2017-12-01
Ferromagnetic van der Waals (vdW) materials are in demand for spintronic devices with all-two-dimensional-materials heterostructures. Here, we demonstrate mechanical exfoliation of magnetic-atom-intercalated transition metal dichalcogenide Cr1/3TaS2 from its bulk crystal; previously such intercalated materials were thought difficult to exfoliate. Magnetotransport in exfoliated tens-of-nanometres-thick flakes revealed ferromagnetic ordering below its Curie temperature T C ~ 110 K as well as strong in-plane magnetic anisotropy; these are identical to its bulk properties. Further, van der Waals heterostructure assembly of Cr1/3TaS2 with another intercalated ferromagnet Fe1/4TaS2 is demonstrated using a dry-transfer method. The fabricated heterojunction composed of Cr1/3TaS2 and Fe1/4TaS2 with a native Ta2O5 oxide tunnel barrier in between exhibits tunnel magnetoresistance (TMR), revealing possible spin injection and detection with these exfoliatable ferromagnetic materials through the vdW junction.
Census of U.S. Civil Aircraft. Calendar Year 1982.
1982-12-31
3 TOTAL 0 3 3 PINE AIR SUPER V 4 51 20 1 F/W MULTI REC. ENG 51 0 1 1 TOTAL 0 1 1 PIPER AE-1 2 41 1 0 1 E-2 2 41 1 0 20 20 F-2 2 41 1 0 1 1 "-2 2 41 1...10 11 1 Montgomery 30 7 19 1 3 Muscatine 72 27 31 4 1 2 1 6 0 Brien 31 7 20 2 1 Osceola 10 4 6 Page 54 24 26 1 1 2 Palo Alto 24 7 16 1 Plymouth 32 11... Barren 23 4 14 1 4 Bath 5 2 3 Bell 15 4 8 1 Boone 21 6 12 1 2 Bourbon 3 1 1 Boyd 33 7 11 7 2 2 1 C-20 9r-°. .o U S REGISTERED GENERAL AVIATION
Mixed-ligand copper(II) complexes of dipicolylamine and 1,10 ...
Indian Academy of Sciences (India)
Unknown
DNA repair mechanism.13,14 Copper(II) complexes containing heterocyclic bases have received consid- erable current interest in nucleic acid chemistry due to their diverse applications following the discovery of the “chemical nuclease” activity of the [Cu. (phen)2]+ (phen = 1,10-phenanthroline) complex in the presence of ...
25 CFR 720.110 - Self-evaluation.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Self-evaluation. 720.110 Section 720.110 Indians THE...-evaluation. (a) The agency shall, by August 24, 1987, evaluate its current policies and practices, and the... or organizations representing handicapped persons, to participate in the self-evaluation process by...
Uniform Si nano-dot fabrication using reconstructed structure of Si(110)
Yano, Masahiro; Uozumi, Yuki; Yasuda, Satoshi; Asaoka, Hidehito
2018-06-01
Si nano-dot (ND) formation on Si(110) is observed by means of a scanning tunneling microscope (STM). The initial Si-NDs are Si crystals that are continuous from the substrate and grow during the oxide layer desorption. The NDs fabricated on the flat surface of Si(110)-1 × 1 are surrounded by four types of facets with almost identical appearance probabilities. An increase in the size of the NDs increases the variety of its morphology. In contrast, most Si-NDs fabricated on straight-stepped surface of Si(110)-16 × 2 reconstructed structure are surrounded by only a single type of facet, namely the \\text{Si}(17,15,1)-2 × 1 plane. An appearance probability of the facet in which the base line is along the step of Si(110)-16 × 2 exceeds 75%. This finding provides a fabrication technique of uniformed structural Si-NDs by using the reconstructed structure of Si(110).
36 CFR 223.110 - Delegation to regional forester.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation to regional forester. 223.110 Section 223.110 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 223.110 Delegation to regional forester. The Chief, Forest Service, after approval of conditions of...
33 CFR 110.129a - Apra Harbor, Guam. (Datum: WGS 84)
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. (Datum: WGS 84) 110.129a Section 110.129a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.129a Apra Harbor, Guam. (Datum: WGS 84) (a...
International Nuclear Information System (INIS)
Steinkilberg, M.; Menzel, D.
1977-01-01
Using UPS and XPS, the sequential adsorption of hydrogen + carbon monoxide, and of hydrogen + oxygen, on W(110) has been studied at room temperature. Adsorption of CO on a H-covered surface is rapid and leads to total displacement of hydrogen. The resulting CO layer however, is different from that formed on the clean surface under identical conditions, in that it consists of a higher percentage of virgin CO, while considerably more β-CO forms on the clean surface. Oxygen does not adsorb on a H-covered surface, nor displace hydrogen. It is concluded that hydrogen most probably occupies the same sites utilized by dissociative adsorption of CO and oxygen, while virgin CO can also occupy different sites; its adsorption can thus lead to interactional weakening of the H-surface bond. (Auth.)
Metal-ion complexes of functionalised 1,10-Phenanthrolines as hydrolytic synzymes
Weijnen, J.G.J.
1993-01-01
In this thesis metal-ion complexes of functionalised 1,10-phenanthroline derivatives have been studied as model systems for hydrolytic metallo-enzymes. Amphiphilic metallo- complexes incorporated into micelles or vesicles and water-soluble complexes in pure aqueous buffer solutions, have
International Nuclear Information System (INIS)
Lerche, W.; Pohl, M.; Schultze, K.; Derange, B.; Francois, T.; Van Dam, P.; Jaffre, M.; Longuemare, C.; Pascaud, C.; Calimani, E.; Ciampolillo, S.; Mattioli, F.
1978-01-01
The charged current cross-section ratio R = sigma(γ+n)/sigma(γ+p), averaged over the energy range, 1-10 GeV, is determined by two independent methods. The combined value is R = 2.08+-0.15. Semi-inclusive proton production rates on both proton and neutron targets are presented. Event rates of exclusive channels on the proton target are also given. (Auth.)
Adsorption of ethyl xanthate on ZnS(110) surface in the presence of water molecules: A DFT study
Energy Technology Data Exchange (ETDEWEB)
Long, Xianhao [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Chen, Jianhua, E-mail: jhchen@gxu.edu.cn [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Guangxi Colleges and University Key Laboratory of Minerals Engineering, 530004 (China); Chen, Ye, E-mail: fby18@126.com [College of Resources and Metallurgy, Guangxi University, Nanning 530004 (China)
2016-05-01
Graphical abstract: - Highlights: • Adsorption of water molecules decreases the reactivity of surface Zn atom. • Copper impurities decrease the band gap of ZnS surface. • Copper impurities enhance the adsorption of xanthate on the ZnS surface. • Water molecules have little influence on the properties of Cu-substituted ZnS surface. • The xanthate S atom can interact with the surface S atom of Cu-substituted ZnS surface. - Abstracts: The interaction of collector with the mineral surface plays a very important role in the froth flotation of sphalerite. The adsorptions occurred at the interface between the mineral surface and waters; however most of DFT simulations are performed in vacuum, without consideration of water effect. Semiconductor surface has an obvious proximity effect, which will greatly influence the surface reactivity. To understand the mechanism of xanthate interacting with sphalerite surface in the presence of water molecules, the ethyl xanthate molecule adsorption on un-activated and Cu-activated ZnS(110) surface in the absence and presence of water molecules were performed using the density functional theory (DFT) method. The calculated results show that the adsorption of water molecules dramatically changes the properties of ZnS surface, resulting in decreasing the reactivity of surface Zn atoms with xanthate. Copper activation of ZnS surface changes the surface properties, leading to the totally different adsorption behaviors of xanthate. The presence of waters has little influence on the properties of Cu-activated ZnS surface. The xanthate S atom can interact with the surface S atom of Cu-substituted ZnS surface, which would result in the formation of dixanthogen.
29 CFR 1650.110 - Implementation of salary offset.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Implementation of salary offset. 1650.110 Section 1650.110... Procedures for the Collection of Debts by Salary Offset § 1650.110 Implementation of salary offset. (a... proposed voluntary repayment agreement, deductions will begin in the next bi-weekly salary payment after a...
2010-04-01
... Frozen eggs. (a) Frozen eggs, frozen whole eggs, frozen mixed eggs is the food prepared by freezing... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen eggs. 160.110 Section 160.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
International Nuclear Information System (INIS)
Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Atac, M.; Auchincloss, P.; Azzi, P.; Bacchetta, N.; Baden, A.R.; Badgett, W.; Bailey, M.W.; Bamberger, A.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Bensinger, J.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Biery, K.; Bhadra, S.; Binkley, M.; Bisello, D.; Blair, R.; Blocker, C.; Bodek, A.; Bolognesi, V.; Booth, A.W.; Boswell, C.; Brandenburg, G.; Brown, D.; Buckley-Geer, E.; Budd, H.S.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carey, R.; Carithers, W.; Carlsmith, D.; Carroll, J.T.; Cashmore, R.; Castro, A.; Cen, Y.; Cervelli, F.; Chadwick, K.; Chapman, J.; Chiarelli, G.; Chinowsky, W.; Cihangir, S.; Clark, A.G.; Cobal, M.; Connor, D.; Contreras, M.; Cooper, J.; Cordelli, M.; Crane, D.; Cunningham, J.D.; Day, C.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Eno, S.; Errede, S.; Etchegoyen, A.; Farhat, B.; Frautschi, M.; Feldman, G.J.; Flaugher, B.; Foster, G.W.; Franklin, M.; Freeman, J.; Frisch, H.; Fuess, T.; Fukui, Y.; Gagliardi, G.; Garfinkel, A.F.; Gauthier, A.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Gold, M.; Gonzalez, J.; Goulianos, K.; Grassmann, H.; Grieco, G.M.; Grindley, R.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Handler, R.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Hessing, T.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Hubbard, B.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huth, J.; Hylen, J.; Incagli, M.; Ino, T.; Iso, H.; Jensen, H.; Jessop, C.P.; Johnson, R.P.; Joshi, U.; Kadel, R.W.; Kamon, T.; Kanda, S.; Kardelis, D.A.
1995-01-01
We have sought evidence for radiative decays of neutralinos produced in proton-antiproton collisions at √s=1.8TeV. Events containing two photons plus large missing transverse energy were investigated. The observed event rate and the missing transverse energy distribution of the two-photon events are consistent with QCD predictions. Inferred limits on squark and gluino masses depend on the supersymmetry model parameters. The particular choices μ=-40GeV/c 2 and tanβ=1.5 lead to 90%-confidence-level asymptotic lower limits of 110 GeV/c 2 and 140 GeV/c 2 for squarks and gluinos, respectively
Lõhmus, Uno, 1952-
2016-01-01
Riigikohtu kriminaalkolleegiumi määrusest kohtuasjas 3-1-1-110-15, kriminaalmenetluse seadustiku ja selle rakenduspraktika vastavusest Euroopa Parlamendi ja nõukogu 22. mai 2012. a direktiivi 2012/13/EL sättele ja mõttele ning Euroopa Inimõiguste Kohtu tunnustatud põhimõtetele
Poly[μ4-glutarato-di-μ3-glutarato-bis(1,10-phenanthrolinediyttrium(III
Directory of Open Access Journals (Sweden)
Ling Jin
2011-08-01
Full Text Available In the title complex, [Y2(C5H6O43(C12H8N22]n, three glutarate groups and two 1,10-phenanthroline molecules surround the two YIII ions. Both YIII ions are coordinated by two N atoms from the 1,10-phenanthroline, seven O atoms from five glutarate groups in a distorted tricapped trigonal–prismatic geometry. The YIII ions are bridged by glutarate ligands in three modes, forming a layered, polymeric structure. The resulting layers are assembled by π–π stacking interactions [centroid–centroid distances = 3.740 (3 and 3.571 (3 Å] into a three-dimensional supramolecular architecture.
Directional uv photoemission from (100) and (110) molybdenum surfaces
DEFF Research Database (Denmark)
Cinti, R. C.; Khoury, E. Al; Chakraverty, B. K.
1976-01-01
A study of the (100) and (110) molybdenum surfaces by directional photoemission spectroscopy is presented. Energy distribution spectra formed by photoelectrons emitted normal to the surfaces have been measured for photon energies between 10.2 and 21.2 eV. The results are discussed in terms of cal......-transition and surface-emission processes. Two extra structures are interpreted in terms of surface states or resonances: on the (100) surface, 0.5 eV below EF; on the (110) surface, 4.5 eV below EF in the s-d hybridization gap....... of calculated band structure within the framework of the K∥-conservation assumption. A good agreement is found between the main features of the experimental spectra and the emission expected from the band structure along the corresponding symmetry line in the Brillouin zone, assuming essentially direct...
International Nuclear Information System (INIS)
Kopecky, M.; Kub, J.; Maca, F.; Masek, J.; Pacherova, O.; Rushforth, A. W.; Gallagher, B. L.; Campion, R. P.; Novak, V.; Jungwirth, T.
2011-01-01
We report on high-resolution x-ray diffraction measurements of (Ga,Mn)As and (Ga,Mn)(As,P) epilayers. We observe a structural anisotropy in the form of stacking faults that are present in the (111) and (111) planes and absent in the (111) and (111) planes. They occupy 10 -2 %-10 -1 % of the ferromagnetic epilayer volume while no stacking faults are detected in the controlled, undoped GaAs epilayer. Full-potential density functional calculations provide additional evidence that the formation of the stacking faults is promoted by Mn attracted to these structural defects. The enhanced Mn density along the common [110] direction of the stacking fault planes produces a symmetry-breaking mechanism of a strength and sense that can account for the uniaxial [110]/[110] magnetocrystalline anisotropy of these ferromagnetic semiconductors.
Tank 241-BY-110 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110
24 CFR 598.110 - Tests of pervasive poverty, unemployment and general distress.
2010-04-01
..., unemployment and general distress. 598.110 Section 598.110 Housing and Urban Development Regulations Relating... TWO AND THREE DESIGNATIONS Eligibility Requirements § 598.110 Tests of pervasive poverty, unemployment...) Unemployment. Unemployment is demonstrated by: (1) The most recent data available indicating that the annual...
33 CFR 110.197 - Galveston Harbor, Bolivar Roads Channel, Texas.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Galveston Harbor, Bolivar Roads Channel, Texas. 110.197 Section 110.197 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Roads Channel, Texas. (a)(1) Anchorage area (A). The water bounded by a line connecting the following...
Class IA phosphatidylinositol 3-kinase p110α regulates phagosome maturation.
Directory of Open Access Journals (Sweden)
Emily P Thi
Full Text Available Of the various phosphatidylinositol 3- kinases (PI3Ks, only the class III enzyme Vps34 has been shown to regulate phagosome maturation. During studies of phagosome maturation in THP-1 cells deficient in class IA PI3K p110α, we discovered that this PI3K isoform is required for vacuole maturation to progress beyond acquisition of Rab7 leading to delivery of lysosomal markers. Bead phagosomes from THP-1 cells acquired p110α and contained PI3P and PI(3,4,5P3; however, p110α and PI(3,4,5P3 levels in phagosomes from p110α knockdown cells were decreased. Phagosomes from p110α knock down cells showed normal acquisition of both Rab5 and EEA-1, but were markedly deficient in the lysosomal markers LAMP-1 and LAMP-2, and the lysosomal hydrolase, β-galactosidase. Phagosomes from p110α deficient cells also displayed impaired fusion with Texas Red dextran-loaded lysosomes. Despite lacking lysosomal components, phagosomes from p110α deficient cells recruited normal levels of Rab7, Rab-interacting lysosomal protein (RILP and homotypic vacuole fusion and protein sorting (HOPs components Vps41 and Vps16. The latter observations demonstrated that phagosomal Rab7 was active and capable of recruiting effectors involved in membrane fusion. Nevertheless, active Rab7 was not sufficient to bring about the delivery of lysosomal proteins to the maturing vacuole, which is shown for the first time to be dependent on a class I PI3K.
Bis(1,10-phenanthroline-κ2N,N′(sulfato-κOcopper(II ethanol monosolvate
Directory of Open Access Journals (Sweden)
Natthaya Meundaeng
2013-10-01
Full Text Available The crystal structure of the title compound, [Cu(SO4(C12H8N22]·C2H5OH, arises from the assembly of the neutral complex [Cu(SO4(C12H8N22] and an ethanol solvent molecule. The CuII ion is five-coordinate, surrounded by two pairs of N atoms from two independent N,N′-chelating 1,10-phenanthroline ligands, and one O atom of monodentate sulfate ligand, in a distorted trigonal-bipyramidal fashion. Spatial orientation of the ligands and the assembly in the solid state are stabilized by the C—H...O hydrogen-bonding interactions, established between the O atoms (from the sulfate ligand and the ethanol molecule and the neighbouring 1,10-phenanthroline molecules. There is also an offset face-to-face π–π stacking between the 1,10-phenanthroline ligands. The ethanol solvent molecule is disordered over two orientations in the ratio 0.663 (10:0.337 (10. The crystal examined was subject to racemic twinning and the refined twin fraction was 0.346 (19.
da Costa, Marianges Zadrozny Gouvêa; Pires, Júlia Glória Lucatelli; Nasser, Paulo Dominguez; Ferreira, Camila da Silva; Teixeira, Ana Cristina de Sá; Paranaguá-Vezozzo, Denise Cerqueira; Guarita, Dulce Reis; Carrilho, Flair José; Ono, Suzane Kioko
2016-10-01
This study aimed to investigate the association between chronic pancreatitis and smoking or genetic mutations. The study sample comprised 148 patients with chronic pancreatitis, 110 chronic alcoholic subjects without pancreatic disease, and 297 volunteer blood donors. Of the patients with chronic pancreatitis, 74% had alcoholic etiology and 26% had idiopathic pancreatitis. The frequency of smoking was 91.4% in patients with alcoholic pancreatitis, higher than 73.3% in alcoholic subjects without pancreatitis (P pancreatitis and blood donors. The N34S mutation of serine peptidase inhibitor, Kazal type 1 (SPINK1) was found in 2.7% of patients with chronic alcoholic pancreatitis, in 5.3% of patients with idiopathic pancreatitis, and in 0.4% of blood donors (P = 0.02). The P55S mutation of SPINK1 was found in 2.7% of patients with alcoholic pancreatitis and in 0.7% of blood donors (P = 0.12). The R254W mutation of chymotrypsin C was found in 0.9% of patients with alcoholic pancreatitis, in 0.9% of chronic alcoholic subjects without pancreatitis, and in 0.4% of blood donors (P = 0.75). In all cases, the mutations were heterozygous. Smoking and the N34S mutation of SPINK1 were positively correlated with chronic pancreatitis.
U.S. EPA, Pesticide Product Label, BROGDEX 594-F, 06/08/1984
2011-04-14
... ric •• .. t ,.1 '~'1 .. ':: 1;1 ), .'dll.)I\\S "f :.'.l1r .. ·,1 -1llut 1 .. 0 ,I fH,I~,jCX )vi) ~~"tI~C .... dX fur lu".) pp:n Hll .. 11.:> ~CI)l~n. USC b ~un~e. ut Sr~~J~x ...
Reactions of OH Radicals with Tris (1,10-Phenanthroline) Iron (II) Studied by Pulse Radiolysis
DEFF Research Database (Denmark)
Siekierska Floryan, E.; Pagsberg, Palle Bjørn
1976-01-01
The reaction of OH radicals with aqueous tris(1,10-phenanthroline)iron(II) leads to the formation of an adduct, which exhibits a broad absorption band at rmpH = 6, λmax = 460 nm, and epsilon (Porson)460 = 6700 (molar, decadic, 1 mol−1 cm−1). The rate of formation of the adduct is first order...... in complex concentration with a bimolecular rate constant Image independent of pH in the range pH 3–11. The adduct decays by mixed-order kinetics, but at 310 nm a second-order formation of a decay product can be directly observed. The reaction of OH radicals with aqueous 1,10-phenanthroline leads also...... to the formation of an adduct which absorbs in the whole visible region with a maximum at 425 nm and ε425 = 2612 (molar, decadic, 1 mol−1 cm−1) in neutral solution. The adduct exhibits a red shift in acidic and alkaline media. The formation is first order in 1,10-phenanthroline with a bimolecular rate constant...
Wolhart, Walter D.; Thomas, David F., Jr.
1955-01-01
An experimental investigation has been made in the Langley stability tunnel to determine the low-speed yawing, pitching, and static stability characteristics of a 1/10-scale model of the Grumman F9F-9 airplane. Tests were made to determine the effects of duct-entrance-fairing plugs on the static lateral and longitudinal stability characteristics of the complete model in the clean condition. The remaining tests were concerned with determining tail contributions as well as the effect of duct-entrance-fairing plugs, slats, flaps, and landing gear on the yawing and pitching stability derivatives. These data are presented without analysis in order to expedite distribution.
Sengupta, Isha; Das, Dipanwita; Singh, Shivaram Prasad; Chakravarty, Runu; Das, Chandrima
2017-12-15
Promyelocytic leukemia nuclear bodies (PML-NB) are sub-nuclear organelles that are the hub of numerous proteins. DNA/RNA viruses often hijack the cellular factors resident in PML-NBs to promote their proliferation in host cells. Hepatitis B virus (HBV), belonging to Hepadnaviridae family, remains undetected in early infection as it does not induce the innate immune response and is known to be the cause of several hepatic diseases leading to cirrhosis and hepatocellular carcinoma. The association of PML-NB proteins and HBV is being addressed in a number of recent studies. Here, we report that the PML-NB protein Speckled 110 kDa (Sp110) is SUMO1-modified and undergoes a deSUMOylation-driven release from the PML-NB in the presence of HBV. Intriguingly, Sp110 knockdown significantly reduced viral DNA load in the culture supernatant by activation of the type I interferon-response pathway. Furthermore, we found that Sp110 differentially regulates several direct target genes of hepatitis B virus protein X (HBx), a viral co-factor. Subsequently, we identified Sp110 as a novel interactor of HBx and found this association to be essential for the exit of Sp110 from the PML-NB during HBV infection and HBx recruitment on the promoter of these genes. HBx, in turn, modulates the recruitment of its associated transcription cofactors p300/HDAC1 to these co-regulated genes, thereby altering the host gene expression program in favor of viral persistence. Thus, we report a mechanism by which HBV can evade host immune response by hijacking the PML-NB protein Sp110, and therefore, we propose it to be a novel target for antiviral therapy. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Energy Technology Data Exchange (ETDEWEB)
Methfessel, Torsten
2010-12-09
This thesis provides an introduction into the technique of spin-polarized scanning tunnelling microscopy and spectroscopy as an experimental method for the investigation of magnetic nanostructures. Experimental results for the spin polarized electronic structure depending on the crystal structure of ultrathin Co layers, and depending on the direction of the magnetization for ultrathin Fe layers are presented. High-resolution measurements show the position-dependent spin polarization on a single copper-phthalocyanine molecule deposited on a ferromagnetic surface. Co was deposited by molecular beam epitaxy on the (110) surface of the bodycentered cubic metals Cr and Fe. In contrast to previous reports in the literature only two layers of Co can be stabilized in the body-centered cubic (bcc) structure. The bcc-Co films on the Fe(110) surface show no signs of epitaxial distortions. Thicker layers reconstruct into a closed-packed structure (hcp / fcc). The bcc structure increases the spin-polarization of Co to P=62 % in comparison to hcp-Co (P=45 %). The temperature-dependent spin-reorientation of ultrathin Fe/Mo(110) films was investigated by spin-polarized spectroscopy. A reorientation of the magnetic easy axis from the [110] direction along the surface normal to the in-plane [001] axis is observed at T (13.2{+-}0.5) K. This process can be identified as a discontinuous reorientation transition, revealing two simultaneous minima of the free energy in a certain temperature range. The electronic structure of mono- and double-layer Fe/Mo(110) shows a variation with the reorientation of the magnetic easy axis and with the direction of the magnetization. The investigation of the spin-polarized charge transport through a copper-phthalocyanine molecule on the Fe/Mo(110) surface provides an essential contribution to the understanding of spin-transport at the interface between metal and organic molecule. Due to the interaction with the surface of the metal the HOMO-LUMO energy
Cheng, Yongfeng; Han, Xuesong; Ouyang, Huangche; Rao, Yu
2012-03-18
An efficient method towards synthesis of 1,10-phenanthrolines is described. Through Lewis acid-catalyzed annulation reaction between 3-ethoxycyclobutanones and 8-aminoquinolines, a variety of unsymmetric and symmetric 1,10-phenanthroline derivatives were readily prepared with high regioselectivity at room temperature.
33 CFR 110.31 - Hull Bay and Allerton Harbor at Hull, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hull Bay and Allerton Harbor at Hull, Mass. 110.31 Section 110.31 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.31 Hull Bay and Allerton Harbor at...
International Nuclear Information System (INIS)
Kuranchie-Mensah, H.; Teyssie, J.-L.; Oberhaensli, F.; Metian, M.; Warnau, M.
2015-01-01
In coastal ecosystems where bivalves are often exposed to metal contamination, dietary exposure has been recognised as a dominant uptake pathway of trace metals in bivalves. The present study employed radiotracers ("6"5Zn and "1"1"0"mAg) to assess the assimilation efficiency (AE) of the two elements in Bloody cockles (Anadara senilis) from Narkwa Lagoon, Ghana. AE is an important parameter in determining bioavailability of trace elements from food. Zn and Ag bioavailabilty was assessed using single-feeding approach, followed by a 28–day depuration period, with two species of phytoplankton (Isochrysis galbana and Skelotonema costatum) used as food, and two different size groups of Bloody Cockles. Results indicate that AE of "6"5Zn and "1"1"0"mAg were influenced by the phytoplankton species used as food whereas, for both algal species, AE increased slightly with increasing cockle body size. Once taken up, "6"5Zn was relatively strongly retained in cockle’s flesh (biological half-live: ≈40 days) whereas "1"1"0"mAg was rapidly released (biological halflive: ≈5 days). A complementary experiment -using subcellular partitioning and in vitro digestion method- was performed to provide additional information on the proportion of "6"5Zn and "1"1"0mAg in the bloody cockle that is available for transfer to next trophic levels. Overall, this work highlighted that trace metal accumulation in marine filter feeders does depend on the metal bioavailability in food as well as on other biological factors, such as body size. (author)
Liu, Xiaodan; Liao, Wang; Peng, Hongxia; Luo, Xuequn; Luo, Ziyan; Jiang, Hua; Xu, Ling
2016-01-01
Abnormal expression of miRNAs is intimately related to a variety of human cancers. The purpose of this study is to confirm the expression of miR-181a and elucidate its physiological function and mechanism in pediatric acute myeloid leukemia (AML). Pediatric AML patients and healthy controls were enrolled, and the expression of miR-181a and ataxia telangiectasia mutated (ATM) in tissues were examined using quantitative PCR. Moreover, cell proliferation and cell cycle were evaluated in several cell lines (HL60, NB4 and K562) by using flow cytometry after transfected with miR-181a mimics and inhibitors, or ATM siRNA and control siRNA. Finally, ATM as the potential target protein of miR-181a was examined. We found that miR-181a was significantly increased in pediatric AML, which showed an inverse association with ATM expression. Overexpressed miR-181a in cell lines significantly enhanced cell proliferation, as well as increased the ratio of S-phase cells by miR-181a mimics transfection in vitro. Luciferase activity of the reporter construct identified ATM as the direct molecular target of miR-181a. ATM siRNA transfection significantly enhanced cell proliferation and increased the ratio of S-phase cells in vitro. The results revealed novel mechanism through which miR-181a regulates G1/S transition and cell proliferation in pediatric AML by regulating the tumor suppressor ATM, providing insights into the molecular mechanism in pediatric AML.
Energy Technology Data Exchange (ETDEWEB)
Baullini, R; Chaminade, R; Desneiges, P; Grjebine, T; Quidort, J; Wahl, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1953-07-01
The metastable state of Ta, whose period is around 20 microseconds, has been discovered by De BENEDETTI and Mc GOWAM who done measurements of deferred coincidences between the particles beta and the electrons of conversion given out by the hafnium radiated by thermal neutrons. We measured the period of {sup 181}Ta{sup *} by measures of deferred coincidences {beta}-e{sup -} and {beta}-{gamma}. A method of survey of the specter of photons amplitudes emitted by {sup 181}Ta{sup *} has been fit. This method permitted to solve the presence of {gamma} in the radiation emitted in synchronism with the deexcitation of {sup 181}Ta{sup *}. Finally in a last chapter, we propose a method of dosage of the {sup 181}Hf in presence of other radioelements. (M.B.) [French] L'etat metastable de Ta, dont la periode est voisine de 20 microsecondes, a ete decouvert par DE BENEDETTI et Mc GOWAM qui effectuaient des mesures de coincidences differees entre les particules beta et les electrons de conversion emis par du hafnium irradie par des neutrons thermiques. Nous avons mesure la periode de {sup 181}Ta{sup *} par des mesures de coincidences differees {beta}-e{sup -} et {beta}-{gamma}. Une methode d'etude du spectre d'amplitudes des photons emis par {sup 181}Ta{sup *} a ete mise au point. Cette methode a permis d'eclaircir la presence de {gamma} dans le rayonnement emis en synchronisme avec la desexcitation de {sup 181}Ta{sup *}. Enfin dans un dernier chapitre, on proposera une methode de dosage du {sup 181}Hf en presence d'autres radioelements. (M.B.)
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.110 Cacao nibs. (a... is “cacao nibs”, “cocoa nibs”, or “cracked cocoa”. (1) When the cacao nibs, or the cacao beans from...
21 CFR 110.93 - Warehousing and distribution.
2010-04-01
...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING... microbial contamination as well as against deterioration of the food and the container. ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Warehousing and distribution. 110.93 Section 110...
Silver-mediated oxidative C-H difluoromethylation of phenanthridines and 1,10-phenanthrolines.
Zhu, Sheng-Qing; Xu, Xiu-Hua; Qing, Feng-Ling
2017-10-17
A silver-mediated oxidative difluoromethylation of phenanthridines and 1,10-phenanthrolines with TMSCF 2 H is disclosed. This C-H difluoromethylation of N-containing polycyclic aromatics constitutes an efficient method for the regioselective synthesis of difluoromethylated N-heterocycles.
The DOE/NASA SRG110 Program Overview
Shaltens, R. K.; Richardson, R. L.
2005-12-01
The Department of Energy is developing the Stirling Radioisotope Generator (SRG110) for NASAs Science Mission Directorate for potential surface and deep space missions. The SRG110 is one of two new radioisotope power systems (RPSs) currently being developed for NASA space missions, and is capable of operating in a range of planetary atmospheres and in deep space environments. It has a mass of approximately 27 kg and produces more than 125We(dc) at beginning of mission (BOM), with a design lifetime of fourteen years. Electrical power is produced by two (2) free-piston Stirlings convertor heated by two General Purpose Heat Source (GPHS) modules. The complete SRG110 system is approximately 38 cm x 36 cm and 76 cm long. The SRG110 generator is being designed in 3 stages: Engineering Model, Qualification Generator, and Flight Generator. Current plans call for the Engineering Model to be fabricated and tested by October 2006. Completion of testing of the Qualification Generator is scheduled for mid-2009. This development is being performed by Lockheed Martin, Valley Forge, PA and Infinia Corporation, Kennewick, WA under contract to the Department of Energy, Germantown, Md. Glenn Research Center, Cleveland, Ohio is providing independent testing and support for the technology transition for the SRG110 Program.
21 CFR 110.110 - Natural or unavoidable defects in food for human use that present no health hazard.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Natural or unavoidable defects in food for human... PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD Defect Action Levels § 110.110 Natural or... natural or unavoidable defects to the lowest level currently feasible. (d) The mixing of a food containing...
Atomic structures of Cd Te and Cd Se (110) surfaces
International Nuclear Information System (INIS)
Watari, K.; Ferraz, A.C.
1996-01-01
Results are reported based on the self-consistent density-functional theory, within the local-density approximation using ab-initio pseudopotentials of clean Cd Te and Cd Se (110) surfaces. We analyzed the trends for the equilibrium atomic structures, and the variations of the bond angles at the II-VI (110). The calculations are sensitive to the ionicity of the materials and the results are in agreement with the arguments which predict that the relaxed zinc-blend (110) surfaces should depend on ionicity. (author). 17 refs., 1 figs., 3 tabs
High-temperature steam oxidation kinetics of the E110G cladding alloy
International Nuclear Information System (INIS)
Király, Márton; Kulacsy, Katalin; Hózer, Zoltán; Perez-Feró, Erzsébet; Novotny, Tamás
2016-01-01
In the course of recent years, several experiments were performed at MTA EK (Centre for Energy Research, Hungarian Academy of Sciences) on the isothermal high-temperature oxidation of the improved Russian cladding alloy E110G in steam/argon atmosphere. Using these data and designing additional supporting experiments, the oxidation kinetics of the E110G alloy was investigated in a wide temperature range, between 600 °C and 1200 °C. For short durations (below 500 s) or high temperatures (above 1065 °C) the oxidation kinetics was found to follow a square-root-of-time dependence, while for longer durations and in the intermediate temperature range (800–1000 °C) it was found to approach a cube-root-of-time dependence rather than a square-root one. Based on the results a new best-estimate and a conservative oxidation kinetics model were created. - Highlights: • Steam oxidation kinetics of E110G was studied at MTA EK based on old and new data. • New best-estimate and conservative steam oxidation kinetics were proposed for E110G. • The exponent of oxidation time changed depending on oxidation temperature. • A simple exponential curve was used instead of Arrhenius-type curve for the factor.
International Nuclear Information System (INIS)
Herreros Usher, Oscar; Maceiras de Jefimowicz, Elena; De la Vega Vedoya, Mario; Jorge Nassiff, Sonia
1980-01-01
Excitation functions and isomeric cross sections ratios have been measured for the 110 Cd (d,2n) and 111 Cd (d,3n) reactions in which the isomeric pair sup(110m)In/sup(110g)In is produced. Activation method was employed and the irradiations were performed at the synchrocyclotron of the Comision Nacional de Energia Atomica, Argentina, with an incident energy of 27.MeV. (author) [es
CP110 exhibits novel regulatory activities during centriole assembly in Drosophila
Franz, Anna; Roque, Hélio; Saurya, Saroj; Dobbelaere, Jeroen
2013-01-01
CP110 is a conserved centriole protein implicated in the regulation of cell division, centriole duplication, and centriole length and in the suppression of ciliogenesis. Surprisingly, we report that mutant flies lacking CP110 (CP110Δ) were viable and fertile and had no obvious defects in cell division, centriole duplication, or cilia formation. We show that CP110 has at least three functions in flies. First, it subtly influences centriole length by counteracting the centriole-elongating activity of several centriole duplication proteins. Specifically, we report that centrioles are ∼10% longer than normal in CP110Δ mutants and ∼20% shorter when CP110 is overexpressed. Second, CP110 ensures that the centriolar microtubules do not extend beyond the distal end of the centriole, as some centriolar microtubules can be more than 50 times longer than the centriole in the absence of CP110. Finally, and unexpectedly, CP110 suppresses centriole overduplication induced by the overexpression of centriole duplication proteins. These studies identify novel and surprising functions for CP110 in vivo in flies. PMID:24297749
Nikulin, S. A.; Rozhnov, A. B.; Belov, V. A.; Li, E. V.; Glazkina, V. S.
2011-11-01
Exploratory investigations of the influence of alloying and impurity content in the E110 alloy cladding tubes on the behavior under conditions of Loss of Coolant Accidents (LOCA) has been performed. Three alloys of E110 type have been tested: E110 alloy of nominal composition Zr-1%Nb (E110), E110 alloy of modified composition Zr-1%Nb-0.12%Fe-0.13%O (E110M), E110 alloy of nominal composition Zr-1%Nb with reduced impurity content (E110G). Alloys E110 and E110M were manufactured on the electrolytic basis and alloy E110G was manufactured on the basis of zirconium sponge. The high temperature oxidation tests in steam ( T = 1100 °C, 18% of equivalent cladding reacted (ECR)) have been conducted, kinetics of oxidation was investigated. Quantitative research of structure and fracture macrocharacteristics was performed by means of optical and electron microscopy. The results received were compared with the residual ductility of specimens. The results of the investigation showed the existence of "breakaway oxidation" kinetics and white spalling oxide in E110 and E110M alloys while the specimen oxidation kinetics in E110G alloy was characterized by a parabolic law and specimens had a dense black oxide. Oxygen and iron alloying in the E110 alloy positively changed the macrocharacteristics of structure and fracture. However, in general, it did not improve the resistance to embrittlement in LOCA conditions apparently because of a strong impurity influence caused by electrolytic process of zirconium production.
Photon emission spectroscopy of NiAl(110) in the scanning tunneling microscope
International Nuclear Information System (INIS)
Nilius, N.; Ernst, N.; Freund, H.-J.; Johansson, P.
2000-01-01
Spectroscopic measurements have been carried out of the light emitted from the NiAl(110)/W tunnel junction of a scanning tunneling microscope. The data reveal two prominent emission lines in the visible and near-infrared region. Corresponding model calculations assign the observed light emission to the radiating decay of the tip-induced plasmon excited in the tip-sample cavity. In agreement with the theory, a low- and a high-energy mode of the plasmon can be distinguished in the experimental data. Since the excitation probability of the two modes is determined by the size of the tunnel cavity, it can be influenced by the radius of the tunnel tip. A blunted tip favors the observation conditions of the higher mode
Eddy-resolving 1/10° model of the World Ocean
Ibrayev, R. A.; Khabeev, R. N.; Ushakov, K. V.
2012-02-01
The first results on simulating the intra-annual variability of the World Ocean circulation by use of the eddy-resolving model are considered. For this purpose, a model of the World Ocean with a 1/10° horizontal resolution and 49 vertical levels was developed (a 1/10 × 1/10 × 49 model of the World Ocean). This model is based on the traditional system of three-dimensional equations of the large-scale dynamics of the ocean and boundary conditions with an explicit allowance for water fluxes on the free surface of the ocean. The equations are written in the tripolar coordinate system. The numerical method is based on the separation of the barotropic and baroclinic components of the solution. Discretization in time is implemented using explicit schemes allowing effective parallelization for a large number of processors. The model uses the sub-models of the boundary layer of the atmosphere and the submodel of sea-ice thermodynamics. The model of the World Ocean was developed at the Institute of Numerical Mathematics of the Russian Academy of Sciences (INM RAS) and the P.P. Shirshov Institute of Oceanogy (IO RAS). The formulation of the problem of simulating the intra-annual variability of thermohydrodynamic processes of the World Ocean and the parameterizations that were used are considered. In the numerical experiment, the temporal evolution of the atmospheric effect is determined by the normal annual cycle according to the conditions of the international Coordinated Ocean-Ice Reference Experiment (CORE-I). The calculation was carried out on a multiprocessor computer with distributed memory; 1601 computational cores were used. The presented analysis demonstrates that the obtained results are quite satisfactory when compared to the results that were obtained by other eddy-resolving models of the global ocean. The analysis of the model solution is, to a larger extent, of a descriptive character. A detailed analysis of the results is to be presented in following works
Radiative decays of the upsilon (2S) resonance
International Nuclear Information System (INIS)
Irion, J.
1984-04-01
The Crystal Ball Detector at DORIS II was used to study radiative decays of the upsilon (2S) resonance with more than twice the previously available data. The inclusive photon spectrum of hadronic upsilon (2S) decays and the exclusive channel upsilon (2S) → γγ upsilon (1S) → γγ l + l - were analyzed. In the inclusive spectrum three significant photon lines at energies of Eγ 1 = (108.2 +- 0.7 +- 4) MeV, Eγ 1 = (127.1 +- 0.8 +- 4) MeV and Eγ 3 = (160.0 +- 2.4 +- 4) MeV with branching fractions of (6.0 +- 0.7 +- 0.9)%, (6.6 +- 0.8 +- 1.0)%, (2.6 +- 0.7 +- 0.8)% respectively were measured. The lines are consistent with being transitions from the upsilon (2S) to the 3 P 2 , 3 P 1 and 3 P 0 states. In addition a line at Eγ approx. 427 MeV was observed which is interpreted as transitions from the 3 P 2 1 states to the upsilon (1S). 17 references
Alpha decay of neutron-deficient isotopes with 52
Schardt, D; Kirchner, R; Klepper, O; Kurcewicz, W; Roeckl, E; Tidemand-Petersson, P
1981-01-01
Using /sup 58/Ni(/sup 58/Ni, xpyn) reactions and on-line mass separation, the alpha -decays of very neutron-deficient isotopes of tellurium, iodine, xenon and cesium were studied. The new isotopes /sup 106/Te (T/sub 1/2/=60/sub -10//sup +30/ mu s) and /sup 110/Xe were identified by their alpha -lines of 4160+or-30 keV and 3737+or-30 keV energy, respectively, with the genetic relationship between the two successive alpha -decays being verified experimentally, while for several other alpha -decaying isotopes more precise data were obtained. The observed alpha -decay properties are discussed within the systematics of energy and reduced width. (19 refs).
DEFF Research Database (Denmark)
Martinez, U.; Hansen, Jonas Ørbæk; Salazar, Estephania Lira
2012-01-01
microscopy studies, we here present experimental evidence for the existence of O vacancies along the ⟨11̅ 1⟩R step edges (OS vac.’s) on rutile TiO2(110). Both the distribution of bridging O vacancies on the terraces and temperature-programed reaction experiments of ethanol-covered TiO2(110) point...... to the existence of the OS vac.’s. Based on experiments and density functional theory calculations, we show that OS vac.’s are reactive sites for ethanol dissociation via O-H bond scission. Implications of these findings are discussed...
Cizmecioglu, Onur; Ni, Jing; Xie, Shaozhen; Zhao, Jean J; Roberts, Thomas M
2016-01-01
We aimed to understand how spatial compartmentalization in the plasma membrane might contribute to the functions of the ubiquitous class IA phosphoinositide 3-kinase (PI3K) isoforms, p110α and p110β. We found that p110β localizes to membrane rafts in a Rac1-dependent manner. This localization potentiates Akt activation by G-protein-coupled receptors (GPCRs). Thus genetic targeting of a Rac1 binding-deficient allele of p110β to rafts alleviated the requirement for p110β-Rac1 association for GPCR signaling, cell growth and migration. In contrast, p110α, which does not play a physiological role in GPCR signaling, is found to reside in nonraft regions of the plasma membrane. Raft targeting of p110α allowed its EGFR-mediated activation by GPCRs. Notably, p110β dependent, PTEN null tumor cells critically rely upon raft-associated PI3K activity. Collectively, our findings provide a mechanistic account of how membrane raft localization regulates differential activation of distinct PI3K isoforms and offer insight into why PTEN-deficient cancers depend on p110β. DOI: http://dx.doi.org/10.7554/eLife.17635.001 PMID:27700986
40 CFR 300.110 - National Response Team.
2010-07-01
... 40 Protection of Environment 27 2010-07-01 2010-07-01 false National Response Team. 300.110... PLAN Responsibility and Organization for Response § 300.110 National Response Team. National planning... agencies named in § 300.175(b). Each agency shall designate a member to the team and sufficient alternates...
Energy transfer in porous anodic alumina/rhodamine 110 nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Elhouichet, H., E-mail: habib.elhouichet@fst.rnu.tn [Laboratoire de Physico-Chimie des Materiaux Mineraux et leurs Applications, Centre National de Recherches en Sciences des Materiaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Departement de Physique, Faculte des Sciences de Tunis, University of Tunis Elmanar 2092 Tunis (Tunisia); Harima, N.; Koyama, H. [Hyogo University of Teacher Education, Kato, Hyogo 673-1494 (Japan); Gaponenko, N.V. [Belarusian State University of Informatics and Radioelectronics, P. Browki St. 6, 220013 Minsk (Belarus)
2012-09-15
We have used porous anodic alumina (PAA) films as templates for embedding rhodamine 110 (Rh110) molecules and examined their photoluminescence (PL) properties in detail. The analysis of the polarization memory (PM) of PL strongly suggests that there is a significant energy transfer from PAA to Rh110 molecules. The effect of annealing the PAA layer on the PL properties of the nanocomposite has been studied. The results show that the energy transfer becomes more efficient in annealed PAA. - Highlights: Black-Right-Pointing-Pointer Porous anodic alumina-rhodamine 110 nanocomposites are elaborated. Black-Right-Pointing-Pointer Efficient energy transfer from the host to Rh110 molecules is evidenced from measurements of photoluminescence and degree of polarization memory spectra. Black-Right-Pointing-Pointer Thermal annealing of porous anodic alumina can improve the process of excitation transfer.
Directory of Open Access Journals (Sweden)
Dhina Fitriastuti
2014-03-01
Full Text Available The synthesis of (1-N-(3,4-dimethoxy-benzyl-1,10-phenanthrolinium bromide had been conducted from vanillin. Heme polymerization inhibitory activity assay of the synthesized antiplasmodium has also been carried out. The first step of reaction was methylation of vanillin using dimethylsulfate and NaOH. The mixture was refluxed for 2 h to yield veratraldehyde in the form of light yellow solid (79% yield. Methylation product was reduced using sodium borohydride (NaBH4 with grinding method and yielded veratryl alcohol in the form of yellow liquid (98% yield. Veratryl alcohol was brominated using PBr3 to yield yellowish black liquid (85% yield. The final step was benzylation of 1,10-phenanthroline monohydrate with the synthesized veratryl bromide under reflux condition in acetone for 14 h to afford (1-N-(3,4-dimethoxy-benzyl-1,10-phenanthrolinium bromide (84% as yellow solid with melting point of 166-177 °C. The structures of products were characterized by FT-IR, GC-MS and 1H-NMR spectrometers. The results of heme polymerization inhibitory activity assay of (1-N-(3,4-dimethoxybenzyl-1,10-phenanthrolinium bromide showed that it had IC50 HPIA of 3.63 mM, while chloroquine had IC50 of4.37 mM. These results indicated that (1-N-(3,4-dimethoxybenzyl-1,10-phenanthrolinium bromide was more potential antiplasmodium than chloroquine.
Mechanism of oxidation of L-methionine by iron(III)-1,10 ...
Indian Academy of Sciences (India)
Unknown
Abstract. Kinetics and mechanism of oxidation of L-methionine by iron(III)–1,10- phenanthroline complex have been studied in perchloric acid medium. The reaction is first order each in iron(III) and methionine. Increase in [phenanthroline] increases the rate while increase in [HClO4] decreases it. While the reactive species ...
Unoccupied Surface State on Ag(110) as Revealed by Inverse Photoemission
Reihl, B.; Schlittler, R. R.; Neff, H.
1984-05-01
By use of the new technique of k-resolved inverse photoemission spectroscopy, an unoccupied s-like surface state on Ag(110) has been detected, which lies within the projected L2'-->L1 gap of the bulk. At the X¯ point of the surface Brillouin zone, the energy of the surface state is 1.65 eV above the Fermi level EF, and exhibits a band dispersion E(k∥) towards higher energies. The surface-state emission is immediately quenched when the surface is exposed to very small amounts of oxygen or hydrogen.
Targeting p110gamma in gastrointestinal cancers: attack on multiple fronts
Directory of Open Access Journals (Sweden)
Marco eFalasca
2014-10-01
Full Text Available Phosphoinositide 3-kinases (PI3Ks regulate several cellular functions that are critical for cancer progression and development, including cell survival, proliferation and migration. Three classes of PI3Ks exist with the class I PI3K encompassing four isoforms of the catalytic subunit known as p110α, p110β, p110γ and p110δ. Although for many years attention has been mainly focused on p110α recent evidence supports the conclusion that p110β, p110γ and p110δ can also have a role in cancer. Amongst these, accumulating evidence now supports the conclusion that p110γ is involved in several cellular processes associated with cancer development and progression and indeed this specific isoform has emerged as a novel important player in cancer progression. Studies from our laboratory have identified a specific overexpression of p110γ in human pancreatic ductal adenocarcinoma (PDAC and in hepatocellular carcinoma (HCC tissues compared to their normal counterparts. Our data have further established that selective inhibition of this PI3K isoform is able to block PDAC and HCC cell proliferation, strongly suggesting that pharmacological inhibition of this enzyme can directly affect these tumors growth. Furthermore increasing evidence suggests that p110γ plays also a key role in the interactions between cancer cells and tumor microenvironment and in particular in tumor-associated immune response. It has also been reported that p110γ can regulate invasion of myeloid cells into tumors and tumor angiogenesis. Finally p110γ has also been directly involved in regulation of cancer cell migration. Taken together these data indicate that p110γ plays multiple roles in regulation of several processes that are critical for tumor progression and metastasis. This review will discuss the role of p110γ in gastrointestinal tumor development and progression and how targeting this enzyme might represent a way to target very aggressive tumors such as pancreatic and
20 CFR 416.110 - Purpose of program.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Purpose of program. 416.110 Section 416.110... income program replaces the financial assistance programs for the aged, blind, and disabled in the 50... the program: (a) Objective tests. The law provides that payments are to be made to aged, blind, and...
Qin, Qi-Zhong; Chen, Yu; Fu, Ting-Ting; Ding, Li; Han, Ling-Li; Li, Jian-Chao
2012-03-01
To understand electromagnetic radiation field strength and its influencing factors of certain 110-kV high-voltage lines in one urban area of Chongqing by measuring 110-kV high-voltage line's electromagnetic radiation level. According to the methodology as determined by the National Hygienic Standards, we selected certain adjacent residential buildings, high-voltage lines along a specific street and selected different distances around its vertical projection point as monitoring points. The levels of electromagnetic radiations were measured respectively. In this investigation within the frequency of 5-1,000 Hz both the electric field strength and magnetic field strength of each monitoring sites were lower than the public exposure standards as determined by the International Commission on Non-Ionizing Radiation Protection. However, the electrical field strength on the roof adjacent to the high-voltage lines was significantly higher than that as measured on the other floors in the same buildings (p electromagnetic radiation measurements of different monitoring points, under the same high-voltage lines, showed the location which is nearer the high-voltage line maintain a consistently higher level of radiation than the more distant locations (p Electromagnetic radiation generated by high-voltage lines decreases proportionally to the distance from the lines. The buildings can to some extent shield (or absorb) the electric fields generated by high-voltage lines nearby. The electromagnetic radiation intensity near high-voltage lines may be mitigated or intensified by the manner in which the high-voltage lines are set up, and it merits attention for the potential impact on human health.
International Nuclear Information System (INIS)
Anghel, L.V.; Balasoiu, M.; Lazar, D.M.; Ishchenko, L.A.
2011-01-01
The composition of composites has a huge impact on the stability of tris-1,10-phenanthroline iron (II) complex during the determination of total iron content. The subject of this work is the determination of the stability of tris-1,10-phenanthroline iron (II) complex in samples of biominerals produced by bacteria Klebsiella oxytoca. The stability of this complex was monitored in the time period of 0-60 min. The aim of this work is to determine the concentration of the biogenic ferrihydrite in the samples and the time interval in which the absorbance of the complex is highest. The UV-Vis spectrophotometric method was used for the determination. Obtained results indicate that for more exact estimations of the concentration of biogenic ferrihydrite, absorbance of tris-1,10-phenanthroline iron (II) complex should be measured within 25 min from the moment ortho-phenanthroline was added
DEFF Research Database (Denmark)
Garcia-Mota, Monica; Vojvodic, Aleksandra; Metiu, Horia
2011-01-01
The oxygen evolution reaction (OER) on the rutile M-TiO2(110) (M = V, Nb, Ta, Cr, Mo, W, Mn, Fe, Ru, Ir, Ni) surfaces was investigated by using density functional theory calculations. The stability of different doped TiO2 systems was analyzed. The scaling relationship between the binding energies...... of OER intermediates (HOO* versus HO*) is found to follow essentially the same trend as for undoped oxides. Our theoretical analysis shows a lower overpotential associated with OER on the doped M-TiO2(110) than on the undoped TiO2(110). The theoretical activity of Cr-, Mo-, Mn-, and Ir-doped TiO2...
Orphan receptor GPR110, an oncogene overexpressed in lung and prostate cancer
International Nuclear Information System (INIS)
Lum, Amy M; Wang, Bruce B; Beck-Engeser, Gabriele B; Li, Lauri; Channa, Namitha; Wabl, Matthias
2010-01-01
GPR110 is an orphan G protein-coupled receptor--a receptor without a known ligand, a known signaling pathway, or a known function. Despite the lack of information, one can assume that orphan receptors have important biological roles. In a retroviral insertion mutagenesis screen in the mouse, we identified GPR110 as an oncogene. This prompted us to study the potential isoforms that can be gleaned from known GPR110 transcripts, and the expression of these isoforms in normal and transformed human tissues. Various epitope-tagged isoforms of GPR110 were expressed in cell lines and assayed by western blotting to determine cleavage, surface localization, and secretion patterns. GPR110 transcript and protein levels were measured in lung and prostate cancer cell lines and clinical samples, respectively, by quantitative PCR and immunohistochemistry. We found four potential splice variants of GPR110. Of these variants, we confirmed three as being expressed as proteins on the cell surface. Isoform 1 is the canonical form, with a molecular mass of about 100 kD. Isoforms 2 and 3 are truncated products of isoform 1, and are 25 and 23 kD, respectively. These truncated isoforms lack the seven-span transmembrane domain characteristic of GPR proteins and thus are not likely to be membrane anchored; indeed, isoform 2 can be secreted. Compared with the median gene expression of ~200 selected genes, GPR110 expression was low in most tissues. However, it had higher than average gene expression in normal kidney tissue and in prostate tissues originating from older donors. Although identified as an oncogene in murine T lymphomas, GPR110 is greatly overexpressed in human lung and prostate cancers. As detected by immunohistochemistry, GPR110 was overexpressed in 20 of 27 (74%) lung adenocarcinoma tissue cores and in 17 of 29 (59%) prostate adenocarcinoma tissue cores. Additionally, staining with a GPR110 antibody enabled us to differentiate between benign prostate hyperplasia and potential
Pharmacokinetics of Rhodamine 110 and Its Organ Distribution in Rats.
Jiang, Shiau-Han; Cheng, Yung-Yi; Huo, Teh-Ia; Tsai, Tung-Hu
2017-09-06
Rhodamine dyes have been banned as food additives due to their potential tumorigenicity. Rhodamine 110 is illegal as a food additive, although its pharmacokinetics have not been characterized, and no accurate bioanalytical methods are available to quantify rhodamine 110. The aim of this study was to develop and validate a fast, stable, and sensitive method to quantify rhodamine 110 using high-performance liquid chromatography coupled to tandem mass spectrometry (HPLC-MS/MS) to assess its pharmacokinetics and organ distribution in awake rats. Rhodamine 110 exhibited linear pharmacokinetics and slow elimination after oral administration. Furthermore, its oral bioavailability was approximately 34-35%. The distribution in the liver and kidney suggests that these organs are primarily responsible for rhodamine 110 metabolism and elimination. Our investigation describes the pharmacokinetics and a quantification method for rhodamine 110, improving our understanding of the food safety of rhodamine dyes.
The study of geometric structure of Na films on Cu(110)
International Nuclear Information System (INIS)
Zeybek, O.
2004-01-01
In order to understand the geometric structure of Na films on Cu( 110) substrate, a couple of surface science techniques have been applied in this study. The thickness of the Na films were calculated using X-ray Photoelectron Spectroscopy data and Mean Free Path. The coverages were compared with the work function changes in this study and other investigations. Sub-monolayer and up to 2 ML thickness of Na films on Cu(110) have been investigated using Low Energy Electron Diffraction (LEED) and Ultra Violet Inverse Photoelectron Spectroscopy. It is found that the (1 x 1) LEED pattern of Cu(110) changes to (1 x 2) with increasing Na coverage up to 1 ML. Af ter 1 ML Na films, LEED shows again (1 x 1) structure
International Nuclear Information System (INIS)
Olstad, R.A.; Moeller, C.P.; Grunloh, H.J.
1998-01-01
Electron Cyclotron Heating (ECH) is one of the major candidates for Heating and Current Drive on ITER. ECH is extremely attractive from a reactor engineering point of view, offering compact launch structures, high injected power density, and a simple interface with the shield/blanket. Economic deployment of ECH for ITER requires MW unit microwave sources (gyrotrons). The present technology limitation is the availability of suitable low loss output windows. These are needed for the torus as well as the tube. The torus window, in particular, is a demanding application as it also serves as a tritium barrier. Several distinct window concepts are under development by the various Parties. This report summarizes the efforts to make and test a open-quotes distributedclose quotes window suitable for 1 MW cw operation at 110 GHz. A companion report (Final Report on Task 245+) describes the efforts to make a distributed window suitable for 1 MW cw operation at 170 GHz, the main frequency of interest to ITER. General Atomics (GA) fabricated a 4 in. x 4 in. 110 GHz distributed window which was delivered in September 1995 to Communications and Power Industries (CPI). Hot tests at CPI confirmed the power handling capability of the window. Tests were conducted with a reduced beam size at 200 kW with 0.7 s pulses without any arcing or excessive window temperatures. The power density and pulse length were equivalent to that in a full size 1.2 MW CW beam with a peak-to-average power ratio of 2.7. This window was assembled using a gold braze material to bond the sapphire strips to the niobium frame. The braze was successful except for small leaks at two locations, and re-braze efforts were unsuccessful
33 CFR 110.8 - Lake Champlain, N.Y. and Vt.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Champlain, N.Y. and Vt. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.8 Lake Champlain, N.Y. and Vt. (a) Ticonderoga, N.Y. An area shoreward of a line bearing 312° from Ticonderoga Light to the southeast corner of the...
F-22 versus UCAV: Fixing Today’s Deficiencies Leaves Questions about Tomorrow’s Dominance
2009-12-01
International and Comparative Perspectives," In Handbook of Defence Politics, eds. Isaiah Wilson III and James J. F. Forest, 1st ed. (London, U.K...83 Wijk, European Military Reform for a Global Partnership, 200–204. 84 Thomas P. Barnett, The...Press, 2004), 416–418. 109 Ibid., 418. 110 Thomas G. Mahnken, Technology and the American Way of War (New York, NY: Columbia University Press, 2008
Chaudhari, Aditi; Krumlinde, Daniel; Lundqvist, Annika; Akyürek, Levent M; Bandaru, Sashidhar; Skålén, Kristina; Ståhlman, Marcus; Borén, Jan; Wettergren, Yvonne; Ejeskär, Katarina; Rotter Sopasakis, Victoria
2015-10-01
The phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K) catalytic subunit p110α is the most frequently mutated kinase in human cancer, and the hot spot mutations E542K, E545K, and H1047R are the most common mutations in p110α. Very little is known about the metabolic consequences of the hot spot mutations of p110α in vivo. In this study, we used adenoviral gene transfer in mice to investigate the effects of the E545K and H1047R mutations on hepatic and whole-body glucose metabolism. We show that hepatic expression of these hot spot mutations results in rapid hepatic steatosis, paradoxically accompanied by increased glucose tolerance, and marked glycogen accumulation. In contrast, wild-type p110α expression does not lead to hepatic accumulation of lipids or glycogen despite similar degrees of upregulated glycolysis and expression of lipogenic genes. The reprogrammed metabolism of the E545K and H1047R p110α mutants was surprisingly not dependent on altered p110α lipid kinase activity. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
45 CFR 2523.110 - Can Federal agencies submit multiple applications?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Can Federal agencies submit multiple applications? 2523.110 Section 2523.110 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION... AMERICORPS PROGRAM ASSISTANCE § 2523.110 Can Federal agencies submit multiple applications? No. The...
Quasi-CW 110 kW AlGaAs laser diode array module for inertial fusion energy laser driver
International Nuclear Information System (INIS)
Kawashima, Toshiyuki
2001-01-01
We have successfully demonstrated a large aperture 803 nm AlGaAs diode laser module as a pump source for a 1053 nm, 10 J output Nd: glass slab laser amplifier for diode-pumped solid-state laser (DPSSL) fusion driver. Detailed performance results of the laser diode module are presented, including bar package and stack configuration, and their thermal design and analysis. A sufficiently low thermal impedance of the stack was realized by combining backplane liquid cooling configuration with modular bar package architecture. Total peak power of 110 kW and electrical to optical conversion efficiently of 46% were obtained from the module consisting of a total of 1000 laser diode bars. A peak intensity of 2.6 kW/cm 2 was accomplished across an emitting area of 418 mm x 10 mm. Currently, this laser diode array module with a large two-dimensional aperture is, to our knowledge, the only operational pump source for the high output energy DPSSL. (author)
Bis(6-nitro-1,10-phenanthrolin-1-ium 2,5-dicarboxyterephthalate
Directory of Open Access Journals (Sweden)
Kai-Long Zhong
2014-03-01
Full Text Available In the structure of the title 2:1 proton-transfer compound, 2C12H8N3O2+·C10H4O82−, the 6-nitro-1,10-phenanthroline molecules act as proton sponges, accepting protons from pyromellitic acid. The –NO2 group of one of the 6-nitro-1,10-phenanthrolin-1-ium cations is disordered and was refined with a site-occupancy ratio of 0.624 (15:0.376 (15. Two –COOH(–COO− groups of the 2,5-dicarboxyterephthalate dianion are disordered and were refined with site-occupancy ratios of 0.769 (4:0.231 (4 and 0.766 (5:0.234 (5. The –NO2 group of the second cation is also disordered about a pseudo-twofold rotation axis and was refined with a site-occupancy ratio of 0.903 (3:0.097 (3. There is an intramolecular O—H...O hydrogen bond in the anion. The phenanthroline rings of the two cations are inclined to one another by 31.3 (1°. In the anions, considering the major components only, the carboxylic acid groups (–COOH are inclined to the benzene ring by 17.3 (2 and 22.3 (3°. The carboxylate groups (–COO− are twisted by 9.3 (2 and 13.6 (6° with respect to the benzene ring. In the crystal, adjacent 2,5-dicarboxyterephthalate anions are linked via O—H...O hydrogen bonds, forming chains propagating along [010]. The cations are attached to the chain of anions by N—H...O hydrogen bonds.
13 CFR 108.110 - Qualified management.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Qualified management. 108.110... management. An Applicant must show, to the satisfaction of SBA, that its current or proposed management team... or proposed management team has sufficient qualifications, SBA will consider information provided by...
Incorporation of detailed eye model into polygon-mesh versions of ICRP-110 reference phantoms.
Nguyen, Thang Tat; Yeom, Yeon Soo; Kim, Han Sung; Wang, Zhao Jun; Han, Min Cheol; Kim, Chan Hyeong; Lee, Jai Ki; Zankl, Maria; Petoussi-Henss, Nina; Bolch, Wesley E; Lee, Choonsik; Chung, Beom Sun
2015-11-21
The dose coefficients for the eye lens reported in ICRP 2010 Publication 116 were calculated using both a stylized model and the ICRP-110 reference phantoms, according to the type of radiation, energy, and irradiation geometry. To maintain consistency of lens dose assessment, in the present study we incorporated the ICRP-116 detailed eye model into the converted polygon-mesh (PM) version of the ICRP-110 reference phantoms. After the incorporation, the dose coefficients for the eye lens were calculated and compared with those of the ICRP-116 data. The results showed generally a good agreement between the newly calculated lens dose coefficients and the values of ICRP 2010 Publication 116. Significant differences were found for some irradiation cases due mainly to the use of different types of phantoms. Considering that the PM version of the ICRP-110 reference phantoms preserve the original topology of the ICRP-110 reference phantoms, it is believed that the PM version phantoms, along with the detailed eye model, provide more reliable and consistent dose coefficients for the eye lens.
International Nuclear Information System (INIS)
Chi, Se-Hwan
2015-01-01
Changes in flexural strength and Weibull modulus due to specimen size were investigated for three nuclear graphite grades, IG-110, NBG-18, and PCEA, using four-point-1/3 point (4-1/3) loading with specimens of three different sizes: 3.18 (Thickness) × 6.35 (Width) × 50.8 (Length), 6.50 (T) × 12.0 (W) × 52.0 (L), 18.0 (T) × 16.0 (W) × 64 (L) (mm) (total: 210 specimens). Results showed some specimen size effects were grade dependent: While NBG-18 (a) showed rather significant specimen size effects (37% difference between the 3 T and 18 T), the differences in IG-110 and PCEA were 7.6–15%. The maximum differences in flexural strength due to specimen size were larger in the PCEA and NBG-18 having larger sized coke particles (medium grain size: >300 μm) than the IG-110 with super fine coke particle size (25 μm). The Weibull modulus showed a data population dependency, in that it decreased with increasing numbers of data used for modulus determination. A good correlation between the fracture surface roughness and the flexural strength was confirmed
Energy Technology Data Exchange (ETDEWEB)
Park, Jiyoung; Kim, Ki-Suk; Kim, Kang-Hoon; Lee, In-Seung; Jeong, Hyeon-soo; Kim, Yumi; Jang, Hyeung-Jin, E-mail: hjjang@khu.ac.kr
2015-12-04
Glucagon-like peptide-1 (GLP-1) hormone is known to regulate blood glucose by an insulinotropic effect and increases proliferation as and also prevents apoptosis of pancreatic β cells. We know that GLP-1 is secreted by nutrients such as fatty acids and sweet compounds but also bitter compounds via stimulation of G-protein coupled receptors (GPCRs) in the gut. Among these, bitter compounds are multiply-contained in phytochemicals or artificial materials and perceived as ligands of various bitter taste receptors. We hypothesized that GLP-1 hormone is secreted through stimulation of a single bitter taste receptor by 1,10-phenanthroline which is known agonist of taste receptor type 2 member 5 (T2R5). To prove this hypothesis, we used the representatively well-known 1,10-phenanthroline as ligand of single receptor and evaluated the existence of T2R5 by double-labeling immunofluorescence and then 1,10-phenanthroline is able to secrete GLP-1 hormone through stimulation of T2R5 in human enteroendocrine cells. Consequently, we verify that GLP-1 hormone is colocalized with T2R5 in the human duodenum and ileum tissue and is secreted by 1,10-phenanthroline via T2R5 signal transduction in differentiated human enteroendocrine L cells. - Highlights: • Taste receptor type 2 member 5 (T2R5) is colocalized with GLP-1 hormone in human enteroendocrine cells. • GLP-1 secretion is stimulated by 1,10-phenanthroline via stimulation of T2R5. • Inhibition of the bitter taste pathway reduce GLP-1 secretion.
International Nuclear Information System (INIS)
Park, Jiyoung; Kim, Ki-Suk; Kim, Kang-Hoon; Lee, In-Seung; Jeong, Hyeon-soo; Kim, Yumi; Jang, Hyeung-Jin
2015-01-01
Glucagon-like peptide-1 (GLP-1) hormone is known to regulate blood glucose by an insulinotropic effect and increases proliferation as and also prevents apoptosis of pancreatic β cells. We know that GLP-1 is secreted by nutrients such as fatty acids and sweet compounds but also bitter compounds via stimulation of G-protein coupled receptors (GPCRs) in the gut. Among these, bitter compounds are multiply-contained in phytochemicals or artificial materials and perceived as ligands of various bitter taste receptors. We hypothesized that GLP-1 hormone is secreted through stimulation of a single bitter taste receptor by 1,10-phenanthroline which is known agonist of taste receptor type 2 member 5 (T2R5). To prove this hypothesis, we used the representatively well-known 1,10-phenanthroline as ligand of single receptor and evaluated the existence of T2R5 by double-labeling immunofluorescence and then 1,10-phenanthroline is able to secrete GLP-1 hormone through stimulation of T2R5 in human enteroendocrine cells. Consequently, we verify that GLP-1 hormone is colocalized with T2R5 in the human duodenum and ileum tissue and is secreted by 1,10-phenanthroline via T2R5 signal transduction in differentiated human enteroendocrine L cells. - Highlights: • Taste receptor type 2 member 5 (T2R5) is colocalized with GLP-1 hormone in human enteroendocrine cells. • GLP-1 secretion is stimulated by 1,10-phenanthroline via stimulation of T2R5. • Inhibition of the bitter taste pathway reduce GLP-1 secretion.
Radiation Damage in CaF{sub 2}2 and BaF{sub 2} Investigated by the Channeling Technique
Energy Technology Data Exchange (ETDEWEB)
Hellborg, R; Skog, G
1973-04-15
The radiation damage in single crystals of CaF{sub 2} and BaF{sub 2} due to room temperature bombardment with 2.0 MeV helium ions has been studied by the channeling technique. Back scattering spectra for the <111> and <110> axial directions were taken after different doses of random irradiation. A slight in crease of the aligned yield with radiation dose has been found for both crystals at doses below 1017 ions/cm2. For CaF{sub 2} at a dose of about 1.4x1017 ions/cm2 a steep increase is found, after which the aligned yield saturates at a high value. Analyses of spectra measured along different aligned directions indicate that the structures of defects in CaF{sub 2} and BaF{sub 2} differ
Plasma scattering measurement using a submillimeter wave gyrotron as a radiation source
International Nuclear Information System (INIS)
Ogawa, I.; Idehara, T.; Itakura, Y.; Myodo, M.; Hori, T.; Hatae, T.
2004-01-01
Plasma scattering measurement is an effective technique to observe low frequency density fluctuations excited in plasma. The spatial and wave number resolutions and the S/N ratio of measurement depend on the wavelength range, the size and the intensity of a probe beam. A well-collimated, submillimeter wave beam is suitable for improving the spatial and wave number resolutions. Application of high frequency gyrotron is effective in improving the S/N ratio of the measurement because of its capacity to deliver high power. Unlike the molecular vapor lasers, the gyrotrons generate diverging beam of radiation with TE mn mode structure. It is therefore necessary to convert the output radiation into a Gaussian beam. A quasi-optical antenna is a suitable element for the conversion system under consideration since it is applicable to several TE 0n and TE 1n modes. In order to apply the gyrotron to plasma scattering measurement, we have stabilized the output (P = 110 W, f = 354 GHz) of gyrotron up to the level (ΔP/P < 1 %, Δf< 10 kHz). The gyrotron output can be stabilized by decreasing the fluctuation of the cathode potential. (authors)
Kalinovskaya, I. V.; Zadorozhnaya, A. N.
2018-04-01
Influence of cinnamic acid on the luminescent properties of the europium(III) nitrate with 1,10-phenantroline in a polymer materials was studied. It was shown that combined use of these rare earth complexes leads to intense luminescence in the 400-700 nm region. Samples containing polymer europium nitrate with 1,10-phenantroline and cinnamic acid at a molar ratio of 1:2,0 had the maximum luminescence intensity and photostability.
Energy Technology Data Exchange (ETDEWEB)
Gao, Jinling, E-mail: Jinling_Gao@yeah.net; Yao, Wenjuan, E-mail: wj_yao@yeah.net; Ma, Yudong
2016-08-15
Graphical abstract: An analytical model and a numerical procedure are developed to study the mechanical response of IG-110 graphite bricks in HTGR subjected to high temperature and irradiation. The calculation results show great accordance with each other. Rational suggestions on the calculation and design of the IG-110 graphite structure are proposed based on the sensitivity analyses including temperature, irradiation dimensional change, creep and Poisson’s ratio. - Highlights: • Analytical solution of stress and displacement of IG-110 graphite components in HTGR. • Finite element procedure developed for stress analysis of HTGR graphite component. • Parameters analysis of mechanical response of graphite components during the whole life of the reflector. - Abstract: Structural design of nuclear power plant project is an important sub-discipline of civil engineering. Especially after appearance of the fourth generation advanced high temperature gas cooled reactor, structural mechanics in reactor technology becomes a popular subject in structural engineering. As basic ingredients of reflector in reactor, graphite bricks are subjected to high temperature and irradiation and the stress field of graphite structures determines integrity of reflector and makes a great difference to safety of whole structure. In this paper, based on assumptions of elasticity, side reflector is regarded approximately as a straight cylinder structure and primary creep strain is ignored. An analytical study on stress of IG110 graphite parts is present. Meanwhile, a finite element procedure for calculating stresses in the IG110 graphite structure exposed in the high temperature and irradiation is developed. Subsequently, numerical solution of stress in IG110 graphite structure is obtained. Analytical solution agrees well with numerical solution, which indicates that analytical derivation is accurate. Finally, influence of temperature, irradiation dimensional change, creep and Poisson’s
Waste compatibility safety issues and final results for tank 241-T-110 push mode samples
International Nuclear Information System (INIS)
Nuzum, J.L.
1997-01-01
This document is the final laboratory report for Tank 241-T-110. Push mode core segments were removed from risers 2 and 6 between January 29, 1997, and February 7, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-110 Push Mode Core Sampling and analysis Plan (TSAP) and Safety Screening Data Quality Objective (DQO). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO
Directory of Open Access Journals (Sweden)
Laura Aragoneses-Fenoll
2018-02-01
Full Text Available Class IA phosphatidylinositol 3-kinase (PI3K catalytic subunits p110α and p110δ are targets in cancer therapy expressed at high levels in T lymphocytes. The role of p110δ PI3K in normal or pathological immune responses is well established, yet the importance of p110α subunits in T cell-dependent immune responses is not clear. To address this problem, mice with p110α conditionally deleted in CD4+ and CD8+ T lymphocytes (p110α−/−ΔT were used. p110α−/−ΔT mice show normal development of T cell subsets, but slightly reduced numbers of CD4+ T cells in the spleen. “In vitro,” TCR/CD3 plus CD28 activation of naive CD4+ and CD8+ p110α−/−ΔT T cells showed enhanced effector function, particularly IFN-γ secretion, T-bet induction, and Akt, Erk, or P38 activation. Tfh derived from p110α−/−ΔT cells also have enhanced responses when compared to normal mice, and IL-2 expanded p110α−/−ΔT CD8+ T cells had enhanced levels of LAMP-1 and Granzyme B. By contrast, the expansion of p110α−/−ΔT iTreg cells was diminished. Also, p110α−/−ΔT mice had enhanced anti-keyhole limpet hemocyanin (KLH IFN-γ, or IL-4 responses and IgG1 and IgG2b anti-KLH antibodies, using CFA or Alum as adjuvant, respectively. When compared to WT mice, p110α−/−ΔT mice inoculated with B16.F10 melanoma showed delayed tumor progression. The percentage of CD8+ T lymphocytes was higher and the percentage of Treg cells lower in the spleen of tumor-bearing p110α−/−ΔT mice. Also, IFN-γ production in tumor antigen-activated spleen cells was enhanced. Thus, PI3K p110α plays a significant role in antigen activation and differentiation of CD4+ and CD8+ T lymphocytes modulating antitumor immunity.
21 CFR 110.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 110.5 Section...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD General Provisions § 110.5 Current good manufacturing practice. (a) The criteria and...
40 CFR 211.110-2 - National security exemptions.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false National security exemptions. 211.110... ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110-2 National security exemptions. (a) A new product which is produced to conform with specifications developed by national security agency...
40 CFR 405.110 - Applicability; description of the condensed whey subcategory.
2010-07-01
... condensed whey subcategory. 405.110 Section 405.110 Protection of Environment ENVIRONMENTAL PROTECTION... Condensed Whey Subcategory § 405.110 Applicability; description of the condensed whey subcategory. The... whey and condensed acid whey. ...
12 CFR 516.110 - Who may submit a written comment?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who may submit a written comment? 516.110 Section 516.110 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY APPLICATION PROCESSING PROCEDURES Comment Procedures § 516.110 Who may submit a written comment? Any person may submit a...
10 CFR 5.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Remedial and affirmative action and self-evaluation. 5.110 Section 5.110 Energy NUCLEAR REGULATORY COMMISSION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... action and self-evaluation. (a) Remedial action. If the designated agency official finds that a recipient...
Triaqua(1,10-phenanthroline-2,9-dicarboxylatocobalt(II dihydrate
Directory of Open Access Journals (Sweden)
Zi-Fa Shi
2010-04-01
Full Text Available The title compound, [Co(C14H6N2O4(H2O3]·2H2O, has twofold crystallographic symmetry. The CoII atom is in a distorted pentagonal-bipyramidal coordination environment with two N atoms and two O atoms from a tetradentate 1,10-phenanthroline-2,9-dicarboxylate ligand and one O atom from a water molecule forming the pentagonal plane, and two O atoms from two water molecules occupying axial positions. In the crystal, adjacent molecules are linked by O—H...O hydrogen bonds, forming a three-dimensional network.
Uptake and excretion of 110mAg by Mud carp Cirrhina molitorella
International Nuclear Information System (INIS)
Chen Shunhua; Zhong Chuangguang
2004-01-01
Accumulation, excretion and tissue distribution of 110m Ag from both labeled food and water pathways in juvenile mud carp Cirrhina molitorella were investigated. Results indicated that the excretion rate of 110m Ag uptaken from artificial food pathway was very fast. 24 hours after feeding, the radioactivity of the fish decreased rapidly to 2.62% of the initial one and maintained the similar level afterwards in the 7 days excretion experiment. On the 7th day of excretion, the fish were dissected to separate the organs and tissues. The distribution of 110m Ag in the fish was uneven. Radioactivity of 110m Ag in the organs and tissues was in the order as liver>intestine>gall bladder>eye>gill>remainder>muscle. The radioactivity in liver, intestine and gall bladder were 48.14%, 18/43% and 15.43% of the total radioactivity of the fish, respectively. The accumulation of waterborne 110m Ag by mud carp showed that 110m Ag was easy to be uptaken by the fish. the concentration factors at 8th hour and 13th day were 23.8 and 208.6 respectively. Excretion of 110m Ag uptaken from water pathway was slower than that from food pathway. The radioactivity decreased to 20.1% and 16.7% on 15th and 28th day, respectively. The excretion procedure was composed of fast excretion phase (0-2d) and slow excretion phase (2-28d). The half-life of 110m Ag in mud carp in the slow excretion phase was 22d during the slow excretion phase. The distribution of 110m Ag in organs and tissues was mainly in viscera, which accounted for about 80% of the total radioactivity of the fish
Energy Technology Data Exchange (ETDEWEB)
Rounaghi, Gholamhossein, E-mail: ghrounagh@yahoo.com [Department of Chemistry, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of); Zadeh Kakhki, Roya Mohammad; Sadeghian, Hamid [Department of Chemistry, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad (Iran, Islamic Republic of)
2011-11-30
Highlights: > An ISE based on a new ionophore is used successfully to determine cerium (III) cation over the concentration range 1.0 x 10{sup -1}-2.1 x 10{sup -9} mol l{sup -1}. > It has a fast response time of 10 s. > It has comparatively good selectivities with respect to metal cations. > It can be used in a pH range of 5.0-8.0. > It also was used as an indicator electrode in potentiometric determination of F{sup -} ion in some real sample preparations. - Abstract: In the present study, a novel electrode based on 2,9-dihydroxy-1,10-diphenoxy-4,7-dithiadecane (DHDPDTD) that is selective to cerium (III) cations was evaluated electrochemically, and a Nerenstian slope (19.3 {+-} 1 mV decade{sup -1}) over a concentration range of 1.0 x 10{sup -8}-1.0 x 10{sup -1} M and a detection limit of 2.1 x 10{sup -9} M were observed. The proposed electrochemical sensor displayed a rapid response time of 10 s, improved selectivity towards Ce (III) cations in the presence of alkali, alkaline earth, transition and heavy metal cations, and could be used in a pH range of 5.0-8.0. Additionally, the proposed sensor was used as an indicator in the potentiometric titration of fluoride and the determination of F{sup -} ions in real samples.
29 CFR 36.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Remedial and affirmative action and self-evaluation. 36.110 Section 36.110 Labor Office of the Secretary of Labor NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... affirmative action and self-evaluation. (a) Remedial action. If the designated agency official finds that a...
34 CFR 110.1 - What is the purpose of ED's age discrimination regulations?
2010-07-01
... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 110.1 What is the purpose of ED's age discrimination regulations? The purpose of these regulations is to set out ED's rules for implementing the Age... 34 Education 1 2010-07-01 2010-07-01 false What is the purpose of ED's age discrimination...
Catalytic hydrolysis of COS over CeO_2 (110) surface: A density functional theory study
International Nuclear Information System (INIS)
Song, Xin; Ning, Ping; Wang, Chi; Li, Kai; Tang, Lihong; Sun, Xin
2017-01-01
Graphical abstract: CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. H_2O plays a role as a bridge in the process of joint adsorption. Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Highlights: • H_2O is easier adsorbed on the CeO_2 (110) surface than COS. • When COS and H_2O jointly adsorb on the CeO_2 (110) surface, the H_2O molecule plays a role as a bridge. • Ce−O−H bond can enhance the adsorption effect. • Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Abstract: Density functional theory (DFT) calculations were performed to investigate the reaction pathways for catalytic hydrolysis of COS over CeO_2 (110) surface using Dmol"3 model. The thermodynamic stability analysis for the suggested routes of COS hydrolysis to CO_2 and H_2S was evaluated. The absolute values of adsorption energy of H_2O-CeO_2 are higher than that of COS-CeO_2. Meanwhile, the adsorption energy and geometries show that H_2O is easier adsorbed on the surface of CeO_2 (110) than COS. H_2O plays a role as a bridge in the process of joint adsorption. H_2O forms more Ce−O−H groups on the CeO_2 (110) surface. CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. The migration of H from H_2O to COS is the key for the hydrolysis reaction. C−O channel is easier to occur than C−S channel. Experimental result shows that adding of CeO_2 can increase COS removal rate and prolong the 100% COS removal rate from 180 min to 210 min. The difference between Fe_2O_3 and CeO_2 for the hydrolysis of COS is characterized in the atomic charge transfer and the formation of H−O bond and H−S bond. The transfer effect of H in H_2O to S in COS over CeO_2 decreases the energy barriers of hydrolysis reaction, and enhances the reaction activity of COS hydrolysis.
Directory of Open Access Journals (Sweden)
Nazudin
2012-08-01
Full Text Available A unique of synthetic methods was employed to prepare 2-(4-methoxyphenyl-4-phenyl-1,10-phenanthroline (5 derivatives from 4-methoxy-benzaldehyde (1, acetophenone (2, and 8-aminoquinoline (4 with aldol condensation and cyclization reactions. The derivatives were tested through antiplasmodial test. The synthesis of derivatives compound 5 was conducted in three steps. The 3-(4-methoxyphenyl-1-phenylpropenone 3 was synthesized through aldol condensation of 1 and 2 which has a yield of 96.42%. The compound 5 was synthesized through cyclization of compound 4 and 3 with 84.55% yield. The derivative of compound 5 was synthesized from compound 5 using DMS and DES reagents which refluxed for 21 and 22 h, to produce (1-N-methyl-9-(4-methoxyphenyl-7-phenyl-1,10-phenanthrolinium sulfate (6 and (1-N-ethyl-9-(4-methoxyphenyl-7-phenyl-1,10-phenanthrolinium sulfate (7 with 91.42 and 86.36% yields, respectively. Results of in vitro testing of antiplasmodial activity of compound 5 derivatives (i.e., compound 6 and 7 against chloroquine-resistant P. falciparum FCR3 strain showed that compound 7 had higher antimalarial activity than compounds 5 and 6. Whereas, results of in vitro testing against chloroquine-sensitive P. falciparum D10 strain showed that compound 6 has higher antimalarial activity than compounds 5 and 7.
MODELING SUPERSONIC-JET DEFLECTION IN THE HERBIG–HARO 110-270 SYSTEM WITH HIGH-POWER LASERS
International Nuclear Information System (INIS)
Yuan, Dawei; Li, Yutong; Lu, Xin; Yin, Chuanlei; Su, Luning; Liao, Guoqian; Zhang, Jie; Wu, Junfeng; Wang, Lifeng; He, Xiantu; Zhong, Jiayong; Wei, Huigang; Zhang, Kai; Han, Bo; Zhao, Gang; Jiang, Shaoen; Du, Kai; Ding, Yongkun; Zhu, Jianqiang
2015-01-01
Herbig–Haro (HH) objects associated with newly born stars are typically characterized by two high Mach number jets ejected in opposite directions. However, HH 110 appears to only have a single jet instead of two. Recently, Kajdi et al. measured the proper motions of knots in the whole system and noted that HH 110 is a continuation of the nearby HH 270. It has been proved that the HH 270 collides with the surrounding mediums and is deflected by 58°, reshaping itself as HH 110. Although the scales of the astrophysical objects are very different from the plasmas created in the laboratory, similarity criteria of physical processes allow us to simulate the jet deflection in the HH 110/270 system in the laboratory with high power lasers. A controllable and repeatable laboratory experiment could give us insight into the deflection behavior. Here we show a well downscaled experiment in which a laser-produced supersonic-jet is deflected by 55° when colliding with a nearby orthogonal side-flow. We also present a two-dimensional hydrodynamic simulation with the Euler program, LARED-S, to reproduce the deflection. Both are in good agreement. Our results show that the large deflection angle formed in the HH 110/270 system is probably due to the ram pressure from a flow–flow collision model
International Nuclear Information System (INIS)
Alves, Laís Nascimento
2017-01-01
With the rising incidence of cancer and this disease as global public health dilemma, there is an alarming need of studying new cancer therapies. To achieve the development of efficient agents is essential to understand the fundamental mechanisms of carcinogenesis and tumor progression. Overexpression of proteins in malignant tissues, in contrast to expression of the proteins found in normal tissues of the same organ, is crucially important and of great interest for the characterization of potential tumor biomarkers. Following this premise, MUC1 glycoprotein was selected as a therapeutic target in a breast cancer model. In order to determine the viability of the aptA aptamer as radiosensitizers carrier, the toxic compound 1,10 phenanthroline, complexed with Fe(II) was intercalated in the aptamers. The dissociation constant was found at a value of Kd = 30 μM. The selective binding and internalization of the compound was demonstrated. Based on these data, the aptA can be used as carrying vector of molecules such as 1,10-phenanthroline. As a next stage, the evaluation of its in vitro potential as radiosensitizers with the use of ionizing radiation will be done. (author)
27 CFR 24.110 - Organizational documents.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Organizational documents..., DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Application § 24.110 Organizational... under control number 1512-0058) [T.D. ATF-299, 55 FR 24989, June 19, 1990, as amended by T.D. ATF-409...
48 CFR 49.110 - Settlement negotiation memorandum.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Settlement negotiation... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.110 Settlement negotiation memorandum. (a) The TCO shall, at the conclusion of negotiations, prepare a settlement negotiation memorandum...
Tank 241-BY-110 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-110 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-110 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-110 using the vapor sampling system (VSS) on November 11, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 27 C. Air from the Tank BY-110 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 12B, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
International Nuclear Information System (INIS)
Song Fei; Mao Hongying; Guan Dandan; Dou Weidong; Zhang Hanjie; Li Haiyang; He Pimo; Bao Shining; Hofmann, Philip
2009-01-01
The interface electronic properties of fluorene-1-carboxylic acid (FC-1) adsorbed on Cu(110) have been studied by ultraviolet photoemission spectroscopy (UPS) and first-principles calculations. Both the molecular orbitals and the Cu valence band are significantly modified upon adsorption. FC-1 is chemically bonded to Cu(110) through charge donation and back donation involving the lowest unoccupied molecular orbital (LUMO) and the highest occupied molecular orbital (HOMO) of the molecule. An observed reduction of the work function can be attributed to the adsorption induced charge redistribution, and the positive interface dipole.
Oxygen adsorption on Pt(110)-(1x2): new high-coverage structures
DEFF Research Database (Denmark)
Helveg, Stig; Lorensen, Henrik Qvist; Horch, Sebastian
1999-01-01
From an interplay between scanning tunneling microscopy (STM) experiments and density functional theory (DFT) calculations, a comprehensive picture is obtained for oxygen adsorption on the Pt(110)-(1 x 2) surface, from single isolated oxygen atoms chemisorbed in FCC sites along the platinum ridges...... adsorption and platinum lattice distortions. (C) 1999 Elsevier Science B.V. All rights reserved....
International Nuclear Information System (INIS)
Terada, H.; Malinowski, J.; Blick, H.
1981-09-01
The performance of the computer programs (Spectran F and Spectran-III) in resolving the 137 Cs-sup(110m)Ag double peak at 661.6-657.7 keV in the gamma-ray spectrum was investigated. In the experiments, the intensity ratios of both lines in the double peak were varied from 0.1 to 60. The results obtained show, that both programs have almost the same performance in resolving the double peak investigated, with slight superiority of Spectran-F. If accuracy better than 5% is desired, the peak intensity ratio in the dublet must be kept below 10. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mu, Rende, E-mail: dallasbiam@163.com [Beijing Institute of Aeronautical Materials, Aviation Key Laboratory of Science and Technology on Advanced Corrosion and Protection for Aviation Material, Department 5, P.O. Box 81-5, Beijing 100095 (China); Tan, Chengwen; Yu, Xiaodong [School of Material Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China)
2016-05-05
Tungsten single crystal and poly crystal were treated by electrolytic etching in a 3% by weight solution of NaOH in distilled water. The method for determining the proportion of {110} planes and characteristic morphology on the coating surface after electrolytic etching were investigated using EBSD and auto-focusing microscope. Then the optimization of process parameters for electrolytic etching is achieved. In order to compare the effect of process parameters, three process parameters were selected for the tungsten single crystal electrolytic etching. Through analyzing the change of {110} planes' proportion, we found that when the coatings are etched with 1.4 amp/cm{sup 2} and 3 min, {110} planes can be exposed in the greatest degree that can reach 61.4% on tubular surfaces. The proposed approach greatly improves the proportion of {110} planes relative to the original surface. - Highlights: • Tungsten single/poly crystals treated by electrolytic etching in solution of NaOH. • The {110} planes have the lower surface free energy than {112}. • Some {112} planes etched firstly, the {110} planes exposed at last during etching. • {110} planes exposed to the greatest extent with 1.4 amp/cm{sup 2} and 3 min.
Transfer of radiosilver (Ag-110m) in the food chain
International Nuclear Information System (INIS)
Handl, J.
1993-01-01
Following the Chernobyl accident, Ag-110m (Half-life: 250 days) has been reported in some important components of the terrestrial environment such as pasture vegetation and pasture animals. A review of the available literature showed that the behaviour of silver in the terrestrial environment is relatively poorly understood. A research programme to study the behaviour of Ag-110m along the soil - vegetation - animal - man pathway was therefore initiated. In an in-vivo study in cooperation with the Institute of Animal Husbandry and Animal Behaviour, Mariensee with pigs the transfer of Ag-110m from feed to animal tissues was followed for 30 days using Ag-110m labelled meat as feed. The observation has not yet been finished. After the evaluation of all measurements, transfer factors animal tissue/feed as well as the biological half-life for Ag-110m in animal organs will be determined. (orig./BBR)
International Nuclear Information System (INIS)
Pal'chikov, V.G.; Ya Faenov, A.; Yu Skobelev, I.
2002-01-01
The wavelengths of the 1snp 1 P 1 0 -1s 2 1 S 0 transitions in the He-like Mg XI (n = 4-9) and F VIII (n=4-8) have been measured in laser-produced plasmas. The accuracy of the present measurements (0.4-1.6 mA) is a large improvement over previous results. The Rydberg series is used to determine the ground-state ionization energy of F VIII and Mg XI: E i on (F VIII) 953.96±0.11 eV, E i on (Mg XI)=1761.88±0.15 eV. These experimental results are compared with theoretical data calculated by the 1/Z-expansion method and the HFR and MCDF approaches. Fairly good agreement between theory and experiment is observed with a precision up to 5x10 -5 . Radiative corrections to the 1s 2 1 S 0 state are analysed and compared with experiments. It is found that QED corrections to the ground-state ionization energy are significant at the present level of experimental accuracy. (author)
Aad, G.; Abdallah, J.; Abdelalim, A.A.; Abdesselam, A.; Abdinov, O.; Abi, B.; Abolins, M.; Abramowicz, H.; Abreu, H.; Acerbi, E.; Acharya, B.S.; Ackers, M.; Adams, D.L.; Addy, T.N.; Adelman, J.; Aderholz, M.; Adomeit, S.; Adorisio, C.; Adragna, P.; Adye, T.; Aefsky, S.; Aguilar-Saavedra, J.A.; Aharrouche, M.; Ahlen, S.P.; Ahles, F.; Ahmad, A.; Ahmed, H.; Ahsan, M.; Aielli, G.; Akdogan, T.; Akesson, T.P.A.; Akimoto, G.; Akimov, A.V.; Aktas, A.; Alam, M.S.; Alam, M.A.; Albrand, S.; Aleksa, M.; Aleksandrov, I.N.; Aleppo, M.; Alessandria, F.; Alexa, C.; Alexander, G.; Alexandre, G.; Alexopoulos, T.; Alhroob, M.; Aliev, M.; Alimonti, G.; Alison, J.; Aliyev, M.; Allport, P.P.; Allwood-Spiers, S.E.; Almond, J.; Aloisio, A.; Alon, R.; Alonso, A.; Alonso, J.; Alviggi, M.G.; Amako, K.; Amaral, P.; Ambrosio, G.; Amelung, C.; Ammosov, V.V.; Amorim, A.; Amoros, G.; Amram, N.; Anastopoulos, C.; Andeen, T.; Anders, C.F.; Anderson, K.J.; Andreazza, A.; Andrei, V.; Andrieux, M-L.; Anduaga, X.S.; Angerami, A.; Anghinolfi, F.; Anjos, N.; Annovi, A.; Antonaki, A.; Antonelli, M.; Antonelli, S.; Antos, J.; Antunovic, B.; Anulli, F.; Aoun, S.; Apolle, R.; Arabidze, G.; Aracena, I.; Arai, Y.; Arce, A.T.H.; Archambault, J.P.; Arfaoui, S.; Arguin, J-F.; Argyropoulos, T.; Arik, E.; Arik, M.; Armbruster, A.J.; Arms, K.E.; Armstrong, S.R.; Arnaez, O.; Arnault, C.; Artamonov, A.; Arutinov, D.; Asai, M.; Asai, S.; Asfandiyarov, R.; Ask, S.; Asman, B.; Asner, D.; Asquith, L.; Assamagan, K.; Astbury, A.; Astvatsatourov, A.; Atoian, G.; Aubert, B.; Auerbach, B.; Auge, E.; Augsten, K.; Aurousseau, M.; Austin, N.; Avolio, G.; Avramidou, R.; Axen, D.; Ay, C.; Azuelos, G.; Azuma, Y.; Baak, M.A.; Baccaglioni, G.; Bacci, C.; Bach, A.M.; Bachacou, H.; Bachas, K.; Bachy, G.; Backes, M.; Badescu, E.; Bagnaia, P.; Bai, Y.; Bailey, D.C.; Bain, T.; Baines, J.T.; Baker, O.K.; Baker, M.D.; Baker, S; Baltasar Dos Santos Pedrosa, F.; Banas, E.; Banerjee, P.; Banerjee, Sw.; Banfi, D.; Bangert, A.; Bansal, V.; Baranov, S.P.; Baranov, S.; Barashkou, A.; Barbaro Galtieri, A.; Barber, T.; Barberio, E.L.; Barberis, D.; Barbero, M.; Bardin, D.Y.; Barillari, T.; Barisonzi, M.; Barklow, T.; Barlow, N.; Barnett, B.M.; Barnett, R.M.; Baroncelli, A.; Barone, M.; Barr, A.J.; Barreiro, F.; Barreiro Guimaraes da Costa, J.; Barrillon, P.; Bartoldus, R.; Bartsch, D.; Bates, R.L.; Batkova, L.; Batley, J.R.; Battaglia, A.; Battistin, M.; Battistoni, G.; Bauer, F.; Bawa, H.S.; Bazalova, M.; Beare, B.; Beau, T.; Beauchemin, P.H.; Beccherle, R.; Bechtle, P.; Beck, G.A.; Beck, H.P.; Beckingham, M.; Becks, K.H.; Beddall, A.J.; Beddall, A.; Bednyakov, V.A.; Bee, C.; Begel, M.; Behar Harpaz, S.; Behera, P.K.; Beimforde, M.; Belanger-Champagne, C.; Belhorma, B.; Bell, P.J.; Bell, W.H.; Bella, G.; Bellagamba, L.; Bellina, F.; Bellomo, G.; Bellomo, M.; Belloni, A.; Belotskiy, K.; Beltramello, O.; Ben Ami, S.; Benary, O.; Benchekroun, D.; Benchouk, C.; Bendel, M.; Benedict, B.H.; Benekos, N.; Benhammou, Y.; Benincasa, G.P.; Benjamin, D.P.; Benoit, M.; Bensinger, J.R.; Benslama, K.; Bentvelsen, S.; Beretta, M.; Berge, D.; Bergeaas Kuutmann, E.; Berger, N.; Berghaus, F.; Berglund, E.; Beringer, J.; Bernardet, K.; Bernat, P.; Bernhard, R.; Bernius, C.; Berry, T.; Bertin, A.; Bertinelli, F.; Bertolucci, F.; Besana, M.I.; Besson, N.; Bethke, S.; Bhimji, W.; Bianchi, R.M.; Bianco, M.; Biebel, O.; Biesiada, J.; Biglietti, M.; Bilokon, H.; Binder, M.; Bindi, M.; Binet, S.; Bingul, A.; Bini, C.; Biscarat, C.; Bischof, R.; Bitenc, U.; Black, K.M.; Blair, R.E.; Blanchard, J-B; Blanchot, G.; Blocker, C.; Blocki, J.; Blondel, A.; Blum, W.; Blumenschein, U.; Boaretto, C.; Bobbink, G.J.; Bobrovnikov, V.B.; Bocci, A.; Bocian, D.; Bock, R.; Boddy, C.R.; Boehler, M.; Boek, J.; Boelaert, N.; Boser, S.; Bogaerts, J.A.; Bogdanchikov, A.; Bogouch, A.; Bohm, C.; Bohm, J.; Boisvert, V.; Bold, T.; Boldea, V.; Bondarenko, V.G.; Bondioli, M.; Boonekamp, M.; Boorman, G.; Booth, C.N.; Booth, P.; Booth, J.R.A.; Bordoni, S.; Borer, C.; Borisov, A.; Borissov, G.; Borjanovic, I.; Borroni, S.; Bos, K.; Boscherini, D.; Bosman, M.; Boterenbrood, H.; Botterill, D.; Bouchami, J.; Boudreau, J.; Bouhova-Thacker, E.V.; Boulahouache, C.; Bourdarios, C.; Boveia, A.; Boyd, J.; Boyko, I.R.; Bozhko, N.I.; Bozovic-Jelisavcic, I.; Braccini, S.; Bracinik, J.; Braem, A.; Brambilla, E.; Branchini, P.; Brandenburg, G.W.; Brandt, A.; Brandt, G.; Brandt, O.; Bratzler, U.; Brau, B.; Brau, J.E.; Braun, H.M.; Brelier, B.; Bremer, J.; Brenner, R.; Bressler, S.; Breton, D.; Brett, N.D.; Bright-Thomas, P.G.; Britton, D.; Brochu, F.M.; Brock, I.; Brock, R.; Brodbeck, T.J.; Brodet, E.; Broggi, F.; Bromberg, C.; Brooijmans, G.; Brooks, W.K.; Brown, G.; Brubaker, E.; Bruckman de Renstrom, P.A.; Bruncko, D.; Bruneliere, R.; Brunet, S.; Bruni, A.; Bruni, G.; Bruschi, M.; Buanes, T.; Bucci, F.; Buchanan, J.; Buchanan, N.J.; Buchholz, P.; Buckingham, R.M.; Buckley, A.G.; Budagov, I.A.; Budick, B.; Buscher, V.; Bugge, L.; Buira-Clark, D.; Buis, E.J.; Bulekov, O.; Bunse, M.; Buran, T.; Burckhart, H.; Burdin, S.; Burgess, T.; Burke, S.; Busato, E.; Bussey, P.; Buszello, C.P.; Butin, F.; Butler, B.; Butler, J.M.; Buttar, C.M.; Butterworth, J.M.; Byatt, T.; Caballero, J.; Cabrera Urban, S.; Caccia, M.; Caforio, D.; Cakir, O.; Calafiura, P.; Calderini, G.; Calfayan, P.; Calkins, R.; Caloba, L.P.; Caloi, R.; Calvet, D.; Calvet, S.; Camard, A.; Camarri, P.; Cambiaghi, M.; Cameron, D.; Cammin, J.; Campana, S.; Campanelli, M.; Canale, V.; Canelli, F.; Canepa, A.; Cantero, J.; Capasso, L.; Capeans Garrido, M.D.M.; Caprini, I.; Caprini, M.; Caprio, M.; Capriotti, D.; Capua, M.; Caputo, R.; Caramarcu, C.; Cardarelli, R.; Carli, T.; Carlino, G.; Carminati, L.; Caron, B.; Caron, S.; Carpentieri, C.; Carrillo Montoya, G.D.; Carron Montero, S.; Carter, A.A.; Carter, J.R.; Carvalho, J.; Casadei, D.; Casado, M.P.; Cascella, M.; Caso, C.; Castaneda Hernandez, A.M.; Castaneda-Miranda, E.; Castillo Gimenez, V.; Castro, N.F.; Cataldi, G.; Cataneo, F.; Catinaccio, A.; Catmore, J.R.; Cattai, A.; Cattani, G.; Caughron, S.; Cauz, D.; Cavallari, A.; Cavalleri, P.; Cavalli, D.; Cavalli-Sforza, M.; Cavasinni, V.; Cazzato, A.; Ceradini, F.; Cerna, C.; Cerqueira, A.S.; Cerri, A.; Cerrito, L.; Cerutti, F.; Cervetto, M.; Cetin, S.A.; Cevenini, F.; Chafaq, A.; Chakraborty, D.; Chan, K.; Chapman, J.D.; Chapman, J.W.; Chareyre, E.; Charlton, D.G.; Chavda, V.; Cheatham, S.; Chekanov, S.; Chekulaev, S.V.; Chelkov, G.A.; Chen, H.; Chen, L.; Chen, S.; Chen, T.; Chen, X.; Cheng, S.; Cheplakov, A.; Chepurnov, V.F.; Cherkaoui El Moursli, R.; Tcherniatine, V.; Chesneanu, D.; Cheu, E.; Cheung, S.L.; Chevalier, L.; Chevallier, F.; Chiarella, V.; Chiefari, G.; Chikovani, L.; Childers, J.T.; Chilingarov, A.; Chiodini, G.; Chizhov, M.V.; Choudalakis, G.; Chouridou, S.; Christidi, I.A.; Christov, A.; Chromek-Burckhart, D.; Chu, M.L.; Chudoba, J.; Ciapetti, G.; Ciftci, A.K.; Ciftci, R.; Cinca, D.; Cindro, V.; Ciobotaru, M.D.; Ciocca, C.; Ciocio, A.; Cirilli, M.; Citterio, M.; Clark, A.; Clark, P.J.; Cleland, W.; Clemens, J.C.; Clement, B.; Clement, C.; Clifft, R.W.; Coadou, Y.; Cobal, M.; Coccaro, A.; Cochran, J.; Coe, P.; Coelli, S.; Coggeshall, J.; Cogneras, E.; Cojocaru, C.D.; Colas, J.; Cole, B.; Colijn, A.P.; Collard, C.; Collins, N.J.; Collins-Tooth, C.; Collot, J.; Colon, G.; Coluccia, R.; Comune, G.; Conde Muino, P.; Coniavitis, E.; Conidi, M.C.; Consonni, M.; Constantinescu, S.; Conta, C.; Conventi, F.; Cook, J.; Cooke, M.; Cooper, B.D.; Cooper-Sarkar, A.M.; Cooper-Smith, N.J.; Copic, K.; Cornelissen, T.; Corradi, M.; Correard, S.; Corriveau, F.; Corso-Radu, A.; Cortes-Gonzalez, A.; Cortiana, G.; Costa, G.; Costa, M.J.; Costanzo, D.; Costin, T.; Cote, D.; Coura Torres, R.; Courneyea, L.; Cowan, G.; Cowden, C.; Cox, B.E.; Cranmer, K.; Cranshaw, J.; Cristinziani, M.; Crosetti, G.; Crupi, R.; Crepe-Renaudin, S.; Cuenca Almenar, C.; Cuhadar Donszelmann, T.; Cuneo, S.; Curatolo, M.; Curtis, C.J.; Cwetanski, P.; Czirr, H.; Czyczula, Z.; D'Auria, S.; D'Onofrio, M.; D'Orazio, A.; Da Rocha Gesualdi Mello, A.; Da Silva, P.V.M.; Da Via, C; Dabrowski, W.; Dahlhoff, A.; Dai, T.; Dallapiccola, C.; Dallison, S.J.; Daly, C.H.; Dam, M.; Dameri, M.; Damiani, D.S.; Danielsson, H.O.; Dankers, R.; Dannheim, D.; Dao, V.; Darbo, G.; Darlea, G.L.; Daum, C.; Dauvergne, J.P.; Davey, W.; Davidek, T.; Davidson, N.; Davidson, R.; Davies, M.; Davison, A.R.; Dawe, E.; Dawson, I.; Dawson, J.W.; Daya, R.K.; De, K.; de Asmundis, R.; De Castro, S.; De Castro Faria Salgado, P.E.; De Cecco, S.; de Graat, J.; De Groot, N.; de Jong, P.; De La Cruz-Burelo, E.; De La Taille, C.; De Lotto, B.; De Mora, L.; De Nooij, L.; De Oliveira Branco, M.; De Pedis, D.; de Saintignon, P.; De Salvo, A.; De Sanctis, U.; De Santo, A.; De Vivie De Regie, J.B.; De Zorzi, G.; Dean, S.; Dedes, G.; Dedovich, D.V.; Defay, P.O.; Degenhardt, J.; Dehchar, M.; Deile, M.; Del Papa, C.; Del Peso, J.; Del Prete, T.; Dell'Acqua, A.; Dell'Asta, L.; Della Pietra, M.; della Volpe, D.; Delmastro, M.; Delpierre, P.; Delruelle, N.; Delsart, P.A.; Deluca, C.; Demers, S.; Demichev, M.; Demirkoz, B.; Deng, J.; Deng, W.; Denisov, S.P.; Dennis, C.; Derkaoui, J.E.; Derue, F.; Dervan, P.; Desch, K.; Deviveiros, P.O.; Dewhurst, A.; DeWilde, B.; Dhaliwal, S.; Dhullipudi, R.; Di Ciaccio, A.; Di Ciaccio, L.; Di Domenico, A.; Di Girolamo, A.; Di Girolamo, B.; Di Luise, S.; Di Mattia, A.; Di Nardo, R.; Di Simone, A.; Di Sipio, R.; Diaz, M.A.; Diaz Gomez, M.M.; Diblen, F.; Diehl, E.B.; Dietl, H.; Dietrich, J.; Dietzsch, T.A.; Diglio, S.; Dindar Yagci, K.; Dingfelder, J.; Dionisi, C.; Dita, P.; Dita, S.; Dittus, F.; Djama, F.; Djilkibaev, R.; Djobava, T.; do Vale, M.A.B.; Do Valle Wemans, A.; Doan, T.K.O.; Dobbs, M.; Dobinson, R.; Dobos, D.; Dobson, E.; Dobson, M.; Dodd, J.; Dogan, O.B.; Doglioni, C.; Doherty, T.; Doi, Y.; Dolejsi, J.; Dolenc, I.; Dolezal, Z.; Dolgoshein, B.A.; Dohmae, T.; Donadelli, M.; Donega, M.; Donini, J.; Dopke, J.; Doria, A.; Dos Anjos, A.; Dosil, M.; Dotti, A.; Dova, M.T.; Dowell, J.D.; Doxiadis, A.; Doyle, A.T.; Drasal, Z.; Drees, J.; Dressnandt, N.; Drevermann, H.; Driouichi, C.; Dris, M.; Drohan, J.G.; Dubbert, J.; Dubbs, T.; Dube, S.; Duchovni, E.; Duckeck, G.; Dudarev, A.; Dudziak, F.; Duhrssen, M.; Duerdoth, I.P.; Duflot, L.; Dufour, M-A.; Dunford, M.; Duran Yildiz, H.; Dushkin, A.; Duxfield, R.; Dwuznik, M.; Dydak, F.; Dzahini, D.; Duren, M.; Ebenstein, W.L.; Ebke, J.; Eckert, S.; Eckweiler, S.; Edmonds, K.; Edwards, C.A.; Efthymiopoulos, I.; Egorov, K.; Ehrenfeld, W.; Ehrich, T.; Eifert, T.; Eigen, G.; Einsweiler, K.; Eisenhandler, E.; Ekelof, T.; El Kacimi, M.; Ellert, M.; Elles, S.; Ellinghaus, F.; Ellis, K.; Ellis, N.; Elmsheuser, J.; Elsing, M.; Ely, R.; Emeliyanov, D.; Engelmann, R.; Engl, A.; Epp, B.; Eppig, A.; Erdmann, J.; Ereditato, A.; Eriksson, D.; Ermoline, I.; Ernst, J.; Ernst, M.; Ernwein, J.; Errede, D.; Errede, S.; Ertel, E.; Escalier, M.; Escobar, C.; Espinal Curull, X.; Esposito, B.; Etienne, F.; Etienvre, A.I.; Etzion, E.; Evangelakou, D.; Evans, H.; Evdokimov, V.N.; Fabbri, L.; Fabre, C.; Facius, K.; Fakhrutdinov, R.M.; Falciano, S.; Falou, A.C.; Fang, Y.; Fanti, M.; Farbin, A.; Farilla, A.; Farley, J.; Farooque, T.; Farrington, S.M.; Farthouat, P.; Fasching, D.; Fassnacht, P.; Fassouliotis, D.; Fatholahzadeh, B.; Fayard, L.; Fazio, S.; Febbraro, R.; Federic, P.; Fedin, O.L.; Fedorko, I.; Fedorko, W.; Fehling-Kaschek, M.; Feligioni, L.; Felzmann, C.U.; Feng, C.; Feng, E.J.; Fenyuk, A.B.; Ferencei, J.; Ferguson, D.; Ferland, J.; Fernandes, B.; Fernando, W.; Ferrag, S.; Ferrando, J.; Ferrara, V.; Ferrari, A.; Ferrari, P.; Ferrari, R.; Ferrer, A.; Ferrer, M.L.; Ferrere, D.; Ferretti, C.; Ferretto Parodi, A.; Ferro, F.; Fiascaris, M.; Fiedler, F.; Filipcic, A.; Filippas, A.; Filthaut, F.; Fincke-Keeler, M.; Fiolhais, M.C.N.; Fiorini, L.; Firan, A.; Fischer, G.; Fischer, P.; Fisher, M.J.; Fisher, S.M.; Flammer, J.; Flechl, M.; Fleck, I.; Fleckner, J.; Fleischmann, P.; Fleischmann, S.; Flick, T.; Flores Castillo, L.R.; Flowerdew, M.J.; Fohlisch, F.; Fokitis, M.; Fonseca Martin, T.; Fopma, J.; Forbush, D.A.; Formica, A.; Forti, A.; Fortin, D.; Foster, J.M.; Fournier, D.; Foussat, A.; Fowler, A.J.; Fowler, K.; Fox, H.; Francavilla, P.; Franchino, S.; Francis, D.; Franklin, M.; Franz, S.; Fraternali, M.; Fratina, S.; Freestone, J.; French, S.T.; Froeschl, R.; Froidevaux, D.; Frost, J.A.; Fukunaga, C.; Fullana Torregrosa, E.; Fuster, J.; Gabaldon, C.; Gabizon, O.; Gadfort, T.; Gadomski, S.; Gagliardi, G.; Gagnon, P.; Galea, C.; Gallas, E.J.; Gallas, M.V.; Gallo, V.; Gallop, B.J.; Gallus, P.; Galyaev, E.; Gan, K.K.; Gao, Y.S.; Gapienko, V.A.; Gaponenko, A.; Garcia-Sciveres, M.; Garcia, C.; Garcia Navarro, J.E.; Gardner, R.W.; Garelli, N.; Garitaonandia, H.; Garonne, V.; Garvey, J.; Gatti, C.; Gaudio, G.; Gaumer, O.; Gaur, B.; Gautard, V.; Gauzzi, P.; Gavrilenko, I.L.; Gay, C.; Gaycken, G.; Gayde, J-C.; Gazis, E.N.; Ge, P.; Gee, C.N.P.; Geich-Gimbel, Ch.; Gellerstedt, K.; Gemme, C.; Genest, M.H.; Gentile, S.; Georgatos, F.; George, S.; Gerlach, P.; Gershon, A.; Geweniger, C.; Ghazlane, H.; Ghez, P.; Ghodbane, N.; Giacobbe, B.; Giagu, S.; Giakoumopoulou, V.; Giangiobbe, V.; Gianotti, F.; Gibbard, B.; Gibson, A.; Gibson, S.M.; Gieraltowski, G.F.; Gilbert, L.M.; Gilchriese, M.; Gildemeister, O.; Gilewsky, V.; Gillberg, D.; Gillman, A.R.; Gingrich, D.M.; Ginzburg, J.; Giokaris, N.; Giordani, M.P.; Giordano, R.; Giorgi, F.M.; Giovannini, P.; Giraud, P.F.; Girtler, P.; Giugni, D.; Giusti, P.; Gjelsten, B.K.; Gladilin, L.K.; Glasman, C.; Glatzer, J; Glazov, A.; Glitza, K.W.; Glonti, G.L.; Gnanvo, K.G.; Godfrey, J.; Godlewski, J.; Goebel, M.; Gopfert, T.; Goeringer, C.; Gossling, C.; Gottfert, T.; Goggi, V.; Goldfarb, S.; Goldin, D.; Golling, T.; Gollub, N.P.; Golovnia, S.N.; Gomes, A.; Gomez Fajardo, L.S.; Goncalo, R.; Gonella, L.; Gong, C.; Gonidec, A.; Gonzalez, S.; Gonzalez de la Hoz, S.; Gonzalez Silva, M.L.; Gonzalez-Pineiro, B.; Gonzalez-Sevilla, S.; Goodson, J.J.; Goossens, L.; Gorbounov, P.A.; Gordon, H.A.; Gorelov, I.; Gorfine, G.; Gorini, B.; Gorini, E.; Gorisek, A.; Gornicki, E.; Gorokhov, S.A.; Gorski, B.T.; Goryachev, V.N.; Gosdzik, B.; Gosselink, M.; Gostkin, M.I.; Gouanere, M.; Gough Eschrich, I.; Gouighri, M.; Goujdami, D.; Goulette, M.P.; Goussiou, A.G.; Goy, C.; Grabowska-Bold, I.; Grabski, V.; Grafstrom, P.; Grah, C.; Grahn, K-J.; Grancagnolo, F.; Grancagnolo, S.; Grassi, V.; Gratchev, V.; Grau, N.; Gray, H.M.; Gray, J.A.; Graziani, E.; Grebenyuk, O.G.; Green, B.; Greenfield, D.; Greenshaw, T.; Greenwood, Z.D.; Gregor, I.M.; Grenier, P.; Grewal, A.; Griesmayer, E.; Griffiths, J.; Grigalashvili, N.; Grillo, A.A.; Grimm, K.; Grinstein, S.; Grishkevich, Y.V.; Grivaz, J.F.; Groer, L.S.; Grognuz, J.; Groh, M.; Gross, E.; Grosse-Knetter, J.; Groth-Jensen, J.; Gruwe, M.; Grybel, K.; Guarino, V.J.; Guicheney, C.; Guida, A.; Guillemin, T.; Guindon, S.; Guler, H.; Gunther, J.; Guo, B.; Gupta, A.; Gusakov, Y.; Gushchin, V.N.; Gutierrez, A.; Gutierrez, P.; Guttman, N.; Gutzwiller, O.; Guyot, C.; Gwenlan, C.; Gwilliam, C.B.; Haas, A.; Haas, S.; Haber, C.; Haboubi, G.; Hackenburg, R.; Hadavand, H.K.; Hadley, D.R.; Haeberli, C.; Haefner, P.; Hartel, R.; Hahn, F.; Haider, S.; Hajduk, Z.; Hakobyan, H.; Haller, J.; Hallewell, G.D.; Hamacher, K.; Hamilton, A.; Hamilton, S.; Han, H.; Han, L.; Hanagaki, K.; Hance, M.; Handel, C.; Hanke, P.; Hansen, C.J.; Hansen, J.R.; Hansen, J.B.; Hansen, J.D.; Hansen, P.H.; Hansl-Kozanecka, T.; Hansson, P.; Hara, K.; Hare, G.A.; Harenberg, T.; Harper, R.; Harrington, R.D.; Harris, O.M.; Harrison, K; Hart, J.C.; Hartert, J.; Hartjes, F.; Haruyama, T.; Harvey, A.; Hasegawa, S.; Hasegawa, Y.; Hashemi, K.; Hassani, S.; Hatch, M.; Hauff, D.; Haug, S.; Hauschild, M.; Hauser, R.; Havranek, M.; Hawes, B.M.; Hawkes, C.M.; Hawkings, R.J.; Hawkins, D.; Hayakawa, T.; Hayward, H.S.; Haywood, S.J.; Hazen, E.; He, M.; Head, S.J.; Hedberg, V.; Heelan, L.; Heim, S.; Heinemann, B.; Heisterkamp, S.; Helary, L.; Heldmann, M.; Heller, M.; Hellman, S.; Helsens, C.; Hemperek, T.; Henderson, R.C.W.; Hendriks, P.J.; Henke, M.; Henrichs, A.; Henriques Correia, A.M.; Henrot-Versille, S.; Henry-Couannier, F.; Hensel, C.; Henss, T.; Hernandez Jimenez, Y.; Hershenhorn, A.D.; Herten, G.; Hertenberger, R.; Hervas, L.; Hessey, N.P.; Hidvegi, A.; Higon-Rodriguez, E.; Hill, D.; Hill, J.C.; Hill, N.; Hiller, K.H.; Hillert, S.; Hillier, S.J.; Hinchliffe, I.; Hindson, D.; Hines, E.; Hirose, M.; Hirsch, F.; Hirschbuehl, D.; Hobbs, J.; Hod, N.; Hodgkinson, M.C.; Hodgson, P.; Hoecker, A.; Hoeferkamp, M.R.; Hoffman, J.; Hoffmann, D.; Hohlfeld, M.; Holder, M.; Hollins, T.I.; Holmes, A.; Holmgren, S.O.; Holy, T.; Holzbauer, J.L.; Homer, R.J.; Homma, Y.; Horazdovsky, T.; Horn, C.; Horner, S.; Horton, K.; Hostachy, J-Y.; Hott, T.; Hou, S.; Houlden, M.A.; Hoummada, A.; Howell, D.F.; Hrivnac, J.; Hruska, I.; Hryn'ova, T.; Hsu, P.J.; Hsu, S.C.; Huang, G.S.; Hubacek, Z.; Hubaut, F.; Huegging, F.; Huffman, T.B.; Hughes, E.W.; Hughes, G.; Hughes-Jones, R.E.; Huhtinen, M.; Hurst, P.; Hurwitz, M.; Husemann, U.; Huseynov, N.; Huston, J.; Huth, J.; Iacobucci, G.; Iakovidis, G.; Ibbotson, M.; Ibragimov, I.; Ichimiya, R.; Iconomidou-Fayard, L.; Idarraga, J.; Idzik, M.; Iengo, P.; Igonkina, O.; Ikegami, Y.; Ikeno, M.; Ilchenko, Y.; Iliadis, D.; Imbault, D.; Imhaeuser, M.; Imori, M.; Ince, T.; Inigo-Golfin, J.; Ioannou, P.; Iodice, M.; Ionescu, G.; Irles Quiles, A.; Ishii, K.; Ishikawa, A.; Ishino, M.; Ishmukhametov, R.; Isobe, T.; Issever, C.; Istin, S.; Itoh, Y.; Ivashin, A.V.; Iwanski, W.; Iwasaki, H.; Izen, J.M.; Izzo, V.; Jackson, B.; Jackson, J.N.; Jackson, P.; Jaekel, M.R.; Jahoda, M.; Jain, V.; Jakobs, K.; Jakobsen, S.; Jakubek, J.; Jana, D.K.; Jankowski, E.; Jansen, E.; Jantsch, A.; Janus, M.; Jared, R.C.; Jarlskog, G.; Jeanty, L.; Jelen, K.; Jen-La Plante, I.; Jenni, P.; Jeremie, A.; Jez, P.; Jezequel, S.; Ji, H.; Ji, W.; Jia, J.; Jiang, Y.; Jimenez Belenguer, M.; Jin, G.; Jin, S.; Jinnouchi, O.; Joergensen, M.D.; Joffe, D.; Johansen, L.G.; Johansen, M.; Johansson, K.E.; Johansson, P.; Johnert, S.; Johns, K.A.; Jon-And, K.; Jones, G.; Jones, M.; Jones, R.W.L.; Jones, T.W.; Jones, T.J.; Jonsson, O.; Joo, K.K.; Joos, D.; Joram, C.; Jorge, P.M.; Jorgensen, S.; Joseph, J.; Juranek, V.; Jussel, P.; Kabachenko, V.V.; Kabana, S.; Kaci, M.; Kaczmarska, A.; Kadlecik, P.; Kado, M.; Kagan, H.; Kagan, M.; Kaiser, S.; Kajomovitz, E.; Kalinin, S.; Kalinovskaya, L.V.; Kama, S.; Kanaya, N.; Kaneda, M.; Kantserov, V.A.; Kanzaki, J.; Kaplan, B.; Kapliy, A.; Kaplon, J.; Kar, D.; Karagounis, M.; Karagoz, M.; Karnevskiy, M.; Karr, K.; Kartvelishvili, V.; Karyukhin, A.N.; Kashif, L.; Kasmi, A.; Kass, R.D.; Kastanas, A.; Kataoka, M.; Kataoka, Y.; Katsoufis, E.; Katzy, J.; Kaushik, V.; Kawagoe, K.; Kawamoto, T.; Kawamura, G.; Kayl, M.S.; Kayumov, F.; Kazanin, V.A.; Kazarinov, M.Y.; Kazi, S.I.; Keates, J.R.; Keeler, R.; Keener, P.T.; Kehoe, R.; Keil, M.; Kekelidze, G.D.; Kelly, M.; Kennedy, J.; Kenney, C.J.; Kenyon, M.; Kepka, O.; Kerschen, N.; Kersevan, B.P.; Kersten, S.; Kessoku, K.; Ketterer, C.; Khakzad, M.; Khalil-zada, F.; Khandanyan, H.; Khanov, A.; Kharchenko, D.; Khodinov, A.; Kholodenko, A.G.; Khomich, A.; Khoriauli, G.; Khovanskiy, N.; Khovanskiy, V.; Khramov, E.; Khubua, J.; Kilvington, G.; Kim, H.; Kim, M.S.; Kim, P.C.; Kim, S.H.; Kimura, N.; Kind, O.; Kind, P.; King, B.T.; King, M.; Kirk, J.; Kirsch, G.P.; Kirsch, L.E.; Kiryunin, A.E.; Kisielewska, D.; Kisielewski, B.; Kittelmann, T.; Kiver, A.M.; Kiyamura, H.; Kladiva, E.; Klaiber-Lodewigs, J.; Klein, M.; Klein, U.; Kleinknecht, K.; Klemetti, M.; Klier, A.; Klimentov, A.; Klingenberg, R.; Klinkby, E.B.; Klioutchnikova, T.; Klok, P.F.; Klous, S.; Kluge, E.E.; Kluge, T.; Kluit, P.; Kluth, S.; Knecht, N.S.; Kneringer, E.; Knobloch, J.; Ko, B.R.; Kobayashi, T.; Kobel, M.; Koblitz, B.; Kocian, M.; Kocnar, A.; Kodys, P.; Koneke, K.; Konig, A.C.; Koenig, S.; Konig, S.; Kopke, L.; Koetsveld, F.; Koevesarki, P.; Koffas, T.; Koffeman, E.; Kohn, F.; Kohout, Z.; Kohriki, T.; Koi, T.; Kokott, T.; Kolachev, G.M.; Kolanoski, H.; Kolesnikov, V.; Koletsou, I.; Koll, J.; Kollar, D.; Kollefrath, M.; Kolos, S.; Kolya, S.D.; Komar, A.A.; Komaragiri, J.R.; Kondo, T.; Kono, T.; Kononov, A.I.; Konoplich, R.; Konovalov, S.P.; Konstantinidis, N.; Kootz, A.; Koperny, S.; Kopikov, S.V.; Korcyl, K.; Kordas, K.; Koreshev, V.; Korn, A.; Korol, A.; Korolkov, I.; Korolkova, E.V.; Korotkov, V.A.; Kortner, O.; Kortner, S.; Kostyukhin, V.V.; Kotamaki, M.J.; Kotov, S.; Kotov, V.M.; Kotov, K.Y.; Kourkoumelis, C.; Koutsman, A.; Kowalewski, R.; Kowalski, H.; Kowalski, T.Z.; Kozanecki, W.; Kozhin, A.S.; Kral, V.; Kramarenko, V.A.; Kramberger, G.; Krasel, O.; Krasny, M.W.; Krasznahorkay, A.; Kraus, J.; Kreisel, A.; Krejci, F.; Kretzschmar, J.; Krieger, N.; Krieger, P.; Krobath, G.; Kroeninger, K.; Kroha, H.; Kroll, J.; Kroseberg, J.; Krstic, J.; Kruchonak, U.; Kruger, H.; Krumshteyn, Z.V.; Kruth, A.; Kubota, T.; Kuehn, S.; Kugel, A.; Kuhl, T.; Kuhn, D.; Kukhtin, V.; Kulchitsky, Y.; Kuleshov, S.; Kummer, C.; Kuna, M.; Kundu, N.; Kunkle, J.; Kupco, A.; Kurashige, H.; Kurata, M.; Kurchaninov, L.L.; Kurochkin, Y.A.; Kus, V.; Kuykendall, W.; Kuze, M.; Kuzhir, P.; Kvasnicka, O.; Kwee, R.; La Rosa, A.; La Rotonda, L.; Labarga, L.; Labbe, J.; Lacasta, C.; Lacava, F.; Lacker, H.; Lacour, D.; Lacuesta, V.R.; Ladygin, E.; Lafaye, R.; Laforge, B.; Lagouri, T.; Lai, S.; Lamanna, M.; Lambacher, M.; Lampen, C.L.; Lampl, W.; Lancon, E.; Landgraf, U.; Landon, M.P.J.; Landsman, H.; Lane, J.L.; Lange, C.; Lankford, A.J.; Lanni, F.; Lantzsch, K.; Lanza, A.; Lapin, V.V.; Laplace, S.; Lapoire, C.; Laporte, J.F.; Lari, T.; Larionov, A.V.; Larner, A.; Lasseur, C.; Lassnig, M.; Lau, W.; Laurelli, P.; Lavorato, A.; Lavrijsen, W.; Laycock, P.; Lazarev, A.B.; Lazzaro, A.; Le Dortz, O.; Le Guirriec, E.; Le Maner, C.; Le Menedeu, E.; Le Vine, M.; Leahu, M.; Lebedev, A.; Lebel, C.; Lechowski, M.; LeCompte, T.; Ledroit-Guillon, F.; Lee, H.; Lee, J.S.H.; Lee, S.C.; Lefebvre, M.; Legendre, M.; Leger, A.; LeGeyt, B.C.; Legger, F.; Leggett, C.; Lehmacher, M.; Lehmann Miotto, G.; Lehto, M.; Lei, X.; Leite, M.A.L.; Leitner, R.; Lellouch, D.; Lellouch, J.; Leltchouk, M.; Lendermann, V.; Leney, K.J.C.; Lenz, T.; Lenzen, G.; Lenzi, B.; Leonhardt, K.; Lepidis, J.; Leroy, C.; Lessard, J-R.; Lesser, J.; Lester, C.G.; Leung Fook Cheong, A.; Leveque, J.; Levin, D.; Levinson, L.J.; Levitski, M.S.; Lewandowska, M.; Leyton, M.; Li, B.; Li, H.; Li, X.; Liang, Z.; Liang, Z.; Liberti, B.; Lichard, P.; Lichtnecker, M.; Lie, K.; Liebig, W.; Lifshitz, R.; Lilley, J.N.; Lim, H.; Limosani, A.; Limper, M.; Lin, S.C.; Linde, F.; Linnemann, J.T.; Lipeles, E.; Lipinsky, L.; Lipniacka, A.; Liss, T.M.; Lissauer, D.; Lister, A.; Litke, A.M.; Liu, C.; Liu, D.; Liu, H.; Liu, J.B.; Liu, M.; Liu, S.; Liu, T.; Liu, Y.; Livan, M.; Livermore, S.S.A.; Lleres, A.; Lloyd, S.L.; Lobodzinska, E.; Loch, P.; Lockman, W.S.; Lockwitz, S.; Loddenkoetter, T.; Loebinger, F.K.; Loginov, A.; Loh, C.W.; Lohse, T.; Lohwasser, K.; Lokajicek, M.; Loken, J.; Long, R.E.; Lopes, L.; Lopez Mateos, D.; Losada, M.; Loscutoff, P.; Losty, M.J.; Lou, X.; Lounis, A.; Loureiro, K.F.; Lovas, L.; Love, J.; Love, P.A.; Lowe, A.J.; Lu, F.; Lu, J.; Lu, L.; Lubatti, H.J.; Luci, C.; Lucotte, A.; Ludwig, A.; Ludwig, D.; Ludwig, I.; Ludwig, J.; Luehring, F.; Luijckx, G.; Lumb, D.; Luminari, L.; Lund, E.; Lund-Jensen, B.; Lundberg, B.; Lundberg, J.; Lundquist, J.; Lungwitz, M.; Lupi, A.; Lutz, G.; Lynn, D.; Lynn, J.; Lys, J.; Lytken, E.; Ma, H.; Ma, L.L.; Maass en, M.; Macana Goia, J.A.; Maccarrone, G.; Macchiolo, A.; Macek, B.; Machado Miguens, J.; Macina, D.; Mackeprang, R.; MacQueen, D.; Madaras, R.J.; Mader, W.F.; Maenner, R.; Maeno, T.; Mattig, P.; Mattig, S.; Magalhaes Martins, P.J.; Magnoni, L.; Magradze, E.; Magrath, C.A.; Mahalalel, Y.; Mahboubi, K.; Mahmood, A.; Mahout, G.; Maiani, C.; Maidantchik, C.; Maio, A.; Majewski, S.; Makida, Y.; Makouski, M.; Makovec, N.; Mal, P.; Malecki, Pa.; Malecki, P.; Maleev, V.P.; Malek, F.; Mallik, U.; Malon, D.; Maltezos, S.; Malyshev, V.; Malyukov, S.; Mambelli, M.; Mameghani, R.; Mamuzic, J.; Manabe, A.; Manara, A.; Mandelli, L.; Mandic, I.; Mandrysch, R.; Maneira, J.; Mangeard, P.S.; Mangin-Brinet, M.; Manjavidze, I.D.; Mann, A.; Mann, W.A.; Manning, P.M.; Manousakis-Katsikakis, A.; Mansoulie, B.; Manz, A.; Mapelli, A.; Mapelli, L.; March, L.; Marchand, J.F.; Marchese, F.; Marchesotti, M.; Marchiori, G.; Marcisovsky, M.; Marin, A.; Marino, C.P.; Marroquim, F.; Marshall, R.; Marshall, Z.; Martens, F.K.; Marti-Garcia, S.; Martin, A.J.; Martin, A.J.; Martin, B.; Martin, B.; Martin, F.F.; Martin, J.P.; Martin, Ph.; Martin, T.A.; Martin dit Latour, B.; Martinez, M.; Martinez Outschoorn, V.; Martini, A.; Martyniuk, A.C.; Marzano, F.; Marzin, A.; Masetti, L.; Mashimo, T.; Mashinistov, R.; Masik, J.; Maslennikov, A.L.; Mass, M.; Massa, I.; Massaro, G.; Massol, N.; Mastroberardino, A.; Masubuchi, T.; Mathes, M.; Matricon, P.; Matsumoto, H.; Matsunaga, H.; Matsushita, T.; Mattravers, C.; Maugain, J.M.; Maxfield, S.J.; May, E.N.; Mayer, J.K.; Mayne, A.; Mazini, R.; Mazur, M.; Mazzanti, M.; Mazzoni, E.; Mc Donald, J.; Mc Kee, S.P.; McCarn, A.; McCarthy, R.L.; McCarthy, T.G.; McCubbin, N.A.; McFarlane, K.W.; McGarvie, S.; McGlone, H.; Mchedlidze, G.; McLaren, R.A.; McMahon, S.J.; McMahon, T.R.; McMahon, T.J.; McPherson, R.A.; Meade, A.; Mechnich, J.; Mechtel, M.; Medinnis, M.; Meera-Lebbai, R.; Meguro, T.; Mehdiyev, R.; Mehlhase, S.; Mehta, A.; Meier, K.; Meinhardt, J.; Meirose, B.; Melachrinos, C.; Mellado Garcia, B.R.; Mendoza Navas, L.; Meng, Z.; Mengarelli, A.; Menke, S.; Menot, C.; Meoni, E.; Merkl, D.; Mermod, P.; Merola, L.; Meroni, C.; Merritt, F.S.; Messina, A.M.; Messmer, I.; Metcalfe, J.; Mete, A.S.; Meuser, S.; Meyer, C.; Meyer, J-P.; Meyer, J.; Meyer, J.; Meyer, T.C.; Meyer, W.T.; Miao, J.; Michal, S.; Micu, L.; Middleton, R.P.; Miele, P.; Migas, S.; Migliaccio, A.; Mijovic, L.; Mikenberg, G.; Mikestikova, M.; Mikulec, B.; Mikuz, M.; Miller, D.W.; Miller, R.J.; Mills, W.J.; Mills, C.; Milov, A.; Milstead, D.A.; Milstein, D.; Mima, S.; Minaenko, A.A.; Minano, M.; Minashvili, I.A.; Mincer, A.I.; Mindur, B.; Mineev, M.; Ming, Y.; Mir, L.M.; Mirabelli, G.; Miralles Verge, L.; Misawa, S.; Miscetti, S.; Misiejuk, A.; Mitra, A.; Mitrevski, J.; Mitrofanov, G.Y.; Mitsou, V.A.; Mitsui, S.; Miyagawa, P.S.; Miyazaki, K.; Mjornmark, J.U.; Mladenov, D.; Moa, T.; Moch, M.; Mockett, P.; Moed, S.; Moeller, V.; Monig, K.; Moser, N.; Mohn, B.; Mohr, W.; Mohrdieck-Mock, S.; Moisseev, A.M.; Moles-Valls, R.; Molina-Perez, J.; Moneta, L.; Monk, J.; Monnier, E.; Montesano, S.; Monticelli, F.; Moore, R.W.; Moorhead, G.F.; Mora Herrera, C.; Moraes, A.; Morais, A.; Morel, J.; Morello, G.; Moreno, D.; Moreno Llacer, M.; Morettini, P.; Morgan, D.; Morii, M.; Morin, J.; Morita, Y.; Morley, A.K.; Mornacchi, G.; Morone, M-C.; Morozov, S.V.; Morris, J.D.; Moser, H.G.; Mosidze, M.; Moss, J.; Moszczynski, A.; Mount, R.; Mountricha, E.; Mouraviev, S.V.; Moye, T.H.; Moyse, E.J.W.; Mudrinic, M.; Mueller, F.; Mueller, J.; Mueller, K.; Muller, T.A.; Muenstermann, D.; Muijs, A.; Muir, A.; Munar, A.; Munwes, Y.; Murakami, K.; Murillo Garcia, R.; Murray, W.J.; Mussche, I.; Musto, E.; Myagkov, A.G.; Myska, M.; Nadal, J.; Nagai, K.; Nagano, K.; Nagasaka, Y.; Nairz, A.M.; Naito, D.; Nakamura, K.; Nakano, I.; Nanava, G.; Napier, A.; Nash, M.; Nasteva, I.; Nation, N.R.; Nattermann, T.; Naumann, T.; Nauyock, F.; Navarro, G.; Nderitu, S.K.; Neal, H.A.; Nebot, E.; Nechaeva, P.; Negri, A.; Negri, G.; Nelson, A.; Nelson, S.; Nelson, T.K.; Nemecek, S.; Nemethy, P.; Nepomuceno, A.A.; Nessi, M.; Nesterov, S.Y.; Neubauer, M.S.; Neukermans, L.; Neusiedl, A.; Neves, R.M.; Nevski, P.; Newcomer, F.M.; Nicholson, C.; Nickerson, R.B.; Nicolaidou, R.; Nicolas, L.; Nicoletti, G.; Nicquevert, B.; Niedercorn, F.; Nielsen, J.; Niinikoski, T.; Nikiforov, A.; Nikolaenko, V.; Nikolaev, K.; Nikolic-Audit, I.; Nikolopoulos, K.; Nilsen, H.; Nilsson, P.; Ninomiya, Y.; Nisati, A.; Nishiyama, T.; Nisius, R.; Nodulman, L.; Nomachi, M.; Nomidis, I.; Nomoto, H.; Nordberg, M.; Nordkvist, B.; Norniella Francisco, O.; Norton, P.R.; Notz, D.; Novakova, J.; Nozaki, M.; Nozicka, M.; Nugent, I.M.; Nuncio-Quiroz, A.E.; Nunes Hanninger, G.; Nunnemann, T.; Nurse, E.; Nyman, T.; O'Neale, S.W.; O'Neil, D.C.; O'Shea, V.; Oakham, F.G.; Oberlack, H.; Ocariz, J.; Ochi, A.; Oda, S.; Odaka, S.; Odier, J.; Odino, G.A.; Ogren, H.; Oh, A.; Oh, S.H.; Ohm, C.C.; Ohshima, T.; Ohshita, H.; Ohska, T.K.; Ohsugi, T.; Okada, S.; Okawa, H.; Okumura, Y.; Okuyama, T.; Olcese, M.; Olchevski, A.G.; Oliveira, M.; Oliveira Damazio, D.; Oliver, C.; Oliver, J.; Oliver Garcia, E.; Olivito, D.; Olszewski, A.; Olszowska, J.; Omachi, C.; Onofre, A.; Onyisi, P.U.E.; Oram, C.J.; Ordonez, G.; Oreglia, M.J.; Orellana, F.; Oren, Y.; Orestano, D.; Orlov, I.; Oropeza Barrera, C.; Orr, R.S.; Ortega, E.O.; Osculati, B.; Ospanov, R.; Osuna, C.; Otero y Garzon, G.; Ottersbach, J.P; Ottewell, B.; Ouchrif, M.; Ould-Saada, F.; Ouraou, A.; Ouyang, Q.; Owen, M.; Owen, S.; Oyarzun, A; Oye, O.K.; Ozcan, V.E.; Ozone, K.; Ozturk, N.; Pacheco Pages, A.; Padilla Aranda, C.; Paganis, E.; Paige, F.; Pajchel, K.; Palestini, S.; Palla, J.; Pallin, D.; Palma, A.; Palmer, J.D.; Palmer, M.J.; Pan, Y.B.; Panagiotopoulou, E.; Panes, B.; Panikashvili, N.; Panin, V.N.; Panitkin, S.; Pantea, D.; Panuskova, M.; Paolone, V.; Paoloni, A.; Papadopoulou, Th.D.; Paramonov, A.; Park, S.J.; Park, W.; Parker, M.A.; Parker, S.I.; Parodi, F.; Parsons, J.A.; Parzefall, U.; Pasqualucci, E.; Passeri, A.; Pastore, F.; Pastore, Fr.; Pasztor, G.; Pataraia, S.; Patel, N.; Pater, J.R.; Patricelli, S.; Pauly, T.; Peak, L.S.; Pecsy, M.; Pedraza Morales, M.I.; Peeters, S.J.M.; Peleganchuk, S.V.; Peng, H.; Pengo, R.; Penson, A.; Penwell, J.; Perantoni, M.; Perez, K.; Perez Codina, E.; Perez Garcia-Estan, M.T.; Perez Reale, V.; Peric, I.; Perini, L.; Pernegger, H.; Perrino, R.; Perrodo, P.; Persembe, S.; Perus, P.; Peshekhonov, V.D.; Petereit, E.; Peters, O.; Petersen, B.A.; Petersen, J.; Petersen, T.C.; Petit, E.; Petridis, A.; Petridou, C.; Petrolo, E.; Petrucci, F.; Petschull, D; Petteni, M.; Pezoa, R.; Pfeifer, B.; Phan, A.; Phillips, A.W.; Phillips, P.W.; Piacquadio, G.; Piccaro, E.; Piccinini, M.; Pickford, A.; Piegaia, R.; Pilcher, J.E.; Pilkington, A.D.; Pina, J.; Pinamonti, M.; Pinfold, J.L.; Ping, J.; Pinto, B.; Pirotte, O.; Pizio, C.; Placakyte, R.; Plamondon, M.; Plano, W.G.; Pleier, M.A.; Pleskach, A.V.; Poblaguev, A.; Poddar, S.; Podlyski, F.; Poffenberger, P.; Poggioli, L.; Poghosyan, T.; Pohl, M.; Polci, F.; Polesello, G.; Policicchio, A.; Polini, A.; Poll, J.; Polychronakos, V.; Pomarede, D.M.; Pomeroy, D.; Pommes, K.; Ponsot, P.; Pontecorvo, L.; Pope, B.G.; Popeneciu, G.A.; Popescu, R.; Popovic, D.S.; Poppleton, A.; Popule, J.; Portell Bueso, X.; Porter, R.; Posch, C.; Pospelov, G.E.; Pospisil, S.; Potekhin, M.; Potrap, I.N.; Potter, C.J.; Potter, C.T.; Potter, K.P.; Poulard, G.; Poveda, J.; Prabhu, R.; Pralavorio, P.; Prasad, S.; Prata, M.; Pravahan, R.; Prell, S.; Pretzl, K.; Pribyl, L.; Price, D.; Price, L.E.; Price, M.J.; Prichard, P.M.; Prieur, D.; Primavera, M.; Prokofiev, K.; Prokoshin, F.; Protopopescu, S.; Proudfoot, J.; Prudent, X.; Przysiezniak, H.; Psoroulas, S.; Ptacek, E.; Puigdengoles, C.; Purdham, J.; Purohit, M.; Puzo, P.; Pylypchenko, Y.; Qi, M.; Qian, J.; Qian, W.; Qian, Z.; Qin, Z.; Qing, D.; Quadt, A.; Quarrie, D.R.; Quayle, W.B.; Quinonez, F.; Raas, M.; Radeka, V.; Radescu, V.; Radics, B.; Rador, T.; Ragusa, F.; Rahal, G.; Rahimi, A.M.; Rahm, D.; Raine, C.; Raith, B.; Rajagopalan, S.; Rajek, S.; Rammensee, M.; Rammes, M.; Ramstedt, M.; Ratoff, P.N.; Rauscher, F.; Rauter, E.; Raymond, M.; Read, A.L.; Rebuzzi, D.M.; Redelbach, A.; Redlinger, G.; Reece, R.; Reeves, K.; Reichold, A.; Reinherz-Aronis, E.; Reinsch, A; Reisinger, I.; Reljic, D.; Rembser, C.; Ren, Z.L.; Renkel, P.; Rensch, B.; Rescia, S.; Rescigno, M.; Resconi, S.; Resende, B.; Reznicek, P.; Rezvani, R.; Richards, A.; Richards, R.A.; Richter, R.; Richter-Was, E.; Ridel, M.; Rieke, S.; Rijpstra, M.; Rijssenbeek, M.; Rimoldi, A.; Rinaldi, L.; Rios, R.R.; Riu, I.; Rivoltella, G.; Rizatdinova, F.; Rizvi, E.; Roa Romero, D.A.; Robertson, S.H.; Robichaud-Veronneau, A.; Robinson, D.; Robinson, JEM; Robinson, M.; Robson, A.; Rocha de Lima, J.G.; Roda, C.; Roda Dos Santos, D.; Rodier, S.; Rodriguez, D.; Rodriguez Garcia, Y.; Roe, A.; Roe, S.; Rohne, O.; Rojo, V.; Rolli, S.; Romaniouk, A.; Romanov, V.M.; Romeo, G.; Romero Maltrana, D.; Roos, L.; Ros, E.; Rosati, S.; Rosenbaum, G.A.; Rosenberg, E.I.; Rosendahl, P.L.; Rosselet, L.; Rossetti, V.; Rossi, E.; Rossi, L.P.; Rossi, L.; Rotaru, M.; Rothberg, J.; Rottlander, I.; Rousseau, D.; Royon, C.R.; Rozanov, A.; Rozen, Y.; Ruan, X.; Ruckert, B.; Ruckstuhl, N.; Rud, V.I.; Rudolph, G.; Ruhr, F.; Ruggieri, F.; Ruiz-Martinez, A.; Rulikowska-Zarebska, E.; Rumiantsev, V.; Rumyantsev, L.; Runge, K.; Runolfsson, O.; Rurikova, Z.; Rusakovich, N.A.; Rust, D.R.; Rutherfoord, J.P.; Ruwiedel, C.; Ruzicka, P.; Ryabov, Y.F.; Ryadovikov, V.; Ryan, P.; Rybkin, G.; Rzaeva, S.; Saavedra, A.F.; Sadeh, I.; Sadrozinski, H.F-W.; Sadykov, R.; Safai Tehrani, F.; Sakamoto, H.; Sala, P.; Salamanna, G.; Salamon, A.; Saleem, M.; Salihagic, D.; Salnikov, A.; Salt, J.; Salvachua Ferrando, B.M.; Salvatore, D.; Salvatore, F.; Salvucci, A.; Salzburger, A.; Sampsonidis, D.; Samset, B.H.; Sandaker, H.; Sander, H.G.; Sanders, M.P.; Sandhoff, M.; Sandhu, P.; Sandoval, T.; Sandstroem, R.; Sandvoss, S.; Sankey, D.P.C.; Sanny, B.; Sansoni, A.; Santamarina Rios, C.; Santoni, C.; Santonico, R.; Santos, H.; Saraiva, J.G.; Sarangi, T.; Sarkisyan-Grinbaum, E.; Sarri, F.; Sartisohn, G.; Sasaki, O.; Sasaki, T.; Sasao, N.; Satsounkevitch, I.; Sauvage, G.; Savard, P.; Savine, A.Y.; Savinov, V.; Savva, P.; Sawyer, L.; Saxon, D.H.; Says, L.P.; Sbarra, C.; Sbrizzi, A.; Scallon, O.; Scannicchio, D.A.; Schaarschmidt, J.; Schacht, P.; Schafer, U.; Schaetzel, S.; Schaffer, A.C.; Schaile, D.; Schaller, M.; Schamberger, R.D.; Schamov, A.G.; Scharf, V.; Schegelsky, V.A.; Scheirich, D.; Schernau, M.; Scherzer, M.I.; Schiavi, C.; Schieck, J.; Schioppa, M.; Schlenker, S.; Schlereth, J.L.; Schmidt, E.; Schmidt, M.P.; Schmieden, K.; Schmitt, C.; Schmitz, M.; Scholte, R.C.; Schoning, A.; Schott, M.; Schouten, D.; Schovancova, J.; Schram, M.; Schreiner, A.; Schroeder, C.; Schroer, N.; Schroers, M.; Schroff, D.; Schuh, S.; Schuler, G.; Schultes, J.; Schultz-Coulon, H.C.; Schumacher, J.W.; Schumacher, M.; Schumm, B.A.; Schune, Ph.; Schwanenberger, C.; Schwartzman, A.; Schweiger, D.; Schwemling, Ph.; Schwienhorst, R.; Schwierz, R.; Schwindling, J.; Scott, W.G.; Searcy, J.; Sedykh, E.; Segura, E.; Seidel, S.C.; Seiden, A.; Seifert, F.; Seixas, J.M.; Sekhniaidze, G.; Seliverstov, D.M.; Sellden, B.; Sellers, G.; Seman, M.; Semprini-Cesari, N.; Serfon, C.; Serin, L.; Seuster, R.; Severini, H.; Sevior, M.E.; Sfyrla, A.; Shabalina, E.; Shamim, M.; Shan, L.Y.; Shank, J.T.; Shao, Q.T.; Shapiro, M.; Shatalov, P.B.; Shaver, L.; Shaw, C.; Shaw, K.; Sherman, D.; Sherwood, P.; Shibata, A.; Shield, P.; Shimizu, S.; Shimojima, M.; Shin, T.; Shmeleva, A.; Shochet, M.J.; Shupe, M.A.; Sicho, P.; Sidoti, A.; Siebel, A.; Siegert, F; Siegrist, J.; Sijacki, Dj.; Silbert, O.; Silva, J.; Silver, Y.; Silverstein, D.; Silverstein, S.B.; Simak, V.; Simic, Lj.; Simion, S.; Simmons, B.; Simonyan, M.; Sinervo, P.; Sinev, N.B.; Sipica, V.; Siragusa, G.; Sisakyan, A.N.; Sivoklokov, S.Yu.; Sjolin, J.; Sjursen, T.B.; Skinnari, L.A.; Skovpen, K.; Skubic, P.; Skvorodnev, N.; Slater, M.; Slavicek, T.; Sliwa, K.; Sloan, T.J.; Sloper, J.; Smakhtin, V.; Smirnov, S.Yu.; Smirnov, Y.; Smirnova, L.N.; Smirnova, O.; Smith, B.C.; Smith, D.; Smith, K.M.; Smizanska, M.; Smolek, K.; Snesarev, A.A.; Snow, S.W.; Snow, J.; Snuverink, J.; Snyder, S.; Soares, M.; Sobie, R.; Sodomka, J.; Soffer, A.; Solans, C.A.; Solar, M.; Solc, J.; Solfaroli Camillocci, E.; Solodkov, A.A.; Solovyanov, O.V.; Soluk, R.; Sondericker, J.; Soni, N.; Sopko, V.; Sopko, B.; Sorbi, M.; Sosebee, M.; Soukharev, A.; Spagnolo, S.; Spano, F.; Speckmayer, P.; Spencer, E.; Spighi, R.; Spigo, G.; Spila, F.; Spiriti, E.; Spiwoks, R.; Spogli, L.; Spousta, M.; Spreitzer, T.; Spurlock, B.; St. Denis, R.D.; Stahl, T.; Stahlman, J.; Stamen, R.; Stancu, S.N.; Stanecka, E.; Stanek, R.W.; Stanescu, C.; Stapnes, S.; Starchenko, E.A.; Stark, J.; Staroba, P.; Starovoitov, P.; Stastny, J.; Staude, A.; Stavina, P.; Stavropoulos, G.; Steele, G.; Stefanidis, E.; Steinbach, P.; Steinberg, P.; Stekl, I.; Stelzer, B.; Stelzer, H.J.; Stelzer-Chilton, O.; Stenzel, H.; Stevenson, K.; Stewart, G.A.; Stiller, W.; Stockmanns, T.; Stockton, M.C.; Stodulski, M.; Stoerig, K.; Stoicea, G.; Stonjek, S.; Strachota, P.; Stradling, A.R.; Straessner, A.; Strandberg, J.; Strandberg, S.; Strandlie, A.; Strang, M.; Strauss, M.; Strizenec, P.; Strohmer, R.; Strom, D.M.; Strong, J.A.; Stroynowski, R.; Strube, J.; Stugu, B.; Stumer, I.; Stupak, J.; Sturm, P.; Soh, D.A.; Su, D.; Sugaya, Y.; Sugimoto, T.; Suhr, C.; Suita, K.; Suk, M.; Sulin, V.V.; Sultansoy, S.; Sumida, T.; Sun, X.H.; Sundermann, J.E.; Suruliz, K.; Sushkov, S.; Susinno, G.; Sutton, M.R.; Suzuki, Y.; Sviridov, Yu.M.; Swedish, S.; Sykora, I.; Sykora, T.; Szczygiel, R.R.; Szeless, B.; Szymocha, T.; Sanchez, J.; Ta, D.; Taboada Gameiro, S.; Tackmann, K.; Taffard, A.; Tafirout, R.; Taga, A.; Takahashi, Y.; Takai, H.; Takashima, R.; Takeda, H.; Takeshita, T.; Talby, M.; Talyshev, A.; Tamsett, M.C.; Tanaka, J.; Tanaka, R.; Tanaka, S.; Tanaka, S.; Tanaka, Y.; Tani, K.; Tappern, G.P.; Tapprogge, S.; Tardif, D.; Tarem, S.; Tarrade, F.; Tartarelli, G.F.; Tas, P.; Tasevsky, M.; Tassi, E.; Tatarkhanov, M.; Taylor, C.; Taylor, F.E.; Taylor, G.; Taylor, G.N.; Taylor, R.P.; Taylor, W.; Teixeira Dias Castanheira, M.; Teixeira-Dias, P.; Temming, K.K.; Ten Kate, H.; Teng, P.K.; Tennenbaum-Katan, Y.D.; Terada, S.; Terashi, K.; Terron, J.; Terwort, M.; Testa, M.; Teuscher, R.J.; Tevlin, C.M.; Thadome, J.; Therhaag, J.; Theveneaux-Pelzer, T.; Thioye, M.; Thoma, S.; Thomas, J.P.; Thompson, E.N.; Thompson, P.D.; Thompson, P.D.; Thompson, R.J.; Thompson, A.S.; Thomson, E.; Thomson, M.; Thun, R.P.; Tic, T.; Tikhomirov, V.O.; Tikhonov, Y.A.; Timmermans, C.J.W.P.; Tipton, P.; Tique Aires Viegas, F.J.; Tisserant, S.; Tobias, J.; Toczek, B.; Todorov, T.; Todorova-Nova, S.; Toggerson, B.; Tojo, J.; Tokar, S.; Tokunaga, K.; Tokushuku, K.; Tollefson, K.; Tomasek, L.; Tomasek, M.; Tomoto, M.; Tompkins, D.; Tompkins, L.; Toms, K.; Tonazzo, A.; Tong, G.; Tonoyan, A.; Topfel, C.; Topilin, N.D.; Torchiani, I.; Torrence, E.; Torro Pastor, E.; Toth, J.; Touchard, F.; Tovey, D.R.; Traynor, D.; Trefzger, T.; Treis, J.; Tremblet, L.; Tricoli, A.; Trigger, I.M.; Trincaz-Duvoid, S.; Trinh, T.N.; Tripiana, M.F.; Triplett, N.; Trischuk, W.; Trivedi, A.; Trocme, B.; Troncon, C.; Trottier-McDonald, M.; Trzupek, A.; Tsarouchas, C.; Tseng, J.C-L.; Tsiakiris, M.; Tsiareshka, P.V.; Tsionou, D.; Tsipolitis, G.; Tsiskaridze, V.; Tskhadadze, E.G.; Tsukerman, I.I.; Tsulaia, V.; Tsung, J.W.; Tsuno, S.; Tsybychev, D.; Tuggle, J.M.; Turala, M.; Turecek, D.; Turk Cakir, I.; Turlay, E.; Tuts, P.M.; Twomey, M.S.; Tylmad, M.; Tyndel, M.; Typaldos, D.; Tyrvainen, H.; Tzamarioudaki, E.; Tzanakos, G.; Uchida, K.; Ueda, I.; Ueno, R.; Ugland, M.; Uhlenbrock, M.; Uhrmacher, M.; Ukegawa, F.; Unal, G.; Underwood, D.G.; Undrus, A.; Unel, G.; Unno, Y.; Urbaniec, D.; Urkovsky, E.; Urquijo, P.; Urrejola, P.; Usai, G.; Uslenghi, M.; Vacavant, L.; Vacek, V.; Vachon, B.; Vahsen, S.; Valderanis, C.; Valenta, J.; Valente, P.; Valentinetti, S.; Valkar, S.; Valladolid Gallego, E.; Vallecorsa, S.; Valls Ferrer, J.A.; Van Berg, R.; van der Graaf, H.; van der Kraaij, E.; van der Poel, E.; van der Ster, D.; Van Eijk, B.; van Eldik, N.; van Gemmeren, P.; van Kesteren, Z.; van Vulpen, I.; Vandelli, W.; Vandoni, G.; Vaniachine, A.; Vankov, P.; Vannucci, F.; Varela Rodriguez, F.; Vari, R.; Varnes, E.W.; Varouchas, D.; Vartapetian, A.; Varvell, K.E.; Vasilyeva, L.; Vassilakopoulos, V.I.; Vazeille, F.; Vegni, G.; Veillet, J.J.; Vellidis, C.; Veloso, F.; Veness, R.; Veneziano, S.; Ventura, A.; Ventura, D.; Ventura, S.; Venturi, M.; Venturi, N.; Vercesi, V.; Verducci, M.; Verkerke, W.; Vermeulen, J.C.; Vertogardov, L.; Vetterli, M.C.; Vichou, I.; Vickey, T.; Viehhauser, G.H.A.; Viel, S.; Villa, M.; Villani, E.G.; Villaplana Perez, M.; Vilucchi, E.; Vincter, M.G.; Vinek, E.; Vinogradov, V.B.; Virchaux, M.; Viret, S.; Virzi, J.; Vitale, A.; Vitells, O.; Vivarelli, I.; Vives Vaque, F.; Vlachos, S.; Vlasak, M.; Vlasov, N.; Vogel, A.; Vokac, P.; Volpi, M.; Volpini, G.; von der Schmitt, H.; von Loeben, J.; von Radziewski, H.; von Toerne, E.; Vorobel, V.; Vorobiev, A.P.; Vorwerk, V.; Vos, M.; Voss, R.; Voss, T.T.; Vossebeld, J.H.; Vovenko, A.S.; Vranjes, N.; Vranjes Milosavljevic, M.; Vrba, V.; Vreeswijk, M.; Vu Anh, T.; Vudragovic, D.; Vuillermet, R.; Vukotic, I.; Wagner, W.; Wagner, P.; Wahlen, H.; Walbersloh, J.; Walder, J.; Walker, R.; Walkowiak, W.; Wall, R.; Waller, P.; Wang, C.; Wang, H.; Wang, J.; Wang, J.C.; Wang, S.M.; Warburton, A.; Ward, C.P.; Warsinsky, M.; Wastie, R.; Watkins, P.M.; Watson, A.T.; Watson, M.F.; Watts, G.; Watts, S.; Waugh, A.T.; Waugh, B.M.; Webel, M.; Weber, J.; Weber, M.; Weber, M.S.; Weber, P.; Weidberg, A.R.; Weingarten, J.; Weiser, C.; Wellenstein, H.; Wells, P.S.; Wen, M.; Wenaus, T.; Wendler, S.; Weng, Z.; Wengler, T.; Wenig, S.; Wermes, N.; Werner, M.; Werner, P.; Werth, M.; Werthenbach, U.; Wessels, M.; Whalen, K.; Wheeler-Ellis, S.J.; Whitaker, S.P.; White, A.; White, M.J.; White, S.; Whitehead, S.R.; Whiteson, D.; Whittington, D.; Wicek, F.; Wicke, D.; Wickens, F.J.; Wiedenmann, W.; Wielers, M.; Wienemann, P.; Wiglesworth, C.; Wiik, L.A.M.; Wildauer, A.; Wildt, M.A.; Wilhelm, I.; Wilkens, H.G.; Will, J.Z.; Williams, E.; Williams, H.H.; Willis, W.; Willocq, S.; Wilson, J.A.; Wilson, M.G.; Wilson, A.; Wingerter-Seez, I.; Winkelmann, S.; Winklmeier, F.; Wittgen, M.; Wolter, M.W.; Wolters, H.; Wosiek, B.K.; Wotschack, J.; Woudstra, M.J.; Wraight, K.; Wright, C.; Wright, D.; Wrona, B.; Wu, S.L.; Wu, X.; Wuestenfeld, J.; Wulf, E.; Wunstorf, R.; Wynne, B.M.; Xaplanteris, L.; Xella, S.; Xie, S.; Xie, Y.; Xu, C.; Xu, D.; Xu, G.; Xu, N.; Yabsley, B.; Yamada, M.; Yamamoto, A.; Yamamoto, K.; Yamamoto, S.; Yamamura, T.; Yamaoka, J.; Yamazaki, T.; Yamazaki, Y.; Yan, Z.; Yang, H.; Yang, S.; Yang, U.K.; Yang, Y.; Yang, Y.; Yang, Z.; Yanush, S.; Yao, W-M.; Yao, Y.; Yasu, Y.; Ye, J.; Ye, S.; Yilmaz, M.; Yoosoofmiya, R.; Yorita, K.; Yoshida, H.; Yoshida, R.; Young, C.; Youssef, S.P.; Yu, D.; Yu, J.; Yu, J.; Yuan, J.; Yuan, L.; Yurkewicz, A.; Zaets, V.G.; Zaidan, R.; Zaitsev, A.M.; Zajacova, Z.; Zalite, Yo.K.; Zambrano, V.; Zanello, L.; Zarzhitsky, P.; Zaytsev, A.; Zdrazil, M.; Zeitnitz, C.; Zeller, M.; Zema, P.F.; Zemla, A.; Zendler, C.; Zenin, A.V.; Zenin, O.; Zenis, T.; Zenonos, Z.; Zenz, S.; Zerwas, D.; Zevi della Porta, G.; Zhan, Z.; Zhang, H.; Zhang, J.; Zhang, Q.; Zhang, X.; Zhao, L.; Zhao, T.; Zhao, Z.; Zhemchugov, A.; Zheng, S.; Zhong, J.; Zhou, B.; Zhou, N.; Zhou, Y.; Zhu, C.G.; Zhu, H.; Zhu, Y.; Zhuang, X.; Zhuravlov, V.; Zilka, B.; Zimmermann, R.; Zimmermann, S.; Zimmermann, S.; Ziolkowski, M.; Zitoun, R.; Zivkovic, L.; Zmouchko, V.V.; Zobernig, G.; Zoccoli, A.; Zolnierowski, Y.; Zsenei, A.; zur Nedden, M.; Zutshi, V.
2010-01-01
First measurements of the W -> lnu and Z/gamma* -> ll (l = e, mu) production cross sections in proton-proton collisions at sqrt(s) = 7 TeV are presented using data recorded by the ATLAS experiment at the LHC. The results are based on 2250 W -> lnu and 179 Z/gamma* -> ll candidate events selected from a data set corresponding to an integrated luminosity of approximately 320 nb-1. The measured total W and Z/gamma*-boson production cross sections times the respective leptonic branching ratios for the combined electron and muon channels are $\\stotW$ * BR(W -> lnu) = 9.96 +- 0.23(stat) +- 0.50(syst) +- 1.10(lumi) nb and $\\stotZg$ * BR(Z/gamma* -> ll) = 0.82 +- 0.06(stat) +- 0.05(syst) +- 0.09(lumi) nb (within the invariant mass window 66 < m_ll < 116 GeV). The W/Z cross-section ratio is measured to be 11.7 +- 0.9(stat) +- 0.4(syst). In addition, measurements of the W+ and W- production cross sections and of the lepton charge asymmetry are reported. Theoretical predictions based on NNLO QCD calculations are f...
Electron mobility in few-layer MoxW1-xS2
International Nuclear Information System (INIS)
Chandrasekar, Hareesh; Nath, Digbijoy N
2015-01-01
Heterostructures of two-dimensional (2D) layered materials are increasingly being explored for electronics in order to potentially extend conventional transistor scaling and to exploit new device designs and architectures. Alloys form a key underpinning of any heterostructure device technology and therefore an understanding of their electronic properties is essential. In this paper, we study the intrinsic electron mobility in few-layer Mo x W 1−x S 2 as limited by various scattering mechanisms. The room temperature, energy-dependent scattering times corresponding to polar longitudinal optical (LO) phonon, alloy and background impurity scattering mechanisms are estimated based on the Born approximation to Fermi’s golden rule. The contribution of individual scattering rates is analyzed as a function of 2D electron density as well as of alloy composition in Mo x W 1−x S 2 . While impurity scattering limits the mobility for low carrier densities (<2–4×10 12 cm −2 ), LO polar phonon scattering is the dominant mechanism for high electron densities. Alloy scattering is found to play a non-negligible role for 0.5 < x < 0.7 in Mo x W 1−x S 2 . The LO phonon-limited and impurity-limited mobilities show opposing trends with respect to alloy mole fractions. The understanding of electron mobility in Mo x W 1−x S 2 presented here is expected to enable the design and realization of heterostructures and devices based on alloys of MoS 2 and WS 2 . (paper)
Effects of social isolation and re-socialization on cognition and ADAR1 (p110) expression in mice.
Chen, Wei; An, Dong; Xu, Hong; Cheng, Xiaoxin; Wang, Shiwei; Yu, Weizhi; Yu, Deqin; Zhao, Dan; Sun, Yiping; Deng, Wuguo; Tang, Yiyuan; Yin, Shengming
2016-01-01
It has been reported that social isolation stress could be a key factor that leads to cognitive deficit for both humans and rodent models. However, detailed mechanisms are not yet clear. ADAR1 (Adenosine deaminase acting on RNA) is an enzyme involved in RNA editing that has a close relation to cognitive function. We have hypothesized that social isolation stress may impact the expression of ADAR1 in the brain of mice with cognitive deficit. To test our hypothesis, we evaluated the cognition ability of mice isolated for different durations (2, 4, and 8 weeks) using object recognition and object location tests; we also measured ADAR1 expression in hippocampus and cortex using immunohistochemistry and western blot. Our study showed that social isolation stress induced spatial and non-spatial cognition deficits of the tested mice. In addition, social isolation significantly increased both the immunoreactivity and protein expression of ADAR1 (p110) in the hippocampus and frontal cortex. Furthermore, re-socialization could not only recover the cognition deficits, but also bring ADAR1 (p110) immunoreactivity of hippocampus and frontal cortex, as well as ADAR1 (p110) protein expression of hippocampus back to the normal level for the isolated mice in adolescence. In conclusion, social isolation stress significantly increases ADAR1 (p110) expression in the hippocampus and frontal cortex of the mice with cognitive deficit. This finding may open a window to better understand the reasons (e.g., epigenetic change) that are responsible for social isolation-induced cognitive deficit and help the development of novel therapies for the resulted diseases.
Hyun, Yang-Jin; Kim, Bomi; Kim, Dong-Hyun
2012-04-01
beta-D-Xylosidase (E.C. 3.2.1.37) from Bifidobacterium breve K-110, which hydrolyzes ginsenoside Ra1 to ginsenoside Rb2, was cloned and expressed in Escherichia coli. The (His6)-tagged recombinant enzyme, designated as XlyBK- 110, was efficiently purified using Ni²⁺-affinity chromatography (109.9-fold, 84% yield). The molecular mass of XylBK- 100 was found to be 55.7 kDa by SDS-PAGE. Its sequence revealed a 1,347 bp open reading frame (ORF) encoding a protein containing 448 amino acids, which showed 82% identity (DNA) to the previously reported glycosyl hydrolase family 30 of Bifidobacterium adolescentis ATCC 15703. The Km and Vmax values toward p-nitrophenyl-beta-D-xylopyranoside (pNPX) were 1.45mM and 10.75 micromol/min/mg, respectively. This enzyme had pH and temperature optima at 6.0 and 45 degrees C, respectively. XylBK-110 acted to the greatest extent on xyloglucosyl kakkalide, followed by pNPX and ginsenoside Ra1, but did not act on p-nitrophenyl-alpha-Larabinofuranoside, p-nitrophenyl-beta-D-glucopyranoside, or p-nitrophenyl-beta-D-fucopyranoside. In conclusion, this is the first report on the cloning and expression of beta-Dxylosidase- hydrolyzing ginsenoside Ra1 and kakkalide from human intestinal microflora.
Tyrosine 110 in the measles virus phosphoprotein is required to block STAT1 phosphorylation
International Nuclear Information System (INIS)
Devaux, Patricia; Messling, Veronika von; Songsungthong, Warangkhana; Springfeld, Christoph; Cattaneo, Roberto
2007-01-01
The measles virus (MV) P gene encodes three proteins: P, an essential polymerase cofactor, and C and V, which have multiple functions including immune evasion. We show here that the MV P protein also contributes to immune evasion, and that tyrosine 110 is required to block nuclear translocation of the signal transducer and activator of transcription factors (STAT) after interferon type I treatment. In particular, MV P inhibits STAT1 phosphorylation. This is shown not only by transient expression but also by reverse genetic analyses based on a new functional infectious cDNA derived from a MV vaccine vial (Moraten strain). Our study also identifies a conserved sequence around P protein tyrosine 110 as a candidate interaction site with a cellular protein
Goldie, D. J.; Glowacka, D. M.; Withington, S.; Chen, Jiajun; Ade, P. A. R.; Morozov, D.; Sudiwala, R.; Trappe, N. A.; Quaranta, O.
2016-07-01
We describe the geometry, architecture, dark- and optical performance of ultra-low-noise transition edge sensors as THz detectors for the SAFARI instrument. The TESs are fabricated from superconducting Mo/Au bilayers coupled to impedance-matched superconducting β-phase Ta thin-film absorbers. The detectors have phonon-limited dark noise equivalent powers of order 0.5 - 1.0 aW/ √ Hz and saturation powers of order 20 - 40 fW. The low temperature test configuration incorporating micro-machined backshorts is also described, and construction and typical performance characteristics for the optical load are shown. We report preliminary measurements of the optical performance of these TESs for two SAFARI bands; L-band at 110 - 210 μm and S-band 34 - 60 μm .
Dunbar, W E; Schilt, A A
1972-09-01
Seven new hydroxy-substituted 1,10-phenanthroline derivatives have been evaluated as chromogenic reagents for the determination of copper in strongly alkaline solution. The most sensitive of these, 2,9-dimethyl-4,7-dihydroxy-1,10-phenanthroline, has proven to be highly effective in a simple, rapid procedure for determining trace amounts of copper in sodium hydroxide, potassium carbonate, sodium phosphate or ammonium hydroxide.
1977-01-01
The housing of the External Particle Identifier (EPI) is being moved to S3 beam. Test measurements with EPI were performed in the S3 beam between 20 and 110 GeV/c, before installing it behind BEBC. 110 GeV/c before
Energy Technology Data Exchange (ETDEWEB)
Knapp, M.
2006-05-15
In this work it is demonstrated that there are different ways to deactivate the RuO{sub 2}(110)- surface. All experiments were performed on Ru single-crystals under UHV-conditions by applying the surface science techniques including Low Energy Electron Diffraction (LEED), Thermal Desorption Spectroscopy (TDS), Scanning Tunnelling Microscopy (STM) and X-ray Photoelectron Spectroscopy (XPS). An active RuO{sub 2}(110) film was produced by exposing a well-prepared single crystal Ru(0001) surface to high doses of oxygen at elevated temperatures of 600-650 K. An alternative way to deactivate the RuO{sub 2}(110) surface was studied by adsorbing hydrogen. On the bare (stoichiometric) surface hydrogen adsorbs at room temperature dissociatively on the O{sub br} atoms forming hydroxyl groups. The hydroxyl groups are not active in the oxidation of CO. On the other hand the adsorption and desorption process of the CO molecule is not affected by the hydroxyl groups. Therefore it is possible to passivate only one kind of active sites on the RuO{sub 2}(110) surface. The hydroxyl groups are stable up to a temperature around 550 K. Above this temperature water is formed by the recombination of two neighboring OH groups and desorbs into the gas phase, leaving O-vacancies on the surface. To remove the hydrogen from the O{sub br} atoms at lower temperatures one needs to dose oxygen at 300 K. Water molecules are immediately formed on the 1f-cus-Ru atoms and desorb at about 400 K into the gas phase. After this oxidation step the surface is restored. The reason for this behaviour is a hydrogen transfer reaction on the surface: The hydrogen is initially located on the O{sub br} sites whereas the subsequently dosed oxygen adsorbs atomically on the 1f-cus-Ru forming on-topoxygen (O{sub ot}). This O{sub ot} picks up the hydrogen from the O{sub br} and forms water molecules. The hydrogen transfer reaction plays a key role in the interaction of hydrogen with the RuO{sub 2}(110) surface. By
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We report on the measurement of W-boson pair-production with the L3 detector at LEP at an average centre-of-mass energy of 172.13~GeV. In a data sample corresponding to a total luminosity of 10.25~pb$^{-1}$ we select 110 four-fermion events with pairs of hadronic jets or leptons with high invariant masses. Branching fractions of W decays into different fermion-antifermion pairs are determined with and without the assumption of charged-current lepton universality. The branching fraction for hadronic W decays is measured to be: $ B(\\mathrm{W\\rightarrow hadrons}) = 64.2^{+3.7}_{-3.8}~(stat.) \\pm 0.5~(syst.)~\\%$. Combining all final states the total cross section for W-pair production is measured to be: $\\sigma_{\\mathrm{WW}} = 12.27^{+1.41}_{-1.32}~(stat.)\\pm0.23~(syst.)$~pb. The results are in good agreement with the Standard Model.
33 CFR 110.156 - Randall Bay, Freeport, Long Island, N.Y.
2010-07-01
... Island, N.Y. 110.156 Section 110.156 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.156 Randall Bay, Freeport, Long Island, N.Y. (a) The anchorage grounds. Southward of a line 312 feet south of and parallel to the south side...
33 CFR 110.168 - Hampton Roads, Virginia and adjacent waters (Datum: NAD 83).
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hampton Roads, Virginia and adjacent waters (Datum: NAD 83). 110.168 Section 110.168 Navigation and Navigable Waters COAST GUARD..., Virginia and adjacent waters (Datum: NAD 83). (a) Anchorage Grounds—(1) Anchorage A [Naval Anchorage]. The...
Zipf’s law, 1/f noise, and fractal hierarchy
International Nuclear Information System (INIS)
Chen Yanguang
2012-01-01
Highlights: ► I developed a general scaling method based on hierarchies of cites. ► Hierarchy is classified into three types based on monofractal and multifractals. ► Zipf’s law can be used to estimate the capacity dimension of a multifractal set. ► I derive the self-similar hierarchy from the rank-size distribution. ► The hierarchical scaling method can be applied to the 1/f spectra. - Abstract: Fractals, 1/f noise, and Zipf’s laws are frequently observed within the natural living world as well as in social institutions, representing three signatures of complex systems. All these observations are associated with scaling laws and therefore have created much research interest in many diverse scientific circles. However, the inherent relationships between these scaling phenomena are not yet clear. In this paper, theoretical demonstration and mathematical experiments based on urban studies are employed to reveal the analogy between fractal patterns, 1/f spectra, and the Zipf distribution. First, the multifractal process empirically suggests the Zipf distribution. Second, a 1/f spectrum is mathematically identical to Zipf’s law. Third, both 1/f spectra and Zipf’s law can be converted into a self-similar hierarchy. Fourth, fractals, 1/f spectra, Zipf’s law can be rescaled with similar exponential laws and power laws. The self-similar hierarchy is a more general scaling method which can be used to unify different scaling phenomena and rules in both physical and social systems such as cities, rivers, earthquakes, fractals, 1/f noise, and rank-size distributions. The mathematical laws of this hierarchical structure can provide us with a holistic perspective of looking at complexity and complex systems.
Lyo, In-Whan
Electronic properties of the epitaxially grown Na(110) film have been studied using angle resolved ultraviolet photoemission spectroscopy with synchrotron radiation as the light source. Na provides an ideal ground to study the fundamental aspects of the electron-electron interactions in metals, because of its simple Fermi surface and small pseudopotential. The absolute band structure of Na(110) using angle resolved photoemission spectroscopy has been mapped out using the extrema searching method. The advantage of this approach is that the usual assumption of the unoccupied state dispersion is not required. We have found that the dispersion of Na(1l0) is very close to the parabolic band with the effective mass 1.21 M_{rm e} at 90 K. Self-consistent calculations of the self-energy for the homogeneous electron gas have been performed using the Green's function technique within the framework of the GW approximation, in the hope of understanding the narrowing mechanism of the bandwidth observed for all the nearly-free-electron (NFE) metals. Good agreements between the experimental data and our calculated self-energy were obtained not only for our data on k-dependency from Na(l10), but also for the total bandwidth corrections for other NFE metals, only if dielectric functions beyond the random phase approximation were used. Our findings emphasize the importance of the screening by long wavelength plasmons. Off-normal spectra of angle resolved photoemission from Na(110) show strong asymmetry of the bulk peak intensity for the wide range of photon energies. Using a simple analysis, we show this asymmetry has an origin in the interference of the surface Umklapp electrons with the normal electrons. We have also performed the detailed experimental studies of the anomalous Fermi level structure observed in the forbidden gap region of Na. This was claimed by A. W. Overhauser as the evidence of the charge density wave in the alkali metal. The possibility of this hypothesis is
High temperature behaviour of E110G and E110 fuel claddings in various mixtures of steam and air
International Nuclear Information System (INIS)
Perez-Feró, Erzsébet; Novotny, Tamás; Horváth, Márta; Kunstár, Mihály; Vér, Nóra; Hózer, Zoltán
2014-01-01
Experiments with sponge base E110G and the traditional E110 were carried out to compare the oxidation kinetics of these alloys in steam, in hydrogen rich steam, in steam-air and in air atmosphere and to study the effect of hydrogen- and nitrogen-containing environment on the oxidation. The effect of oxidizing atmosphere on the mechanical behaviour of the claddings was also investigated. The new and the traditional types of cladding rings were oxidised at high temperature (600°C – 1200°C). Oxidation of both alloys in steam-air mixture and in air atmosphere resulted in faster oxidation kinetics compared to steam. In many cases bumpy, porous oxide layer have been found. The presence of hydrogen in the steam atmosphere had no significant effect on the oxidation kinetics. Comparing the two alloys, more favourable behaviour of oxidised E110G was observed regarding the oxidation kinetics, breakaway oxidation and load bearing capability in all cases. (author)
Valence isomerization of 2-phospha-4-silabicyclo[1.1.0]butane: a high-level ab initio study
Slootweg, J.C.; Ehlers, A.W.; Lammertsma, K.
2006-01-01
The rearrangements for 2-phospha-4-silabicyclo[1.1.0]butane, analogous to the valence isomerization of the hydrocarbons bicyclobutane, 1,3-butadiene, and cyclobutene, were studied at the (U)QCISD(T)/ 6-311+G**//(U)QCISD/6-31G* level of theory. The monocyclic 1,2-dihydro-1,2-phosphasiletes are shown
Silencing p110β prevents rapid depletion of nuclear pAkt
International Nuclear Information System (INIS)
Ye, Zhi-wei; Ghalali, Aram; Högberg, Johan; Stenius, Ulla
2011-01-01
Highlights: ► p110β was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. ► p110β knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. ► Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110β subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110β in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110β knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110β is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110β knock out cells. We also found that p110β was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110β is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.
Silencing p110{beta} prevents rapid depletion of nuclear pAkt
Energy Technology Data Exchange (ETDEWEB)
Ye, Zhi-wei; Ghalali, Aram; Hoegberg, Johan [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden); Stenius, Ulla, E-mail: ulla.stenius@ki.se [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden)
2011-12-02
Highlights: Black-Right-Pointing-Pointer p110{beta} was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. Black-Right-Pointing-Pointer p110{beta} knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. Black-Right-Pointing-Pointer Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110{beta} subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110{beta} in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110{beta} knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110{beta} is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110{beta} knock out cells. We also found that p110{beta} was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110{beta} is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.
41 CFR 102-117.110 - What is satisfactory service?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...
THE HEAT TREATMENT ANALYSIS OF E110 CASE HARDENING STEEL
Directory of Open Access Journals (Sweden)
MAJID TOLOUEI-RAD
2016-03-01
Full Text Available This paper investigates mechanical and microstructural behaviour of E110 case hardening steel when subjected to different heat treatment processes including quenching, normalizing and tempering. After heat treatment samples were subjected to mechanical and metallographic analysis and the properties obtained from applying different processes were analysed. The heat treatment process had certain effects on the resultant properties and microstructures obtained for E110 steel which are described in details. Quenching produced a martensitic microstructure characterized by significant increase in material’s hardness and a significant decreased in its impact energy. Annealed specimens produced a coarse pearlitic microstructure with minimal variation in hardness and impact energy. For normalized samples, fine pearlitic microstructure was identified with a moderate increase in hardness and significant reduction in impact energy. Tempering had a significant effect on quenched specimens, with a substantial rise in material ductility and reduction of hardness with increasing tempering temperature. Furthermore, Results provide additional substantiation of temper embrittlement theory for low-carbon alloys, and indicate potential occurrence of temper embrittlement for fine pearlitic microstructures.
Coder’s Manual: A Guide to TEPIAC Documentation.
1977-07-01
Po Polonium Am Americium Hg Mercury Pr Praseodymium *Ar Argon (Hydrargyrum) Pt Platinum (also A) Ho Holmium Pu Plutonium *As Arsenic *1 Iodine Ra...Er 20 3 208 D ChD2 110 F F 2 Fe (FeF 21 209 E C 6H1 5ErO1 2S 3[Er(C 2 HSO 4)3] III G GaO4P [GaPO4] 210 F CH3 F 112 H 1iNO 212 G C8 H20Ge [Ge(C 2 H 5...Fluidity, 69 Heat conductance (contact), 62 Fluidized bed, 27 Heat conduction, 57 Fluorescence, 125 Heat conductivity, 57 Food products, 31 Heat content
Synthesis and crystal structure of two lead (II) complexes with 1,10-phenanthroline ligand
International Nuclear Information System (INIS)
Olivera, Fiorella L.; Santillan, Guillermo A.
2012-01-01
Two coordination complexes have been synthesized by the reaction of lead nitrate (II) with 1,10-phenanthroline in methanol/water. The crystals of these complexes were obtained by using the diffusion method and structurally characterized by X-ray single crystal diffraction. Both complexes crystallized in the monoclinic space group P2 1 /c. The analysis by crystal X-ray diffraction reveals that in both complexes the coordination around the lead (II) ion is a distorted octahedral structure where the ion is bonded to the heterocyclic nitrogen atoms of chelating ligand 1,10-phenanthroline, three oxygen atoms of three nitrate groups and one oxygen from the water molecule. The difference between the complexes lies in the way of nitrate ion in presence of carboxylic acid aromatics. In addition, the crystal structure of complexes can be regarded as a 3D coordination polymer through Pb-O weak interactions, hydrogen bonds and π-π stacking interactions. (author).
40 CFR 180.110 - Maneb; tolerances for residues.
2010-07-01
... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.110... None Pepper 7 None Potato 0.1 None Pumpkin 7 None Squash, summer 4 None Squash, winter 4 None Tomato 4...
Abulencia, A; Acosta, D; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachacou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben-Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bishai, M; Blair, R E; Blocker, C; Bloom, K; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Bourov, S; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Connolly, A; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cruz, A; Cuevas, J; Culbertson, R; Cyr, D; DaRonco, S; D'Auria, S; D'onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Dionisi, C; Dittmann, J R; DiTuro, P; Dörr, C; Dominguez, A; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Fujii, Y; Furic, I; Gajjar, A; Gallinaro, M; Galyardt, J; Garcia, J E; Garcia Sciverez, M; Garfinkel, A F; Gay, C; Gerberich, H; Gerchtein, E; Gerdes, D; Giagu, S; di Giovanni, G P; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giokaris, N; Giolo, K; Giordani, M; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Y; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B-Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Hayward, H; Heijboer, A; Heinemann, B; Heinrich, J; Hennecke, M; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Huston, J; Ikado, K; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karagoz-Unel, M; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, M S; Kim, S B; Kim, S H; Kim, Y K; Kirby, M; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Kordas, K; Korytov, A; Kotwal, A V; Kovalev, A; Kraus, J; Kravchenko, I; Kreps, M; Kreymer, A; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecci, C; LeCompte, T; Lee, J; Lee, J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Li, K; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Liu, Y; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Maksimovic, P; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McGivern, D; McIntyre, P; McNamara, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Miscetti, S; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Mulhearn, M; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Ogawa, T; Oh, S H; Oh, Y D; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Paoletti, R; Papadimitriou, V; Papikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pitts, K; Plager, C; Pondrom, L; Pope, G; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Rakitin, A; Rappoccio, S; Ratnikov, F; Reisert, B; Rekovic, V; van Remortel, N; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Rinnert, K; Ristori, L; Robertson, W J; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Rott, C; Ruiz, A; Russ, J; Rusu, V; Ryan, D; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Sanchez, C; Santi, L; Sarkar, S; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Semeria, F; Sexton-Kennedy, L; Sfiligoi, I; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sill, A; Sinervo, P; Sisakyan, A; Sjolin, J; Skiba, A; Slaughter, A J; Sliwa, K; Smirnov, D; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sumorok, K; Sun, H; Suzuki, T; Taffard, A; Tafirout, R; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Tönnesmann, M; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vacavant, L; Vaiciulis, A; Vallecorsa, S; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vickey, T; Vidal, R; Vila, I; Vilar, R; Vollrath, I; Volobouev, I; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Walter, T; Wan, Z; Wang, M J; Wang, S M; Warburton, A; Ward, B; Waschke, S; Waters, D; Watts, T; Weber, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Worm, S; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, Y; Yang, C; Yang, U K; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zetti, F; Zhang, X; Zhou, J; Zucchelli, S
2006-03-03
We present a search for Higgs bosons decaying into bb and produced in association with W bosons in pp collisions at square root of s = 1.96 TeV. This search uses 320 pb(-1) of the data set accumulated by the upgraded Collider Detector at Fermilab. Events are selected that have a high-transverse momentum electron or muon, missing transverse energy, and two jets, at least one of which is consistent with the hadronization of a b quark. Both the number of events and the dijet mass distribution are consistent with standard model background expectations, and we set 95% confidence level upper limits on the production cross section times branching ratio for the Higgs boson or any new particle with similar decay kinematics. These upper limits range from 10 pb for mH = 110 GeV/c2 to 3 pb for mH = 150 GeV/c2.
Characteristics of first loaded IG-110 graphite in HTTR core
International Nuclear Information System (INIS)
Sumita, Junya; Shibata, Taiju; Iyoku, Tatsuo; Sawa, Kazuhiro; Hanawa, Satoshi; Ishihara, Masahiro
2006-10-01
IG-110 graphite is a fine-grained isotropic and nuclear-grade graphite with excellent resistivity on both irradiation and corrosion and with high strength. The IG-110 graphite is used for the graphite components of High Temperature Engineering Test Reactor (HTTR) such as fuel and control rod guide blocks and support posts. In order to design and fabricate the graphite components in the HTTR, the Japan Atomic Energy Research Institute (the Japan Atomic Energy Agency at present) had established the graphite structural design code and design data on the basis of former research results. After the design code establishment, the IG-110 graphite components were fabricated and loaded in the HTTR core. This report summarized the characteristics of the first loaded IG-110 graphite as basic data for surveillance test, measuring material characteristics changed by neutron irradiation and oxidation. By comparing the design data, it was shown that the first loaded IG-110 graphite had excellent strength properties and enough safety margins to the stress limits in the design code. (author)
Magnetic properties of smooth terminating dipole bands in 110,112Te
International Nuclear Information System (INIS)
Evans, A.O.; Paul, E.S.; Boston, A.J.; Chantler, H.J.; Chiara, C.J.; Devlin, M.; Fletcher, A.M.; Fossan, D.B.; LaFosse, D.R.; Lane, G.J.; Lee, I.Y.; Macchiavelli, A.O.; Nolan, P.J.; Sarantites, D.G.; Sears, J.M.; Semple, A.T.; Smith, J.F.; Starosta, K.; Vaman, C.; Afanasjev, A.V.; Ragnarsson, I.
2006-01-01
Three strongly coupled sequences have been established in 110,112 Te up to high spins. They are interpreted in terms of deformed structures built on proton 1-particle-1-hole excitations that reach termination at I∼40-bar . This is the first observation of smooth terminating dipole structures in this mass region. Lifetime measurements have allowed the extraction of experimental B(M1;I->I-1) and B(E2;I->I-2) reduced transition rates for one of the dipole bands in 110 Te. The results support the deformed interpretation
40 CFR 415.110 - Applicability; description of the potassium metal production subcategory.
2010-07-01
... potassium metal production subcategory. 415.110 Section 415.110 Protection of Environment ENVIRONMENTAL... SOURCE CATEGORY Potassium Metal Production Subcategory § 415.110 Applicability; description of the potassium metal production subcategory. The provisions of this subpart are applicable to discharges...
Abu El-Enin, M. A.; El-Wasseef, D. R.; El-Sherbiny, D. T.; El-Ashry, S. M.
2009-01-01
A simple and sensitive spectrophotometric method was developed for the determination of labetalol HCl (LBT) and lercanidipine HCl (LER) in pure form and in dosage forms. The method was based upon oxidation of the LBT and LER with Fe+3 and the estimation of the produced Fe+2 with 1,10-phenanthroline. The absorbance of the tris(1,10-phenanthroline) Fe+2 complex was measured at 510 nm. Reaction conditions were optimized to obtain colored complex of higher sensitivity and longer stability. The ab...
Butane-1,2,3,4-tetracarboxylic acid–1,10-phenanthroline–water (1/2/2
Directory of Open Access Journals (Sweden)
Hong-lin Zhu
2011-07-01
Full Text Available The asymmetric unit of the title compound, 2C12H8N2·C8H10O8·2H2O, contains one 1,10-phenanthroline molecule, one half-molecule of butane-1,2,3,4-tetracarboxylic acid (H4BTC and a water molecule, with the complete tetra-acid generated by crystallographic inversion symmetry. Intermolecular O—H...O hydrogen bonds and π–π stacking interactions [centroid–centroid distances = 3.672 (2 and 3.708 (2 Å form an extensive three-dimensional network, which consolidates the crystal packing.
Tank characterization report for single-shell tank 241-U-110
International Nuclear Information System (INIS)
Brown, T.M.; Jensen, L.
1993-09-01
Tank 241-U-110 (U-110) is a Hanford Site waste tank that was;most recently sampled in November and December 1989. Analysis of the samples obtained from tank U-110 was conducted to support the characterization of the contents of this tank and to support Hanford Federal Facility Agreement and Consent Order milestone M-10-00 (Ecology, et al. 1992). Because of incomplete recovery of the waste during sampling, there may be bias in the results of this characterization report
24 CFR 100.110 - Discriminatory practices in residential real estate-related transactions.
2010-04-01
... residential real estate-related transactions. 100.110 Section 100.110 Housing and Urban Development... Discrimination in Residential Real Estate-Related Transactions § 100.110 Discriminatory practices in residential real estate-related transactions. (a) This subpart provides the Department's interpretation of the...
24 CFR 266.110 - Reserve requirements.
2010-04-01
... HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Housing Finance Agency Requirements § 266.110 Reserve requirements. (a) HFAs with top-tier designation or overall...
12 CFR 560.110 - Most favored lender usury preemption.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Most favored lender usury preemption. 560.110... INVESTMENT Lending and Investment Provisions Applicable to all Savings Associations § 560.110 Most favored... permits its most favored lender to charge late fees, then a savings association located in that state may...
21 CFR 333.110 - First aid antibiotic active ingredients.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false First aid antibiotic active ingredients. 333.110... (CONTINUED) DRUGS FOR HUMAN USE TOPICAL ANTIMICROBIAL DRUG PRODUCTS FOR OVER-THE-COUNTER HUMAN USE First Aid Antibiotic Drug Products § 333.110 First aid antibiotic active ingredients. The product consists of any of...
Energetics and dynamics of Pt dimers on Pt(110)-(1x2)
International Nuclear Information System (INIS)
Linderoth, T.R.; Horch, S.; Petersen, L.; Helveg, S.; Schoenning, M.; Laegsgaard, E.; Stensgaard, I.; Besenbacher, F.
2000-01-01
The stability and dynamics of Pt dimers on Pt(110)-(1x2) are studied using fast-scanning, variable-temperature STM. The kinetics of both dissociation and association of dimers have been quantified from a direct analysis of time-lapse STM movies. The extracted barriers are at variance with results from ab initio calculations, and we speculate that the discrepancies are due to trace amounts of gas impurities such as CO
Palladium sulphide (PdS) films as a new thermoelectric sulphide compound
Energy Technology Data Exchange (ETDEWEB)
Ares, J.R.; Diaz-Chao, P.; Clamagirand, J.; Macia, M.D.; Ferrer, I.J.; Sanchez, C. [Universidad Autonoma de Madrid (Spain). Lab. de Materiales de Interes en Energias Renovables
2010-07-01
Palladium sulphide (PdS) films have been prepared by direct sulphuration of 20 nm thick palladium films at different temperatures (200 C < T < 450 C). Sulphurated films exhibit an unique crystalline phase: PdS. Seebeck coefficient and electrical resistivity of these films are between -110 and -150 {mu}V/K and {proportional_to} 0.08 to 0.8 {omega}cm depending on the sulphuration temperature. Negative sign of Seebeck coefficient indicates an n type conduction in all films. Discussion is focused on the influence of atomic ratio between sulphur and palladium as well as impurities arising from the substrate on transport properties. (orig.)
48 CFR 1337.110-71 - Additional DOC clauses related to service contracting.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Additional DOC clauses related to service contracting. 1337.110-71 Section 1337.110-71 Federal Acquisition Regulations System....110-71 Additional DOC clauses related to service contracting. (a) Insert a clause substantially...
International Nuclear Information System (INIS)
Kang, Jung Youl; Shin, Su jeong; Kim, Jae Kwan; Park, Kyoung Chan
2016-01-01
Two Tb(III) complexes, [Tb(TETA)]− and [Tb(TETA)(phen)]− (TETA = 1,4,8,11-tetraazacyclotetradecane-1,4,8,11-tetraacetate and phen=1,10-phenanthroline), were synthesized and their luminescence ("5D_4 → "7F_=_0_-_6 transitions) and magnetic properties were examined. The photoluminescence (PL) quantum yield of [Tb(TETA)(phen)]− (Q = 0.47) was significantly higher than that of [Tb(TETA)]− (Q = 0.006). The dramatic increase (78 x) in green luminescence was attributed to intramolecular energy transfer from phen to Tb(III). The energy transfer rate according to Dexter theory was found to be approximately 1011s−1. The temperature dependence of the molar susceptibilities confirmed that the two complexes behave as paramagnets obeying the Curie–Weiss law. In addition, the field-dependent magnetization of the two complexes measured in the −70 to + 70 kOe range at T=1.8K fitted well with the Brillouin function with the following values: g _e_f_f=1.5, μ B =9.27×10−21 emu, and J=6. These results provide new insights into the development of lanthanide metal complexes with tetraaza
Energy Technology Data Exchange (ETDEWEB)
Rapko, Brian M.; Vienna, John D.; Sinkov, Serguei I.; Kim, Jinseong; Cisar, Alan J.
2002-09-10
This study addressed three aspects in selected alkaline leaching: first, the use of oxidants persulfate, permanganate, and ferrate as selective chromium-leaching agents from washed Hanford Tank S-110 solids under varying conditions of hydroxide concentration, temperature, and time was investigated. Second, the selective dissolution of solids containing mercury(II) oxide under alkaline conditions was examined. Various compounds were studied for their effectiveness in dissolving mercury under varying conditions of time, temperature, and hydroxide concentration in the leachate. Three compounds were studied: cysteine, iodide, and diethyldithiophosphoric acid (DEDTPA). Finally, the possibility of whether an oxidant bound to an anion-exchange resin can be used to effectively oxidize chromium(III) in alkaline solutions was addressed. The experimental results remain ambiguous to date; further work is required to reach any definitive conclusions as to the effectiveness of this approach.
33 CFR 110.194a - Mobile Bay, Ala., and Mississippi Sound, Miss.
2010-07-01
... Sound, Miss. 110.194a Section 110.194a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Mississippi Sound, Miss. (a) The anchorage grounds. (1) The waters of lower Mobile Bay, near Cedar Point... south by latitude 30°20′00″, and on the west by longitude 88°06′00″. (2) The waters of Mississippi Sound...
LSMO-STO(110) multilayered structure grown by metalorganic aerosol deposition
International Nuclear Information System (INIS)
Sapoval, Oleg; Belenchuk, Alexander; Canter, Valeriu; Zasavitsky, Efim; Moshnyaga, Vasily
2013-01-01
La 0.67 Sr 0.33 MnO 3 -SrTiO 3 multilayered structure was grown on SrTiO 3 (110) substrates by metalorganic aerosol deposition technique. The crystal structure was examined by X-ray analysis including simulation of diffraction and reflection patterns. The magneto transport properties of superlattice are presented. The critical thickness of (110)-oriented LSMO layers is lower than 7 perovskite unite cells. The oxygen stoichiometry provided due to high gas pressure conditions is responsible for reducing of critical thickness of LSMO layers at LSMO-STO(110) interfaces. (authors)
Tank characterization report for single-shell tank 241-C-110. Revision 1
International Nuclear Information System (INIS)
Benar, C.J.
1997-01-01
One of the major functions of the Tank Waste Remediation System (IWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-C-110. The objectives of this report are to use characterization data in response to technical issues associated with 241-C-110 waste and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Supporting data and information are contained in the appendixes. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. While only the results from recent sample events will be used to fulfill the requirements of the data quality objectives (DQOs), other information can be used to support or question conclusions derived from these results. Historical information for tank 241-C-110 are provided included surveillance information, records pertaining to waste transfers and tank operations, and 1124 expected tank contents derived from a process knowledge model. The sampling events are listed, as well as sample data obtained before 1989. The results of the 1992 sampling events are also reported in the data package. The statistical analysis and numerical manipulation of data used in issue resolution are reported in Appendix C. Appendix D contains the evaluation to establish the best basis for the inventory estimate and the statistical analysis performed for this evaluation. A bibliography that resulted from an in-depth literature search of all known information sources applicable to tank 241-C-110 and its respective waste types is contained in Appendix E
21 CFR 135.110 - Ice cream and frozen custard.
2010-04-01
...) of this section, the name of the food is “frozen custard” or “french ice cream” or “french custard... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Ice cream and frozen custard. 135.110 Section 135.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...
Diffusion of cesium and iodine in compressed IG-110 graphite compacts
International Nuclear Information System (INIS)
Carter, L.M.; Brockman, J.D.; Robertson, J.D.; Loyalka, S.K.
2016-01-01
Nuclear graphite grade IG-110 is currently used in the High Temperature Engineering Test Reactor (HTTR) in Japan for certain permanent and replaceable core components, and is a material of interest in general. Therefore, transport parameters for fission products in this material are needed. Measurement of diffusion through pressed compacts of IG-110 graphite is experimentally attractive because they are easy to prepare with homogeneous distributions of fission product surrogates. In this work, we measured diffusion coefficients for Cs and I in pressed compacts made from IG-110 powder in the 1079–1290 K temperature range, and compared them to those obtained in as-received IG-110. - Highlights: • A method for analysis of fission product diffusion in graphite by ICP-MS was applied to pressed IG-110 graphite compacts containing cesium and iodine. • Diffusion coefficients for cesium and iodine were obtained. • The measurement design simulates HTGR conditions of high temperature and flowing helium.
2010-07-01
...) immediately before the heated filter. This will be determined by a temperature sensor located immediately upstream of the filter. The sensor shall have an accuracy and precision of ±2 °F (1.1 °C). (ii) At 235° ±15... 86.110-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS...
33 CFR 110.235 - Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83).
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). 110.235 Section 110.235 Navigation and Navigable Waters COAST... Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). (a) The anchorage grounds—(1...
Phosphorylation of DEPDC1 at Ser110 is required to maintain centrosome organization during mitosis.
Chen, Dan; Ito, Satoko; Hyodo, Toshinori; Asano-Inami, Eri; Yuan, Hong; Senga, Takeshi
2017-09-15
DEPDC1 (DEP domain containing 1) is overexpressed in multiple cancers and is associated with cell cycle progression. In this report, we have investigated the expression, localization, phosphorylation and function of DEPDC1 during mitosis. DEPDC1 has two isoforms (isoform a and isoform b), and both of them are increased in mitosis and degraded once cells exit mitosis. DEPDC1a is localized to the centrosome in metaphase, whereas DEPDC1b is localized to the entire cell cortex during mitosis. DEPDC1a, but not DEPDC1b, was required for the integrity of centrosome and organization of the bipolar spindle. Mass spectrometry and biochemical analyses revealed phosphorylation of DEPDC1 at Ser110. The phosphorylation of Ser110 is essential for localization of DEPDC1a to the centrosome. Consistently, non-phosphorylation mutants of DEPDC1a did not rescue disruption of centrosome organization by depletion of endogenous DEPDC1. Our results show a novel role for DEPDC1 in maintaining centrosome integrity during mitosis for the accurate distribution of chromosomes. Copyright © 2017. Published by Elsevier Inc.
Catalytic hydrolysis of COS over CeO{sub 2} (110) surface: A density functional theory study
Energy Technology Data Exchange (ETDEWEB)
Song, Xin; Ning, Ping [Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming 650500 (China); Wang, Chi [Faculty of Chemical Engineering, Kunming University of Science and Technology, Kunming 650500 (China); Li, Kai, E-mail: likaikmust@163.com [Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming 650500 (China); Tang, Lihong; Sun, Xin [Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming 650500 (China)
2017-08-31
Graphical abstract: CeO{sub 2} decreases the maximum energy barrier by 76.15 kcal/mol. H{sub 2}O plays a role as a bridge in the process of joint adsorption. Catalytic effect of CeO{sub 2} in the hydrolysis of COS is mainly reflected on the C−O channel. - Highlights: • H{sub 2}O is easier adsorbed on the CeO{sub 2} (110) surface than COS. • When COS and H{sub 2}O jointly adsorb on the CeO{sub 2} (110) surface, the H{sub 2}O molecule plays a role as a bridge. • Ce−O−H bond can enhance the adsorption effect. • Catalytic effect of CeO{sub 2} in the hydrolysis of COS is mainly reflected on the C−O channel. - Abstract: Density functional theory (DFT) calculations were performed to investigate the reaction pathways for catalytic hydrolysis of COS over CeO{sub 2} (110) surface using Dmol{sup 3} model. The thermodynamic stability analysis for the suggested routes of COS hydrolysis to CO{sub 2} and H{sub 2}S was evaluated. The absolute values of adsorption energy of H{sub 2}O-CeO{sub 2} are higher than that of COS-CeO{sub 2}. Meanwhile, the adsorption energy and geometries show that H{sub 2}O is easier adsorbed on the surface of CeO{sub 2} (110) than COS. H{sub 2}O plays a role as a bridge in the process of joint adsorption. H{sub 2}O forms more Ce−O−H groups on the CeO{sub 2} (110) surface. CeO{sub 2} decreases the maximum energy barrier by 76.15 kcal/mol. The migration of H from H{sub 2}O to COS is the key for the hydrolysis reaction. C−O channel is easier to occur than C−S channel. Experimental result shows that adding of CeO{sub 2} can increase COS removal rate and prolong the 100% COS removal rate from 180 min to 210 min. The difference between Fe{sub 2}O{sub 3} and CeO{sub 2} for the hydrolysis of COS is characterized in the atomic charge transfer and the formation of H−O bond and H−S bond. The transfer effect of H in H{sub 2}O to S in COS over CeO{sub 2} decreases the energy barriers of hydrolysis reaction, and enhances the reaction
2010-01-01
.... Dispute means a program or financial disagreement which the recipient organization requests be handled... recipient organization and SBA. Grants Management Specialist. An SBA employee designated by the AA/SBDCs who... Circular A-110 and Attachment E of OMB Circular A-102. Program manager. An SBA employee responsible for...
International Nuclear Information System (INIS)
Cabot, C.; Della Negra, S.; Deprun, C.; Gauvin, H.; Le Beyec, Y.
1978-01-01
By 63 Cu induced reactions on 110 Cd, 108 Cd, 106 Cd, 109 Ag, 107 Ag and 110 Pd targets, new isotopes were searched in the Ir, Os, Re region. Cross bombardments and excitation function measurements were used to identify new α emitting isotopes. The α-decay measurements are compared to the Qα values obtained from different mass predictions
Growth morphology and structure of bismuth thin films on GaSb(110)
DEFF Research Database (Denmark)
Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.
1998-01-01
Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....
Energy Technology Data Exchange (ETDEWEB)
Christofek, Leonard Steven [Illinois U., Urbana
2001-01-01
The production cross section times decay branching ratios for W + $\\gamma$ and Z/DY + $\\gamma$ have been measured in $\\sqrt{s}$ = 1.8 TeV $\\overline{p}p$ collisions using muon and electron data samples obtained during the 1992-1993 and 1994-1995 collider runs at the Fermilab Tevatron with the CDF detector corresponding to a total integrated luminosity of 110 pb . For photons with transverse energy E > 7.0 GeV, pseudorapidity in the central or plug region ($\\mid \\eta \\mid$ < 2.4) and a lepton-photon angular separation $\\Delta$R > 0.7, we observed 122(213) muon(electron) W$\\gamma$ candidates and 36(43) muon(electron) Z/DY + $\\gamma$ candidates. We observe a total of 335 muon plus electron W + $\\gamma$ and 79 muon plus electron Z/DY + $\\gamma$ candidates, whereas the standard model expectation is 264.6 $\\pm$ 18.2 W + $\\gamma$ events and 74.2 $\\pm$ 4.2 Z/DY + $\\gamma$ events. The combined electron plus muon channel results correspond to $\\sigma$ $\\cdot$ B(W + $\\gamma$ ) = 19.8 $\\pm$ 1.7 pb and $\\sigma$ $\\cdot$ B(Z/DY + $\\gamma$ ) = 5.5 $\\pm$ 0.8 pb. The next-to-leading-order standard model predictions are $\\sigma$ $\\cdot$ B(W + $\\gamma$ ) = 14.8 pb and $\\sigma$ $\\cdot$ B(Z/DY + $\\gamma$ ) = 5.8 pb. For W + $\\gamma$, this corresponds to a $\\sim$ 35% excess relative to the standard model prediction
10 CFR Appendix M to Part 110 - Categorization of Nuclear Material d
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Categorization of Nuclear Material d M Appendix M to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. M Appendix M to Part 110—Categorization of Nuclear Material d [From IAEA INFCIRC/225...
Dynamic behavior of zirconium alloy E110 under submicrosecond shock-wave loading
Kazakov, D. N.; Kozelkov, O. E.; Mayorova, A. S.; Malyugina, S. N.; Mokrushin, S. S.; Pavlenko, A. V.
2015-09-01
Stress waves have been measured under shock wave loading of zirconium alloy E110 samples with the 0.5 - 8 mm thickness at normal and elevated temperatures. Duration of shock loading pulses varied from ˜0.05 up to 1μs with the amplitude varying from 3.4 up to 23 GPa. Free-surface velocity profiles have been registered using VISAR and PDV interferometers with nanosecond resolution. Attenuation of the elastic precursor has been measured to determine plastic strain rate behind the elastic precursor front. The plastic strain rate was observed to decrease with propagation from 106 s-1 at the 0.46-mm distance down to 2 ṡ 104 s-1 at the 8-mm distance. Spall strength has been measured under normal and elevated temperatures. Spall strength versus strain rate relationships have been constructed in the 105 s-1 - 106s-1 range. Under shock compression higher than 10.6 GPa, the three-wave configuration of the shock wave has been registered and the polymorphous α → ω transition is considered to be the reason of this phenomenon. This work was supported by State Atomic Energy Corporation "Rosatom" within State Contract # H.4x.44.90.13.1111
19 CFR 200.735-110 - Indebtedness.
2010-04-01
... Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735-110 Indebtedness..., reflect adversely on the Government as his employer. In the event of a dispute between an employee and an...
43 CFR 46.110 - Incorporating consensus-based management.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Incorporating consensus-based management... § 46.110 Incorporating consensus-based management. (a) Consensus-based management incorporates direct... carry out those plans and activities. For the purposes of this Part, consensus-based management involves...
Energy Technology Data Exchange (ETDEWEB)
Zheng, Jun-Ru [Testing and Analysis Center, Hebei Normal University, Shijiazhuang 050024 (China); College of Chemistry and Material Science, Hebei Normal University, Shijiazhuang 050024 (China); Ren, Shu-Xia [Material Science and Engineering School, Shijiazhuang Tiedao University, Shijiazhaung 050043 (China); Ren, Ning [Department of Chemistry, Handan College, Handan 056005 (China); Zhang, Jian-Jun, E-mail: jjzhang6@126.com [Testing and Analysis Center, Hebei Normal University, Shijiazhuang 050024 (China); College of Chemistry and Material Science, Hebei Normal University, Shijiazhuang 050024 (China); Zhang, Da-Hai [Department of Chemistry, Handan College, Handan 056005 (China); Wang, Shu-Ping [College of Chemistry and Material Science, Hebei Normal University, Shijiazhuang 050024 (China)
2013-11-20
Graphical abstract: Four novel complexes ([Ln(3,5-DmeoxBA){sub 3}(phen)]{sub 2} (Ln = Tb(1), Dy(2), Er(3), Yb(4); 3,5-DmeoxBA = 3,5-dimethoxybenzoic acid; phen = 1,10-phenanthroline))were synthesized and characterized by elemental analysis, IR and TG/DSC-FTIR technology. Heat capacities of the four complexes were measured by differential scanning calorimetry (DSC). The antibacterial action of the four complexes on bacteria and fungus such as Escherichia coli, Staphylococcus aureus and Candida albicans were studied by filter paper approach. - Highlights: • Four novel complexes ([Ln(3,5-DmeoxBA){sub 3}(phen)]{sub 2} were synthesized and characterized. • The thermal decomposition processes of the title complexes were studied using the TG/DSC–FTIR coupling techniques. • The heat capacities of the complexes were measured by (DSC). • The antibacterial action of the four complexes on Escherichia coli, Staphylococcus aureus and Candida albicans were studied. - Abstract: Four lanthanide complexes with a general formula [Ln(3,5-DmeoxBA){sub 3}(phen)]{sub 2} (Ln = Tb(1), Dy(2), Er(3), Yb(4); 3,5-DmeoxBA = 3,5-dimethoxybenzoic acid; phen = 1,10-phenanthroline) were synthesized and characterized by elemental analysis, infrared spectra (IR), and thermogravimetric, differential scanning calorimetry techniques, combined with Fourier transform infrared (TG/DSC–FTIR) technology. The thermal decomposition processes of the four complexes were investigated by TG/DSC–FTIR techniques. Heat capacities were measured by DSC. The values of the experimental heat capacities were fitted to a polynomial equation with the least-squares method. Based on the fitted polynomial, the smoothed heat capacities and thermodynamic functions (H{sub T} − H{sub 298.15} {sub K}), (S{sub T} − S{sub 298.15} {sub K}), and (G{sub T} − G{sub 298.15} {sub K}) were calculated. The antibacterial action of the four complexes on bacteria and fungus such as Escherichia coli, Staphylococcus aureus and
International Nuclear Information System (INIS)
Zhukov, V.V.; Osovskij, V.D.; Ptushnikov, Yu.G.; Sukretnyj, V.G.; Chujkov, B.A.
1986-01-01
A molecular beam technique with an effusion source operating at T=200 K is used to study the adsorption interaction of oxygen with W(100) and (110) faces in the range of the simple temperatures from 5 to 340 K. Three weakly-bound adsorption states of oxygen are detected corresponding to adsorption in the second, third and forth monolayer. These states are characterized by adsorption energies of 0.13, 0.08 and 0.07 eV and desorption temperatures of 45, 27 and 25 K, respectively. The kinetics of filling of these states is almost similar for both faces, whereas the adsorption kinetics in the first monolayer is essentially different. A dissociative nature of adsorption at T >or approx. 5 K and a jump migration mechanism of the admolecules in the precursor state to the stationary adsorption sites are suggested
10 CFR 110.30 - Members of the Nuclear Suppliers Group.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Members of the Nuclear Suppliers Group. 110.30 Section 110.30 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND... Italy Japan Latvia Luxembourg Netherlands New Zealand Norway Poland Portugal Republic of Korea Romania...
Determination of the 1s-2s two-photon excitation cross-section in atomic hydrogen
Energy Technology Data Exchange (ETDEWEB)
Bickel, G.A.; McRae, G.A
2000-07-01
Hydrogen atoms are ablated from zirconium alloys into the gas phase by a pulsed Nd:YAG laser and photo-ionized with three photons at 243 nm via the two-photon 1s {sup 2}S{sub 1/2}-2s {sup 2}S{sub 1/2} resonant transition. A determination of the effective 1s-2s two-photon excitation cross-section is necessary to quantify the hydrogen atom density in the ablation plume. A measurement of the ion signal vs photo-ionization beam energy is fitted to an expression derived from the rate equations. The temporal and spatial properties of the photo-ionization laser beam, transit of the H atoms through the beam, and detector geometry are taken into account. The effective two-photon cross-section for this experimental configuration, derived with the rate equation formalism, is 3.3 {+-} 0.8 X 10{sup -28} cm{sup 4} W{sup -1}. This compares well with the ab initio prediction of 5 {+-} 1 X 10{sup -28} cm{sup 4} W{sup -1} under these experimental conditions. (author)
Determination of the 1s-2s two-photon excitation cross-section in atomic hydrogen
International Nuclear Information System (INIS)
Bickel, G.A.; McRae, G.A.
2000-01-01
Hydrogen atoms are ablated from zirconium alloys into the gas phase by a pulsed Nd:YAG laser and photo-ionized with three photons at 243 nm via the two-photon 1s 2 S 1/2 -2s 2 S 1/2 resonant transition. A determination of the effective 1s-2s two-photon excitation cross-section is necessary to quantify the hydrogen atom density in the ablation plume. A measurement of the ion signal vs photo-ionization beam energy is fitted to an expression derived from the rate equations. The temporal and spatial properties of the photo-ionization laser beam, transit of the H atoms through the beam, and detector geometry are taken into account. The effective two-photon cross-section for this experimental configuration, derived with the rate equation formalism, is 3.3 ± 0.8 X 10 -28 cm 4 W -1 . This compares well with the ab initio prediction of 5 ± 1 X 10 -28 cm 4 W -1 under these experimental conditions. (author)
Bis(1,10-phenanthroline-κ2N,N′(sulfato-κ2O,O′cobalt(II propane-1,3-diol solvate
Directory of Open Access Journals (Sweden)
Kai-Long Zhong
2010-03-01
Full Text Available The title compound, [Co(SO4(C12H8N22]·C3H8O2, was obtained unexpectedly as a by-product during an attempt to synthesize a mixed-ligand complex of CoII with 1,10-phenanthroline (phen and melamine via a solvothermal reaction. The CoII metal ions are in a distorted octahedral coordination environment formed by four N atoms from two chelating phen ligands and two O atoms from a bidentate sulfate ligand. The two chelating N2C2 groups are almost perpendicular to each other [dihedral angle = 80.06 (8°]. A twofold rotation axis passes through the Co and S atoms, and also through the central C atom of the propane-1,3-diol solvent molecule. Intermolecular O—H...O hydrogen bonds help to stabilize the structure.
Sample (S): SE57_S08 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available SE57_S08 Lotus japonicus (accessions B129 gifu and MG20 miyakojima) Lotus japonicus... NCBI taxonomy:34305 Lotus japonicus accessions were a gift from Dr. Toshio Aoki (Nihon University, Japan). ...
[Microcontroller temperature regulator MPT110 for drying-sterilizing cabinets].
Kostin, N N; Gavrishchuk, V I; Zelepukin, S A; Shkulepa, V M; Zharov, E N
2002-01-01
The paper describes a MPT-110 temperature microcontroller developed by the closed joint-stock company "OPLEKS" (Orel, Russia) and the results of comparative tests performed in the @IIICC-80 drying sterilizing cabinet. The use of the MPT-110 controller is shown to improve the quality of control and to shorten the times that is taken for the cabinet to reach the preset temperature point.
1982-05-01
Fub (1/281.l1) - aNg 0522 Web 73. 5 ftb l973. f 11IGAmclZ -.d HMIS 37.8U4ar w4, W4 .kh gad AM 3an of 62 011, I go. 130 get, eggect.~ I J1 1973. UOI&M...HQDA Records Managemet Divis ion TANSILS k The Adjutant General’s Office 9ATIH Zni:ENRYH Programs Branch Attn: DAAG-AE-P A NCV TAS a CV LIA OinCAL teo 5...srieas 128-09 Ikm f m HU f 6I Peolbd "A110 "M 6 CPO 001-13A RE&... T. ML AN*EE a mSm o fti oFdrlMsie oa 3. AGEJICt 11iesm OFFICIAL 48.. s Web DOO HQDA
49 CFR 110.90 - Grant monitoring, reports, and records retention.
2010-10-01
... TRANSPORTATION HAZARDOUS MATERIALS PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.90 Grant monitoring, reports... originally planned. (4) Financial reporting, except as provided in § 110.70 and 49 CFR 18.41, shall be... accordance with 49 CFR 18.42, all financial and programmatic records, supporting documents, statistical...
Directory of Open Access Journals (Sweden)
Jiongke Chen
2011-09-01
Full Text Available In the title complex, [Co(C12H8N23][CoI(C12H8N22(H2O][Bi3I12], conventionally abbreviated [Co(phen3][CoI(phen2(H2O][Bi3I12], where phen is 1,10-phenanthroline, the CoII atom in one cation is coordinated by six N atoms from three phen ligands in an octahedral coordination while the CoII atom in the other cation is coordinated octahedrally by four N atoms from two phen ligands, one water O atom and one I atom. In the anion, three BiIII ions adopt an octahedral coordination constructed by six I− ligands. The three BiI6 octahedra are fused together through trans face-sharing.
Abd El-Halim, Hanan F.; Mohamed, Gehad G.; Khalil, Eman A. M.
2017-10-01
A series of mixed ligand complexes were prepared from the Schiff base (L1) as a primary ligand, prepared by condensation of oxamide and furan-2-carbaldehyde, and 1,10-phenanthroline (1,10-phen) as a secondary ligand. The Schiff base ligand and its mixed ligand chelates were characterized based on elemental analysis, IR, 1H NMR, thermal analysis, UV-Visible, mass, molar conductance, magnetic moment. X-ray diffraction, solid reflectance and ESR also have been studied. The mixed ligand complexes were found to have the formulae of [M(L1) (1,10-phen)]Clm.nH2O (M = Cr(III) and Fe(III) (m = 3) (n = 0); M = Mn(II), Cu(II) and Cd(II) (m = 2) (n = 0); and M = Co(II) (m = 2) (n = 1), Ni(II) (m = 2) (n = 2) and Zn(II) (m = 2) (n = 3)) and that the geometrical structure of the complexes were octahedral. The parameters of thermodynamic using Coats-Redfern and Horowitz-Metzger equations were calculated. The synthesized Schiff base ligand, 1,10-phenanthroline ligand and Their mixed ligand complexes were also investigated for their antibacterial and antifungal activity against bacterial species (Gram-Ve bacteria: Pseudomonas aeruginosa and Escherichia coli) and (Gram + Ve bacteria: Bacillus subtilis and Streptococcus pneumonia) and fungi (Aspergillus fumigates and Candida albicans). The anticancer activity of the new compounds had been tested against breast (MFC7) and colon (HCT-116) cell lines. The results showed high activity for the synthesized compounds.
The trapping of K and Na atoms by a clean W(110) surface. Dynamic trajectory calculations. ch.3
International Nuclear Information System (INIS)
Hurkmans, A.; Overbosch, E.G.; Los, J.
1976-01-01
The fraction of K and Na atoms which are initially trapped by a clean W(110) surface has been measured as a function of incident energy (0.5 < approximately Esub(i) < approximately 15 eV) at several angles of incidence. At the same time the desorption energies Qsub(i) of the trapped potassium and sodium atoms were measured: Qsub(i) = 2.05 +- 0.02 eV and Qsub(i) = 2.60 +- 0.04 eV respectively. The measured trapping probabilities can be described well by Trillings 'partially screened spherical cap' model, except fos the small angles of incidence. Dynamic trajectory calculations were performed for a particle scattered from a diatomic molecule to explain the screening and the descrepancy at normal incidence. The calculations give good quantitative agreement with the measured trapping probability at small angles both for potassium and sodium atoms and show that simultaneous interaction with two adjacent surface atoms affects the trapping particularly at small angles of incidence. (Auth.)
30 CFR 260.110 - What bidding systems may MMS use?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What bidding systems may MMS use? 260.110 Section 260.110 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER... MMS use? We will apply a single bidding system selected from those listed in this section to each...
Graphite-(Mo,W)S2 intergrowth as a palaeoenvironmental proxy in metasedimentary rocks
Cabral, Alexandre Raphael; Zeh, Armin; da Silva Viana, Nívea Cristina; Schirmer, Thomas; Lehmann, Bernd
2017-12-01
Molybdenum enrichment in pristine organic-C-rich sedimentary rocks forms the basis for inferring the presence of dissolved oxygen in seawater. Organic matter removes dissolved hexavalent Mo from seawater where anoxic and euxinic conditions are attained. However, it is unknown whether this Mo-based proxy is retained under metamorphic conditions where organic C is no longer preserved. Here, we describe aggregates of graphite and molybdenite (MoS2) containing up to 21 mass per cent of W as tungstenite (WS2) in solid solution. These aggregates are disseminated in a sulfide-rich Mn-silicate-carbonate rock (queluzite), metamorphosed under amphibolite-facies conditions within the Archaean Barbacena greenstone belt in Minas Gerais, Brazil. Our finding indicates that: (i) W is, like Mo, a palaeoenvironmental proxy; (ii) the W proxy is sensitive to high fS2/fO2 environments; (iii) both Mo and W proxies survive amphibolite-facies overprint as (Mo,W)S2 intergrown with graphite. Archaean greenstones are potential candidates for storing palaeoenvironmental information as (Mo,W)S2-graphite intergrowths.
Energy Technology Data Exchange (ETDEWEB)
Alves, Laís Nascimento
2017-07-01
With the rising incidence of cancer and this disease as global public health dilemma, there is an alarming need of studying new cancer therapies. To achieve the development of efficient agents is essential to understand the fundamental mechanisms of carcinogenesis and tumor progression. Overexpression of proteins in malignant tissues, in contrast to expression of the proteins found in normal tissues of the same organ, is crucially important and of great interest for the characterization of potential tumor biomarkers. Following this premise, MUC1 glycoprotein was selected as a therapeutic target in a breast cancer model. In order to determine the viability of the aptA aptamer as radiosensitizers carrier, the toxic compound 1,10 phenanthroline, complexed with Fe(II) was intercalated in the aptamers. The dissociation constant was found at a value of Kd = 30 μM. The selective binding and internalization of the compound was demonstrated. Based on these data, the aptA can be used as carrying vector of molecules such as 1,10-phenanthroline. As a next stage, the evaluation of its in vitro potential as radiosensitizers with the use of ionizing radiation will be done. (author)
International Nuclear Information System (INIS)
Stephenson, J.D.; Kelhae, V.; Tilli, M.; Tuomi, T.
1978-01-01
'White' synchrotron radiation topography has been employed to reconstruct almost complete, though slightly shape distorted topographs of polycrystalline samples. Those used in the experiments were commercial (110) Fe-3wt%Si crystals containing several misorientated subgrains and were of thickness between 0.15 and 0.20 mm. The topographs were reassembled 'jig-saw puzzle' fashion from photographically enlarged subgrain mini-topographs located near the centres of each film. Magnetic domains were observed in several subgrain topographs recorded in the Laue-reflection and Laue-transmission modes. The technique emphasizes one of the advantages in using 'white' synchrotron radiation to produce rapid high resolution topographs of polycrystalline samples in relatively hazard free radiation conditions. (Auth.)
International Nuclear Information System (INIS)
Weng, S.
1982-01-01
The chemisorption of H on W(110) at room temperature is studied with the use of angle-integrated photoemission and electron-stimulated desorption (ESD). The ESD cross sections of H + are found to be sol low that no significant H + signals with meaningful ion energy distributions are observed. The photoemission results show, however, two types of H adatoms, referred to as β 2 and β 1 states, for this chemisorptive system. Both states are found to appear simultaneously rather than sequentially as suggested by previous studies, and exhibit a simple 1-theta adsorption kinetics with different initial sticking coefficients. The β 2 state induces two binding energy levels at -2.0 and -6.0 eV, respectively, whereas the β 1 state induces a level at -3.8 eV. The work-function change (with a maximum value of -0.45 eV) is found to follow exactly with the intensity of the β 2 state. These results are found to be compatible with the two-binding-site model, inherently suggested by the reflection high-enery electron-diffraction data. However, the results can also be consistent with a single-binding-site model suggested by a recent angle-resolved photoemission and inelastic electron scattering study. A model based on the present results is proposed and critically compared with previous studies. Unresolved problems associated with both single- and two-binding-site models are also discussed
Tailored TiO2(110) surfaces and their reactivity
International Nuclear Information System (INIS)
Pang, C L; Bikondoa, O; Humphrey, D S; Papageorgiou, A C; Cabailh, G; Ithnin, R; Chen, Q; Muryn, C A; Onishi, H; Thornton, G
2006-01-01
Electron bombardment from a filament as well as voltage pulses from a scanning tunnelling microscope tip have been employed to modify the surface of TiO 2 (110). Individual H atoms are selectively desorbed with electrical pulses of +3 V from the scanning tunnelling microscope tip, whilst leaving the oxygen vacancies intact. This allows us to distinguish between oxygen vacancies and hydroxyl groups, which have a similar appearance in scanning tunnelling microscopy images. This then allows the oxygen vacancy-promoted dissociation of water and O 2 to be followed with the microscope. Electrical pulses between +5 and +10 V induce local TiO 2 (110)1 x 2 reconstructions centred around the pulse. As for electron bombardment of the surface, relatively low fluxes increase the density of oxygen vacancies whilst higher fluxes lead to the 1 x 2 and other 1 x n reconstructions
The effect of feeding Bt MON810 maize to pigs for 110 days on intestinal microbiota.
Directory of Open Access Journals (Sweden)
Stefan G Buzoianu
Full Text Available OBJECTIVE: To assess the effects of feeding Bt MON810 maize to pigs for 110 days on the intestinal microbiota. METHODOLOGY/PRINCIPAL FINDINGS: Forty male pigs (∼40 days old were blocked by weight and litter ancestry and assigned to one of four treatments; 1 Isogenic maize-based diet for 110 days (Isogenic; 2 Bt maize-based diet (MON810 for 110 days (Bt; 3 Isogenic maize-based diet for 30 days followed by a Bt maize-based diet for 80 days (Isogenic/Bt; 4 Bt maize-based diet for 30 days followed by an isogenic maize-based diet for 80 days (Bt/Isogenic. Enterobacteriaceae, Lactobacillus and total anaerobes were enumerated in the feces using culture-based methods on days 0, 30, 60 and 100 of the study and in ileal and cecal digesta on day 110. No differences were found between treatments for any of these counts at any time point. The relative abundance of cecal bacteria was also determined using high-throughput 16 S rRNA gene sequencing. No differences were observed in any bacterial taxa between treatments, with the exception of the genus Holdemania which was more abundant in the cecum of pigs fed the isogenic/Bt treatment compared to pigs fed the Bt treatment (0.012 vs 0.003%; P≤0.05. CONCLUSIONS/SIGNIFICANCE: Feeding pigs a Bt maize-based diet for 110 days did not affect counts of any of the culturable bacteria enumerated in the feces, ileum or cecum. Neither did it influence the composition of the cecal microbiota, with the exception of a minor increase in the genus Holdemania. As the role of Holdemania in the intestine is still under investigation and no health abnormalities were observed, this change is not likely to be of clinical significance. These results indicate that feeding Bt maize to pigs in the context of its influence on the porcine intestinal microbiota is safe.
International Nuclear Information System (INIS)
Linderoth, T R; Horch, S; Petersen, L; Laegsgaard, E; Stensgaard, I; Besenbacher, F
2005-01-01
The technique of scanning tunnelling microscopy (STM) uniquely allows dynamic processes on surfaces to be followed directly in real space and at atomic resolution. Results for the 551225 surface diffusion of Pt adatoms and clusters on the anisotropic, missing row reconstructed Pt(110)-(1 x 2) surface are briefly reviewed. Mass transport in this system is entirely one-dimensional (1D) since, at low adatom coverage, atoms and clusters are confined to the missing row troughs. In this paper, we therefore address the question if Pt/Pt(110)-(1 x 2) is a 1D model system to study late stage growth phenomena such as island ripening? From STM measurements, we quantify the morphology changes resulting from annealing a surface configuration with small 1D Pt islands in the missing row troughs to temperatures in the interval 369-395 K. Interestingly, the resulting increase in island sizes (ripening) cannot be accounted for by the known island and adatom mobilities within a 1D model. An explanation is provided from dynamic, time-resolved 'STM-movies' that directly reveal two novel island-mediated mechanisms for inter-trough mass transport which cause the Pt/Pt(110)-(1 x 2) system not to be purely 1D at the higher surface coverage used in the annealing experiments
Perspective: A controversial benchmark system for water-oxide interfaces: H2O/TiO2(110)
Diebold, Ulrike
2017-07-01
The interaction of water with the single-crystalline rutile TiO2(110) surface has been the object of intense investigations with both experimental and computational methods. Not only is TiO2(110) widely considered the prototypical oxide surface, its interaction with water is also important in many applications where this material is used. At first, experimental measurements were hampered by the fact that preparation recipes for well-controlled surfaces had yet to be developed, but clear experimental evidence that water dissociation at defects including oxygen vacancies and steps emerged. For a perfect TiO2(110) surface, however, an intense debate has evolved whether or not water adsorbs as an intact molecule or if it dissociates by donating a proton to a so-called bridge-bonded surface oxygen atom. Computational studies agree that the energy difference between these two states is very small and thus depends sensitively on the computational setup and on the approximations used in density functional theory (DFT). While a recent molecular beam/STM experiment [Z.-T. Wang et al., Proc. Natl. Acad. Sci. U. S. A. 114(8), 1801-1805 (2017)] gives conclusive evidence for a slight preference (0.035 eV) for molecular water and a small activation energy of (0.36 eV) for dissociation, understanding the interface between liquid water and TiO2(110) arises as the next controversial frontier.
Facile Dehydrogenation of Ethane on the IrO2(110) Surface.
Bian, Yingxue; Kim, Minkyu; Li, Tao; Asthagiri, Aravind; Weaver, Jason F
2018-02-21
Realizing the efficient and selective conversion of ethane to ethylene is important for improving the utilization of hydrocarbon resources, yet remains a major challenge in catalysis. Herein, ethane dehydrogenation on the IrO 2 (110) surface is investigated using temperature-programmed reaction spectroscopy (TPRS) and density functional theory (DFT) calculations. The results show that ethane forms strongly bound σ-complexes on IrO 2 (110) and that a large fraction of the complexes undergo C-H bond cleavage during TPRS at temperatures below 200 K. Continued heating causes as much as 40% of the dissociated ethane to dehydrogenate and desorb as ethylene near 350 K, with the remainder oxidizing to CO x species. Both TPRS and DFT show that ethylene desorption is the rate-controlling step in the conversion of ethane to ethylene on IrO 2 (110) during TPRS. Partial hydrogenation of the IrO 2 (110) surface is found to enhance ethylene production from ethane while suppressing oxidation to CO x species. DFT predicts that hydrogenation of reactive oxygen atoms of the IrO 2 (110) surface effectively deactivates these sites as H atom acceptors, and causes ethylene desorption to become favored over further dehydrogenation and oxidation of ethane-derived species. The study reveals that IrO 2 (110) exhibits an exceptional ability to promote ethane dehydrogenation to ethylene near room temperature, and provides molecular-level insights for understanding how surface properties influence selectivity toward ethylene production.
High-temperature air oxidation of E110 and Zr-1%Nb alloys claddings with coatings
International Nuclear Information System (INIS)
Kuprin, A.S.; Belous, V.A.; Voyevodin, V.N.; Bryk, V.V.; Vasilenko, R.L.; Ovcharenko, V.D.; Tolmachova, G.N.; V'yugov, P.N.
2014-01-01
Results of experimental study of the influence of protective vacuum-arc claddings on the base of compounds zirconium-chromium and of its nitrides on air oxidation resistance at temperatures 660, 770, 900, 1020, 1100 deg C during 3600 s. of tubes produced of zirconium alloys E110 and Zr-1%Nb (calcium-thermal alloy of Ukrainian production) are presented. Change of hardness, the width of oxide layer and depth of oxygen penetration into alloys from the side of coating and without coating are investigated by the methods of nanoindentation and by scanning electron microscopy. It is shown that the thickness of oxide layer in zirconium alloys at temperatures 1020 and 1100 deg C from the side of the coating doesn't exceed 5 μm, and from the unprotected side reaches the value of ≥ 120 μm with porous and rough structure. Tubes with coatings save their shape completely independently of the type of alloy; tubes without coatings deform with the production of through cracks
2,9-Dimethyl-1,10-phenanthrolin-1-ium tetrachloridoferrate(III methanol monosolvate
Directory of Open Access Journals (Sweden)
Ehsan Bahojb Noruzi
2012-07-01
Full Text Available In the title compound, (C14H13N2[FeCl4]·CH3OH, the 2,9-dimethyl-1,10-phenanthrolin-1-ium cation, FeCl4− anion and methanol solvent molecule lie on a twofold rotation axis. Due to symmetry, the H atom on the N atom of the cation is half-occupied. In the anion, the FeIII atom has a tetrahedral geometry. H atoms of the methanol molecule are disordered over two sets of sites around the twofold axis. In the crystal, π–π contacts between the pyridine rings and between the pyridine and benzene rings [centroid–centroid distances = 3.6535 (16 and 3.5522 (17 Å] and intermolecular O—H...N and N—H...O hydrogen bonds stabilize the structure.
Hildebrand, Alexandra; Lönnecke, Peter; Silaghi-Dumitrescu, Luminita; Hey-Hawkins, Evamarie
2008-09-14
PhP(2-SHC6H4)2 (PS2H2) reacts with WCl6 with reduction of tungsten to give the air-sensitive tungsten(IV) complex [W{PhP(2-SC6H4)2-kappa(3)S,S',P}2] (1). 1 is oxidised in air to [WO{PhPO(2-SC6H4)2-kappa(3)S,S',O}{PhP(2-SC6H4)2-kappa(3)S,S',P}] (2). The attempted synthesis of 2 by reaction of 1 with iodosobenzene as oxidising agent was unsuccessful. [W{P(2-SC6H4)3-kappa(4)S,S',S",P}2] (3) was formed in the reaction of P(2-SHC6H4)3 (PS3H3) with WCl6. The W(VI) complex 3 contains two PS3(3-) ligands, each coordinated in a tetradentate fashion resulting in a tungsten coordination number of eight. The reaction of 3 with AgBF4 yields the dinuclear tungsten complex [W2{P(2-SC6H4)3-kappa(4)S,S',S",P}3]BF4 (4). Complexes 1-4 were characterised by spectral methods and X-ray structure determination.
24 CFR 811.110 - Refunding of obligations issued to finance Section 8 projects.
2010-04-01
... finance Section 8 projects. 811.110 Section 811.110 Housing and Urban Development Regulations Relating to... RELATED AMENDMENTS § 811.110 Refunding of obligations issued to finance Section 8 projects. (a) This... refunding which generate the McKinney Act savings and, if necessary, HUD will finance in refunding bond debt...
Metabolism of 181W - labeled sodium tungstate in goats
International Nuclear Information System (INIS)
Ekman, L.; Figueiras, H.D.; Jones, B.E.V.; Myamoto, S.
1977-11-01
Radiotungsten was given as Na 2 181 WO 4 orally to 4 goats and intravenously to 3 goats. Blood, milk, urine and faeces were collected regularly during an 8-day period. Thereafter the animals were slaughtered and different tissues were taken for analyses of 181 W. The data obtained suggest that radiotungsten is unlikely to be a significant environmental pollutant source for man, as far as its concentration in milk and meat are concerned
Surface atomic relaxation and magnetism on hydrogen-adsorbed Fe(110) surfaces from first principles
Energy Technology Data Exchange (ETDEWEB)
Chohan, Urslaan K.; Jimenez-Melero, Enrique [School of Materials, The University of Manchester, Manchester M13 9PL (United Kingdom); Dalton Cumbrian Facility, The University of Manchester, Moor Row CA24 3HA (United Kingdom); Koehler, Sven P.K., E-mail: sven.koehler@manchester.ac.uk [Dalton Cumbrian Facility, The University of Manchester, Moor Row CA24 3HA (United Kingdom); School of Chemistry, The University of Manchester, Manchester M13 9PL (United Kingdom); Photon Science Institute, The University of Manchester, Manchester M13 9PL (United Kingdom)
2016-11-30
Highlights: • Potential energy surfaces for H diffusion on Fe(110) calculated. • Full vibrational analysis of surface modes performed. • Vibrational analysis establishes lb site as a transition state to the 3f site. • Pronounced buckling observed in the Fe surface layer. - Abstract: We have computed adsorption energies, vibrational frequencies, surface relaxation and buckling for hydrogen adsorbed on a body-centred-cubic Fe(110) surface as a function of the degree of H coverage. This adsorption system is important in a variety of technological processes such as the hydrogen embrittlement in ferritic steels, which motivated this work, and the Haber–Bosch process. We employed spin-polarised density functional theory to optimise geometries of a six-layer Fe slab, followed by frozen mode finite displacement phonon calculations to compute Fe–H vibrational frequencies. We have found that the quasi-threefold (3f) site is the most stable adsorption site, with adsorption energies of ∼3.0 eV/H for all coverages studied. The long-bridge (lb) site, which is close in energy to the 3f site, is actually a transition state leading to the stable 3f site. The calculated harmonic vibrational frequencies collectively span from 730 to 1220 cm{sup −1}, for a range of coverages. The increased first-to-second layer spacing in the presence of adsorbed hydrogen, and the pronounced buckling observed in the Fe surface layer, may facilitate the diffusion of hydrogen atoms into the bulk, and therefore impact the early stages of hydrogen embrittlement in steels.
Energy Technology Data Exchange (ETDEWEB)
Fadieiev, Yevhen M.; Smola, Sergii S. [A.V. Bogatsky Physico-chemical Institute, National Academy of Sciences of Ukraine, 86, Lustdorfskaya doroga, 65080 Odessa (Ukraine); Malinka, Elena V. [Odessa National Academy of Food Technology, 112, Kanatna Street, 65039 Odessa (Ukraine); Rusakova, Nataliia V., E-mail: lanthachem@ukr.net [A.V. Bogatsky Physico-chemical Institute, National Academy of Sciences of Ukraine, 86, Lustdorfskaya doroga, 65080 Odessa (Ukraine)
2017-03-15
Hybrid organic-inorganic materials based on silica and mixed-ligand complexes of Eu(III) with β-diketones and 1,10-phenanthroline with covalent and non-covalent attachment to matrix were obtained by a sol-gel route. Luminescent study of obtained systems allowed to propose spectral criteria for estimation of the uniformity of complex distribution in amorphous silica matrix. Thus, such criteria are the broadening of Eu(III) 4f-luminescence bands, emission decay and the shape of plot of the emission intensity vs. concentration of complex in the materials. Full width of {sup 5}D{sub 0}→{sup 7}F{sub 2} band at its half maximum and the ratio of the {sup 5}D{sub 0}→{sup 7}F{sub 2} and {sup 5}D{sub 0}→{sup 7}F{sub 1} bands intensities were used as quantitative measures of spectral changes and the bands broadening in Eu(III) emission spectra. - Highlights: • Modification of Eu(III) β-diketonates by an anchor fragments was carried out. • The degree of association of molecules was estimated based on emission spectra. • Covalent anchoring of complexes promotes their uniform distribution in matrix. • Non-covalently grafted complexes are prone to association in amorphous silica.
Edwards, Alyn C; Mocilac, Pavle; Geist, Andreas; Harwood, Laurence M; Sharrad, Clint A; Burton, Neil A; Whitehead, Roger C; Denecke, Melissa A
2017-05-02
The first hydrophilic, 1,10-phenanthroline derived ligands consisting of only C, H, O and N atoms for the selective extraction of Am(iii) from spent nuclear fuel are reported herein. One of these 2,9-bis-triazolyl-1,10-phenanthroline (BTrzPhen) ligands combined with a non-selective extracting agent, was found to exhibit process-suitable selectivity for Am(iii) over Eu(iii) and Cm(iii), providing a clear step forward.
Energy levels, radiative rates, and lifetimes for transitions in W XL
International Nuclear Information System (INIS)
Aggarwal, Kanti M.; Keenan, Francis P.
2014-01-01
Energy levels and radiative rates are reported for transitions in Br-like tungsten, W XL, calculated with the general-purpose relativistic atomic structure package (GRASP). Configuration interaction (CI) has been included among 46 configurations (generating 4215 levels) over a wide energy range up to 213 Ryd. However, for conciseness results are only listed for the lowest 360 levels (with energies up to ∼43 Ryd), which mainly belong to the 4s 2 4p 5 ,4s 2 4p 4 4d,4s 2 4p 4 4f,4s4p 6 ,4p 6 4d,4s4p 5 4d,4s 2 4p 3 4d 2 , and 4s 2 4p 3 4d4f configurations, and provided for four types of transitions, E1, E2, M1, and M2. Comparisons are made with existing (but limited) results. However, to fully assess the accuracy of our data, analogous calculations have been performed with the flexible atomic code, including an even larger CI than in GRASP. Our energy levels are estimated to be accurate to better than 0.02 Ryd, whereas results for radiative rates (and lifetimes) should be accurate to better than 20% for a majority of the strong transitions
HKUST-1 Membranes Anchored on Porous Substrate by Hetero MIL-110 Nanorod Array Seeds.
Mao, Yiyin; Cao, Wei; Li, Junwei; Sun, Luwei; Peng, Xinsheng
2013-09-02
Great anchors and seeds: Hetero-seeding growth processes and anchored nanorod arrays were successfully utilized in the synthesis of HKUST-1 membranes. These arrays were firmly anchored on porous substrates by using a MIL-110 nanorod array as both the anchor and seed. The resulting HKUST-1 membranes demonstrated good separation factors for binary gases exceeding the Knudson selectivity. Copyright © 2013 WILEY‐VCH Verlag GmbH & Co. KGaA, Weinheim.
42 CFR 415.110 - Conditions for payment: Medically directed anesthesia services.
2010-10-01
... anesthesia services. 415.110 Section 415.110 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... directed anesthesia services. (a) General payment rule. Medicare pays for the physician's medical direction of anesthesia services for one service or two through four concurrent anesthesia services furnished...
45 CFR 2490.110 - Self-evaluation.
2010-10-01
... Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.110 Self-evaluation. (a) The agency shall, by November 28...
45 CFR 1706.110 - Self-evaluation.
2010-10-01
... Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the effects thereof...
High-K structures in {sup 180}W and {sup 181}W
Energy Technology Data Exchange (ETDEWEB)
Yeung, K C; Walker, P M; Singleton, B D.D. [Surrey Univ., Guildford (United Kingdom). Dept. of Physics; Urban, W; Lisle, J C; Copnell, J; Mo, J N [Manchester Univ. (United Kingdom). Schuster Lab.; Joyce, M J [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Gjorup, N L; Sletten, G [Risoe National Lab., Roskilde (Denmark)
1992-08-01
In each of the prolate-deformed isotopes {sup 180}W and {sup 181}W, a very high-K non-collective state has been found which decays directly into the corresponding collective ground-state rotational band. There is complete breakdown of the K-selection rule, in contrast to the partial breakdown observed recently in {sup 174}Hf and {sup 182}Os. Nevertheless, the non-collective states themselves retain characteristics associated with a prolate axially symmetric shape, implying that K is still a useful quantum number. (author). 17 refs., 2 figs.
Electrical properties of NiAs-type MnTe films with preferred crystallographic plane of (110)
Energy Technology Data Exchange (ETDEWEB)
Yang, L.; Wang, Z. H., E-mail: zhwang@imr.ac.cn; Zhang, Z. D. [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China)
2016-01-28
NiAs-type manganese telluride (MnTe) films with preferred crystallographic plane of (110) were prepared on Si/SiO{sub 2} substrates by pulsed laser deposition. X-ray diffraction (XRD) of the films was studied at different temperatures. The XRD peak of MnTe (110) films shifts to higher angle with decreasing temperature, showing the decrease of the lattice parameter. Resistivity of the films was studied in the temperature range of 2–350 K. The bump between 150 and 250 K was observed in the films, which may be related to the special s-d and p-d overlaps induced by the compressed lattice. The magnon drag effect near its Néel temperature T{sub N} and enlarged magnetic-elastic coupling below 100 K were observed and analyzed in details.
A 110-ms pulsar, with negative period derivative, in the global cluster M15
International Nuclear Information System (INIS)
Wolszczan, A.; Kulkarni, S.R.; Middleditch, J.; Backer, D.C.; Fruchter, A.S.; Dewey, R.J.
1989-01-01
We report the discovery of a 110-ms pulsar, PSR2127 + 11, in the globular cluster M15 (NGC7078). The results of nine months of timing measurements place the new pulsar about 2'' from the centre of the cluster, and indicate that it is not a member of a close binary system. The measured negative value of the period derivative, P ∼-2 x 10 -17 s s -1 , is probably the result of the pulsar being bodily accelerated in our direction by the gravitational field of the collapsed core of M15. Although PSR2127 + 11 has an unexpectedly long period, we argue that it belongs to the class of 'recycled' pulsars, which have been spun up by accretion in a binary system. (author)
Feng, Nan; Mi, Wenbo; Cheng, Yingchun; Guo, Zaibing; Schwingenschlö gl, Udo; Bai, Haili
2014-01-01
Using first-principles calculations, we have investigated the electronic structure and magnetic properties of Fe-X 6 clusters (X = S, C, N, O, and F) incorporated in 4 4 monolayer MoS 2, where a Mo atom is substituted by Fe and its nearest S atoms are substituted by C, N, O, and F. Single Fe and Fe-F 6 substituions make the system display half-metallic properties, Fe-C 6 and Fe-N 6 substitutions lead to a spin gapless semiconducting behavior, and Fe-O 6 doped monolayer MoS 2 is semiconducting. Magnetic moments of 1.93, 1.45, 3.18, 2.08, and 2.21...? B are obtained for X = S, C, N, O, and F, respectively. The different electronic and magnetic characters originate from hybridization between the X and Fe/Mo atoms. Our results suggest that cluster doping can be an efficient strategy for exploring two-dimensional diluted magnetic semiconductors.
Feng, Nan
2014-02-05
Using first-principles calculations, we have investigated the electronic structure and magnetic properties of Fe-X 6 clusters (X = S, C, N, O, and F) incorporated in 4 4 monolayer MoS 2, where a Mo atom is substituted by Fe and its nearest S atoms are substituted by C, N, O, and F. Single Fe and Fe-F 6 substituions make the system display half-metallic properties, Fe-C 6 and Fe-N 6 substitutions lead to a spin gapless semiconducting behavior, and Fe-O 6 doped monolayer MoS 2 is semiconducting. Magnetic moments of 1.93, 1.45, 3.18, 2.08, and 2.21...? B are obtained for X = S, C, N, O, and F, respectively. The different electronic and magnetic characters originate from hybridization between the X and Fe/Mo atoms. Our results suggest that cluster doping can be an efficient strategy for exploring two-dimensional diluted magnetic semiconductors.
40 CFR 5.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
.... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... self-evaluation. 5.110 Section 5.110 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...
13 CFR 113.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...
36 CFR 1211.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
... action and self-evaluation. 1211.110 Section 1211.110 Parks, Forests, and Public Property NATIONAL ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... affirmative action and self-evaluation. (a) Remedial action. If the designated agency official finds that a...
Measurements of the mass of the W boson in the W+W- → qq-barqq-bar channel with the ALEPH detector
International Nuclear Information System (INIS)
Chalmers, M.D.K.
1999-12-01
A measurement of the mass of the W boson from e + e - → W + W - → qq-barqq-bar events is presented, from LEP data collected at √s = 189 GeV during 1998 with the ALEPH detector. The procedure of direct reconstruction of the W + W - final state invariant mass distribution is adopted, with an optimisation of the event selection and jet clustering algorithms. A two dimensional Monte Carlo reweighting technique is used to extract the W mass and a full discussion of the systematic uncertainties is given. The W mass is measured to be: M W = 80.556 ± 0.110(stat.) ± 0.039(syst.) ± 0.056(F.S.I.) ± 0.017(LEP) GeV/c 2 . A new technique for extracting the W mass using a two dimensional Kolmogorov Smirnov test is introduced. The W mass using this method is measured to be: M W KS = 80.423 ± 0.160(expected stat.) GeV/c 2 , which is compared with that from the method of maximum likelihood. Rigorous optimisation and stability checks on the W mass estimator and its error are presented, and the result put into the context of a LEP and subsequently world average value: M W world = 80.394 ± 0.042 GeV/c 2 . The implications of this result are interpreted by comparing it with the indirect W mass measurement from the Standard Model prediction: M W indirect = 80.381 ± 0.026 GeV/c 2 . A discussion and outlook for the W mass measurement at LEP is given. (author)
Photoelectron spectrometry of manganese vapor between 12 and 110 eV
International Nuclear Information System (INIS)
Krause, M.O.; Carlson, T.A.; Fahlman, A.
1984-01-01
The important dynamic parameters, partial photoionization cross section sigma and angular distribution parameter β, have been determined for atomic Mn between 12 and 110 eV by electron spectroscopy with synchrotron radiation (ESSR). The single-electron photolines from the 3d and 4s subshells and the associated two-electron satellite lines were measured, and the resonance region of 3p→3d excitation around 50 eV was studied in detail. Absolute partial cross sections were derived. For the 3d-subshell properties, we find good agreement with the many-body perturbation-theory calculation (MBPT) by Garvin et al. over the entire energy range and with the random-phase-approximation results by Amusia et al. over the 3p resonance region. Available calculation (MBPT) underestimates the enhancement of sigma(4s) through the 3p resonance. Where overlap exists, the experimental data by Bruhn et al. and by Kobrin et al. agree well with our results. The work on Mn, taken in toto, provides a good overall understanding of the photoionization dynamics of the 3d transition series element Mn, which has a half-filled subshell, although a number of problems, e.g., two- and three-electron transitions and the low-energy region, remain to be further studied. A need for an accurate determination (5--10%) of the total photoabsorption cross section is indicated
Electrochemical cleaning of Sv-08G2S wire surface
International Nuclear Information System (INIS)
Kozlov, E.I.; Degtyarev, V.G.; Novikov, M.P.
1981-01-01
Results of industrial tests of the Sv-08G2S wire with different state of surface fwith technological lubrication, after mechanical cleaning, with electrochemically cleaned surface) are presented. Advantages of welding-technological properties of the wire with electroe chemically cleaned surface are shown. An operation principle of the electrochemical cleaning facility is described. A brief specf ification f of the facility is given [ru
7 CFR 1710.110 - Supplemental financing.
2010-01-01
... and Basic Policies § 1710.110 Supplemental financing. (a) Except in the case of financial hardship as determined by the Administrator, and following certain mergers, consolidations, and transfers of systems... merger, consolidation, or transfer of system substantially in its entirety, and the provisions of 7 CFR...
12 CFR 1815.110 - Categorical exclusion.
2010-01-01
... permanent capital and/or liquidity of an applicant; (m) Actions where no use of Federal funds is involved in....110 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY... EIS or environmental assessment if the designated Fund official determines it meets the criteria...
22 CFR 208.110 - What is the purpose of the nonprocurement debarment and suspension system?
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What is the purpose of the nonprocurement debarment and suspension system? 208.110 Section 208.110 Foreign Relations AGENCY FOR INTERNATIONAL... the nonprocurement debarment and suspension system? (a) To protect the public interest, the Federal...
31 CFR 28.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
..., 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall, within... self-evaluation. 28.110 Section 28.110 Money and Finance: Treasury Office of the Secretary of the Treasury NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL...
45 CFR 618.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... 45 Public Welfare 3 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 618.110 Section 618.110 Public Welfare Regulations Relating to Public Welfare (Continued...
45 CFR 2555.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... 45 Public Welfare 4 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 2555.110 Section 2555.110 Public Welfare Regulations Relating to Public Welfare (Continued...
24 CFR 3.110 - Remedial and affirmative action and self-evaluation.
2010-04-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... self-evaluation. 3.110 Section 3.110 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR...
18 CFR 1317.110 - Remedial and affirmative action and self-evaluation.
2010-04-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... affirmative action and self-evaluation. 1317.110 Section 1317.110 Conservation of Power and Water Resources TENNESSEE VALLEY AUTHORITY NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...
38 CFR 23.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... action and self-evaluation. 23.110 Section 23.110 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...
110 °C range athermalization of wavefront coding infrared imaging systems
Feng, Bin; Shi, Zelin; Chang, Zheng; Liu, Haizheng; Zhao, Yaohong
2017-09-01
110 °C range athermalization is significant but difficult for designing infrared imaging systems. Our wavefront coding athermalized infrared imaging system adopts an optical phase mask with less manufacturing errors and a decoding method based on shrinkage function. The qualitative experiments prove that our wavefront coding athermalized infrared imaging system has three prominent merits: (1) working well over a temperature range of 110 °C; (2) extending the focal depth up to 15.2 times; (3) achieving a decoded image being approximate to its corresponding in-focus infrared image, with a mean structural similarity index (MSSIM) value greater than 0.85.
A comparative DFT study on the dehydrogenation of methanol on Rh(100) and Rh(110)
Zhang, Minhua; Wu, Xingyu; Yu, Yingzhe
2018-04-01
Numerous density functional theory calculations have been performed to investigate the complete mechanisms of methanol dehydrogenation on Rh(100) and Rh(110) surfaces. The adsorption properties of relevant species were discussed in details. In addition, a comprehensive reaction network including four reaction pathways was built and analyzed. It is found that the initial Osbnd H bond scission of CH3OH seems to be more favorable than Csbnd H bond cleavage on both Rh(100) and Rh(110) surfaces from the perspective of activation barriers. It is also concluded that path1 (CH3OH → CH3O → CH2O → CHO → CO) is the predominant pathway on both Rh(100) and Rh (110) surfaces. On the whole, in most of the dehydrogenation reactions investigated, the energy barriers on Rh(100) are lower than those on Rh (110). Remarkable differences in the activity and predominant reaction pathway on Rh(100), Rh(110) and Rh(111) indicate that the dehydrogenation of methanol might be structure-sensitive.
33 CFR 110.232 - Southeast Alaska.
2010-07-01
... explosives anchorage. (5) A wooden vessel must: (i) Be fitted with a radar reflector screen of metal of sufficient size to permit target indication on the radar screen of commercial type radar; or (ii) Have steel... 110.232 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES...
45 CFR 1181.110 - Self-evaluation.
2010-10-01
... HUMANITIES INSTITUTE OF MUSEUM AND LIBRARY SERVICES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE INSTITUTE OF MUSEUM AND LIBRARY SERVICES § 1181.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the...
Directory of Open Access Journals (Sweden)
Ruslin Hadanu
2010-06-01
Full Text Available Quantitative Electronic Structure-Activity Relationship (QSAR analysis of a series of 1,10-phenanthroline derivatives as antiplasmodial compounds have been conducted using atomic net charges (q, dipole moment (μ ELUMO, EHOMO, polarizability (α and log P as the descriptors. The descriptors were obtained from computational chemistry method using semi-empirical PM3. Antiplasmodial activities were taken as the activity of the drugs against chloroquine-resistant Plasmodium falciparum FCR3 strain and are presented as the value of ln (1/IC50 where IC50 is an effective concentration inhibiting 50% of the parasite growth. The best model of QSAR model was determine by multiple linear regression method and giving equation of QSAR: ln 1/IC50 = 3.732 + (5.098 qC5 + (7.051 qC7 + (36.696 qC9 + (41.467 qC11 -(135.497 qC12 + (0.332 μ - (0.170 α + (0.757 log P. The equation was significant on the 95% level with statistical parameters: n=16; r=0.987; r2= 0.975; SE=0.317; Fcalc/Ftable = 15.337 and gave the PRESS=0.707. Its means that there were only a relatively few deviations between the experimental and theoretical data of antimalarial activity. Keywords: QSAR, antimalarial, semi-empirical method, 1,10-phenanthroline.
Spin transport anisotropy in (110)GaAs
Energy Technology Data Exchange (ETDEWEB)
Odilon, D.D.C. Jr.; Rudolph, Joerg; Hey, Rudolf; Santos, Paulo V. [Paul-Drude-Institut fuer Festkoerperelektronik, Berlin (Germany); Iikawa, Fernando [Universidade Estadual de Campinas, IFGW, Campinas SP (Brazil)
2007-07-01
Mobile piezoelectric potentials are used to coherently transport electron spins in GaAs(110) quantum wells (QW) over distances exceeding 60{mu}m. We demonstrate that the dynamics of mobile spins under external magnetic fields depends on the direction of motion in the QW plane. The weak piezoelectric fields impart a non-vanishing average velocity to the carriers, allowing for the direct observation of the carrier momentum dependence of the spin polarization dynamics. While transport along [001] direction presents high in-plane spin relaxation rates, transport along [ anti 110] shows a much weaker external field dependence due to the non-vanishing internal magnetic field. We show that the anisotropy is an intrinsic property of the underling GaAs matrix, associated with the bulk inversion asymmetry contribution to the LS-coupling.
Machonis, Philip R; Jones, Matthew A; Kwik-Uribe, Catherine; Dowell, Dawn
2014-01-01
Single-laboratory validation data were reviewed by the Expert Review Panel (ERP) of the Stakeholder Panel on Strategic Food Analytical Methods at the AOAC Mid-Year Meeting, March 12-14, 2013, in Rockville, MD. The ERP determined that the data presented met established standard method performance requirements and adopted a method for determination of flavanols and procyanidins (DP 1-10) in cocoa-based ingredients and products by ultra-HPLC as AOAC Official First Action Method 2013.03 on March 14, 2013. The flavanols and procyanidins (DP 1-10) are eluted using a binary gradient (solvents A and B) consisting of 98 + 2 (v/v) acetonitrile-glacial acetic acid (A) and 95 + 3 + 2 (v/v/v) methanol-water-glacial acetic acid (B). The mobile phase is applied to a diol stationary phase. Detection occurs using fluorescence detection. Recovery of flavanols and procyanidins (DP 1-10) from both high- and low-fat matrixes was 98.4-99.8%. Precision was determined for seven different sample types (cocoa extract, cocoa nib, natural cocoa powder, cocoa liquor, alkalized cocoa powder, dark chocolate, and milk chocolate).
Geometric structures of thin film: Pt on Pd(110) and NiO on Ni(100)
Energy Technology Data Exchange (ETDEWEB)
Warren, Oden L. [Iowa State Univ., Ames, IA (United States)
1993-07-01
This thesis is divided into 3 papers: dynamical low-energy electron- diffraction investigation of lateral displacements in topmost layer of Pd(110); determination of (1x1) and (1x2) structures of Pt thin films on Pd(110) by dynamical low-energy electron-diffraction analysis; and structural determination of a NiO(111) film on Ni(100) by dynamical low-energy electron-diffraction analysis.
Surface Preparation of InAs (110 Using Atomic Hydrogen
Directory of Open Access Journals (Sweden)
T.D. Veal
2002-06-01
Full Text Available Atomic hydrogen cleaning has been used to produce structurally and electronically damage-free InAs(110 surfaces. X-ray photoelectron spectroscopy (XPS was used to obtain chemical composition and chemical state information about the surface, before and after the removal of the atmospheric contamination. Low energy electron diffraction (LEED and high-resolution electron-energy-loss spectroscopy (HREELS were also used, respectively, to determine the surface reconstruction and degree of surface ordering, and to probe the adsorbed contaminant vibrational modes and the collective excitations of the clean surface. Clean, ordered and stoichiometric InAs(110-(1×1 surfaces were obtained by exposure to thermally generated atomic hydrogen at a substrate temperature as low as 400ºC. Semi-classical dielectric theory analysis of HREEL spectra of the phonon and plasmon excitations of the clean surface indicate that no electronic damage or dopant passivation were induced by the surface preparation method.
Energy Technology Data Exchange (ETDEWEB)
Pal' chikov, V.G. [Multicharged Ions Spectra Data Centre of VNIIFTRI, Mendeleevo (Russian Federation)). E-mail: vitpal@mail.ru; Ya Faenov, A.; Yu Skobelev, I. [Multicharged Ions Spectra Data Centre of VNIIFTRI, Mendeleevo (RU)] [and others
2002-06-28
The wavelengths of the 1snp {sup 1}P{sub 1}{sup 0}-1s{sup 2} {sup 1}S{sub 0} transitions in the He-like Mg XI (n = 4-9) and F VIII (n=4-8) have been measured in laser-produced plasmas. The accuracy of the present measurements (0.4-1.6 mA) is a large improvement over previous results. The Rydberg series is used to determine the ground-state ionization energy of F VIII and Mg XI: E{sub i}on (F VIII) 953.96{+-}0.11 eV, E{sub i}on (Mg XI)=1761.88{+-}0.15 eV. These experimental results are compared with theoretical data calculated by the 1/Z-expansion method and the HFR and MCDF approaches. Fairly good agreement between theory and experiment is observed with a precision up to 5x10{sup -5}. Radiative corrections to the 1s{sup 2} {sup 1}S{sub 0} state are analysed and compared with experiments. It is found that QED corrections to the ground-state ionization energy are significant at the present level of experimental accuracy. (author)
Selecting a MAPLE research reactor core for 1-10 mW operation
International Nuclear Information System (INIS)
Smith, H.J.; Roy, M.-F.; Carlson, P.A.
1986-06-01
The MAPLE class of research reactors is designed so that a single reactor concept can satisfy a wide range of practical applications. This paper reports the results of physics studies performed on a number of potential core configurations fuelled with either 5 w/o or 8 w/o enriched UO 2 or 20 w/o U 3 Si-Al and assesses the relative merits of each. Recommended core designs are given to maximize the neutron fluxes available for scientific application and isotope production
International Nuclear Information System (INIS)
Wang Zhongliang; Ma Ying; Zhang Ruili; Xu Da; Fu Hongbing; Yao Jiannian
2009-01-01
A layered phosphovanadomolybdate/1,10-decanediamine (1,10-DAD) self-assembled ultrathin film was fabricated by means of alternating adsorption of mixed-addenda polyoxometalates (POMs) (phosphovanadomolybdate, H 5 [PMo 10 V 2 O 40 ]) and 1,10-DAD, and its photochromic properties were investigated. It is found that the self-assembled multilayer (SAM) film shows high-photochromic response, excellent photochromic stability and reversibility. The photochromic behavior of the SAM is closely related to the reduction potentials of addenda atoms in mixed-addenda POMs. In the case of photo-reduced mixed-addenda POMs, the electron is localized on the more reducible atom, and the addenda atoms with higher reduction potentials show prior photochromism compared with those with lower reduction potentials. The coloration speed is improved after introduction of V into molybdenum POM. The well-ordered lamellar structure of the film was well maintained during the coloration. - Graphical abstract: An ordered H 5 [PMo 10 V 2 O 40 ]/1,10-decanediamine ultrathin film was fabricated by a self-assembled technique. The hybrid film displays good photochromism closely related to the reduction potentials of addenda atoms.
International Nuclear Information System (INIS)
Shen, Leinuo; Li, Zhou; Zhang, Zheming; Dong, Qiyi; Xiao, Zhu; Lei, Qian; Qiu, Wenting
2014-01-01
Highlights: • Cu–10Ni–3Al–0.8Si alloy with ultra-high strength was designed. • The addition of silicon hindered the precipitation of large NiAl phase. • Tensile strength and electrical conductivity were 1180 MPa and 18.1% IACS. • Nano-scale Ni 2 Si and Ni 3 Al improved the strength and electrical conductivity. - Abstract: Cu–10Ni–3Al–0.8Si alloy with ultra-high strength was designed and its microstructure was studied using optical microscopy, scanning electron microscopy, transmission electron microscopy. The alloy went through a set of thermo-mechanical process: solution treated at 950 °C for 4 h, then cold-rolled by 50% and aged at 450 °C for 8 h, followed by 60% cold-rolling and aging at 450 °C for 8 h. After these treatment, the tensile strength was 1180 MPa, yield strength was 1133 MPa and electrical conductivity was 18.1% IACS, respectively. The comprehensive properties, especially the electrical conductivity of the designed alloy, were much higher than those of traditional Cu–Ni–Al alloys. The addition of silicon in the designed alloy hindered the precipitation of large-scale NiAl phase and improved the strength of the alloy. The orientation relationships between δ-Ni 2 Si, Ni 3 Al precipitates and copper matrix were: [001] Cu ‖[001] Ni 3 Al ‖[001] δ ,(110) Cu ‖(110) Ni 3 Al ‖(010) δ ,(11 ¯ 0) Cu ‖ (11 ¯ 0) Ni 3 Al ||(100) δ , respectively
38 CFR 51.110 - Resident assessment.
2010-07-01
...) PER DIEM FOR NURSING HOME CARE OF VETERANS IN STATE HOMES Standards § 51.110 Resident assessment. The... physician orders for the resident's immediate care and a medical assessment, including a medical history and...) Review of assessments. The nursing facility management must examine each resident no less than once every...
Tank characterization report for single-shell Tank 241-B-110
International Nuclear Information System (INIS)
Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.
1994-08-01
Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr
International Nuclear Information System (INIS)
Iannacci, J; Tschoban, C
2017-01-01
RF-MEMS technology is proposed as a key enabling solution for realising the high-performance and highly reconfigurable passive components that future communication standards will demand. In this work, we present, test and discuss a novel design concept for an 8-bit reconfigurable power attenuator, manufactured using the RF-MEMS technology available at the CMM-FBK, in Italy. The device features electrostatically controlled MEMS ohmic switches in order to select/deselect the resistive loads (both in series and shunt configuration) that attenuate the RF signal, and comprises eight cascaded stages (i.e. 8-bit), thus implementing 256 different network configurations. The fabricated samples are measured (S-parameters) from 10 MHz to 110 GHz in a wide range of different configurations, and modelled/simulated with Ansys HFSS. The device exhibits attenuation levels (S21) in the range from −10 dB to −60 dB, up to 110 GHz. In particular, S21 shows flatness from 15 dB down to 3–5 dB and from 10 MHz to 50 GHz, as well as fewer linear traces up to 110 GHz. A comprehensive discussion is developed regarding the voltage standing wave ratio, which is employed as a quality indicator for the attenuation levels. The margins of improvement at design level which are needed to overcome the limitations of the presented RF-MEMS device are also discussed. (paper)
International Nuclear Information System (INIS)
2011-01-01
Results for Version 4.110 of the Area 5 Radioactive Waste Management Site (RWMS) performance assessment (PA) model are summarized. Version 4.110 includes the fiscal year (FY) 2010 inventory estimate, including a future inventory estimate. Version 4.110 was implemented in GoldSim 10.11(SP4). The following changes have been implemented since the last baseline model, Version 4.105: (1) Updated the inventory and disposal unit configurations with data through the end of FY 2010. (1) Implemented Federal Guidance Report 13 Supplemental CD dose conversion factors (U.S. Environmental Protection Agency, 1999). Version 4.110 PA results comply with air pathway and all-pathways annual total effective dose (TED) performance objectives (Tables 2 and 3, Figures 1 and 2). Air pathways results decrease moderately for all scenarios. The time of the maximum for the air pathway open rangeland scenario shifts from 1,000 to 100 years (y). All-pathways annual TED increases for all scenarios except the resident scenario. The maximum member of public all-pathways dose occurs at 1,000 y for the resident farmer scenario. The resident farmer dose was predominantly due to technetium-99 (Tc-99) (82 percent) and lead-210 (Pb-210) (13 percent). Pb-210 present at 1,000 y is produced predominantly by radioactive decay of uranium-234 (U-234) present at the time of disposal. All results for the postdrilling and intruder-agriculture scenarios comply with the performance objectives (Tables 4 and 5, Figures 3 and 4). The postdrilling intruder results are similar to Version 4.105 results. The intruder-agriculture results are similar to Version 4.105, except for the Pit 6 Radium Disposal Unit (RaDU). The intruder-agriculture result for the Shallow Land Burial (SLB) disposal units is a significant fraction of the performance objective and exceeds the performance objective at the 95th percentile. The intruder-agriculture dose is due predominantly to Tc-99 (75 percent) and U-238 (9.5 percent). The acute
International Nuclear Information System (INIS)
Priyadarshi, Shekhar; Leidinger, Markus; Pierz, Klaus; Racu, Ana M.; Siegner, Uwe; Bieler, Mark; Dawson, Philip
2009-01-01
We report the observation and the study of an additional shift current tensor element in (110)-oriented GaAs quantum wells, which arises from an out-of-plane asymmetry of the quantum well structure. The current resulting from this tensor element is optically induced with 150 fs laser pulses and detected by measuring the simultaneously emitted terahertz radiation. This terahertz spectroscopy of shift currents is a powerful technique for symmetry investigations, which shows, for example, that our nominally symmetric (110)-oriented GaAs/AlGaAs quantum wells grown by molecular beam epitaxy are in reality asymmetric structures with different right and left interfaces.
The 640 × 512 LWIR type-II superlattice detectors operating at 110 K
Tan, Bi-Song; Zhang, Chuan-Jie; Zhou, Wen-Hong; Yang, Xiao-Jie; Wang, Guo-Wei; Li, Yun-Tao; Ding, Yan-Yan; Zhang, Zhou; Lei, Hua-Wei; Liu, Wei-Hua; Du, Yu; Zhang, Li-Fang; Liu, Bin; Wang, Li-Bao; Huang, Li
2018-03-01
The type-II InAs/GaSb superlattices (T2SLs)-based 640 × 512 long wavelength infrared (LWIR) Focal Plane Array (FPA) detector with15 μm pitch and 50% cut-off wavelength of 10.5 μm demonstrates a peak quantum efficiency of 38.6% and peak detectivity of 1.65 × 1011 cm Hz1/2 W-1 at 8.1 μm, high pixel operability of 99.5% and low responsivity non-uniformity of 2.69% at 80 K. The FPA exhibits clear infrared imaging at 110 K and diffusion-limited dark current densities below Tennant's 'Rule07' at temperature above 100 K, which is attributed to the efficient suppression of diffusion dark current and surface leak current by introducing M-structure barrier and double hetero-structure passivation layers.
Wang, Yuan-Min; Teng, Feng; Xu, Zheng; Hou, Yan-Bing; Yang, Sheng-Yi; Qian, Lei; Zhang, Ting; Liu, De-Ang
2004-09-01
The photoluminescence (PL) and electroluminescence (EL) properties of OLEDs based on poly( N-vinylcarbazole)(PVK) and 2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) have been studied. A new emission at 595 nm has been observed in EL spectra but not in PL spectra of the devices. We suggest the new emission originates from the electroplex occuring at PVK-BCP interface. White emission via electroplex has been obtained in all the OLEDs. CIE coordinates of device ITO/PEDOT:PSS/PVK/BCP/Alq 3/LiF/Al is (0.31, 0.33) at 18 V. Alq 3 layer plays an important role in tuning the recombination zone and enhancing the electroplex emission.
Lamb Shift of n = 1 and n = 2 States of Hydrogen-like Atoms, 1 ≤ Z ≤ 110
Energy Technology Data Exchange (ETDEWEB)
Yerokhin, V. A. [Center for Advanced Studies, Peter the Great St. Petersburg Polytechnic University, Polytekhnicheskaya 29, St. Petersburg 195251 (Russian Federation); Shabaev, V. M. [Department of Physics, St. Petersburg State University, Ulianovskaya 1, Petrodvorets, St. Petersburg 198504 (Russian Federation)
2015-09-15
Theoretical energy levels of the n = 1 and n = 2 states of hydrogen-like atoms with the nuclear charge numbers 1 ≤ Z ≤ 110 are tabulated. The tabulation is based on ab initio quantum electrodynamics calculations performed to all orders in the nuclear binding strength parameter Zα, where α is the fine structure constant. Theoretical errors due to various effects are critically examined and estimated.
40 CFR 427.110 - Applicability; description of the wet dust collection subcategory.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability; description of the wet dust collection subcategory. 427.110 Section 427.110 Protection of Environment ENVIRONMENTAL PROTECTION... (particulates) from atmospheric emissions by means of wet scrubbers. ...
47 CFR 25.110 - Filing of applications, fees, and number of copies.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Filing of applications, fees, and number of copies. 25.110 Section 25.110 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing...
Directory of Open Access Journals (Sweden)
Nicandro de Figueiredo Neto
1996-06-01
Full Text Available Apresentamos uma série consecutiva de 110 pacientes com hematoma subdural agudo traumático (HSDA admitidos no serviço de emergência do HBDF no período de 1°-janeiro a 1°-dezembro-1994. Todos os pacientes foram atendidos de acordo com o mesmo protocolo. Houve predominância do sexo masculino (79%, com idade variando entre 14 e 70 anos, sendo os atropelamentos (34% e os acidentes automobilísticos (20% as causas mais comuns. A maioria dos pacientes (85,7% foi admitida muito grave, com 8 pontos ou menos na Escala de Coma Glasgow (ECG, o que influenciou diretamente na mortalidade. A tomografia computadorizada de crânio foi o exame diagnóstico de escolha que mostrou serem as contusões e o inchaço cerebral ("swelling" as lesões intracranianas associadas mais freqüentes. A cirurgia foi realizada em 45,1% dos pacientes, e, em sua maioria, através de craniotomia fronto-têmporo-parietal ampla, com drenagem do hematoma, seguida de plástica da dura-mater. Em 54,9% as condições clínicas não permitiram a realização da cirurgia; neste grupo, cerca de 69,6% estavam em coma profundo à admissão, com 3 pontos na ECG. A letalidade cirúrgica foi de 61,2% e esteve diretamente relacionada à condição clínica inicial e à idade do paciente. A letalidade, incluindo todos os pacientes cirúrgicos e não cirúrgicos com HSDA, mesmo aqueles admitidos já com sinais de falência de tronco cerebral, foi de 79,5%. Além destes pacientes que faleceram, cerca de 7% evoluíram sem seqüelas ou com seqüelas mínimas; outros 11,4% com seqüelas de moderadas a paves e 2,1 % permaneceram em estado vegetativo persistente. Nossos dados estão de acordo com os da literatura no que se refere a elevada taxa de morbidade e mortalidade dos pacientes com HSDA.We report a series of 110 patients with acute traumatic subdural hematoma (ASDH admitted at HBDF emergency within 1994 (January Is1 to December PJ.All patients were treated according to the same protocol
Disruption of a red giant star by a supermassive black hole and the case of PS1-10jh
International Nuclear Information System (INIS)
Bogdanović, Tamara; Cheng, Roseanne M.; Amaro-Seoane, Pau
2014-01-01
The development of a new generation of theoretical models for tidal disruptions is timely, as increasingly diverse events are being captured in surveys of the transient sky. Recently, Gezari et al. reported a discovery of a new class of tidal disruption events: the disruption of a helium-rich stellar core, thought to be a remnant of a red giant (RG) star. Motivated by this discovery and in anticipation of others, we consider tidal interaction of an RG star with a supermassive black hole (SMBH) which leads to the stripping of the stellar envelope and subsequent inspiral of the compact core toward the black hole. Once the stellar envelope is removed the inspiral of the core is driven by tidal heating as well as the emission of gravitational radiation until the core either falls into the SMBH or is tidally disrupted. In the case of the tidal disruption candidate PS1-10jh, we find that there is a set of orbital solutions at high eccentricities in which the tidally stripped hydrogen envelope is accreted by the SMBH before the helium core is disrupted. This places the RG core in a portion of parameter space where strong tidal heating can lift the degeneracy of the compact remnant and disrupt it before it reaches the tidal radius. We consider how this sequence of events explains the puzzling absence of the hydrogen emission lines from the spectrum of PS1-10jh and gives rise to its other observational features.
Disruption of a red giant star by a supermassive black hole and the case of PS1-10jh
Energy Technology Data Exchange (ETDEWEB)
Bogdanović, Tamara; Cheng, Roseanne M. [Center for Relativistic Astrophysics, School of Physics, Georgia Tech, Atlanta, GA 30332 (United States); Amaro-Seoane, Pau, E-mail: tamarab@gatech.edu, E-mail: rcheng@gatech.edu, E-mail: Pau.Amaro-Seoane@aei.mpg.de [Max Planck Institut für Gravitationsphysik (Albert-Einstein-Institut), D-14476 Potsdam (Germany)
2014-06-20
The development of a new generation of theoretical models for tidal disruptions is timely, as increasingly diverse events are being captured in surveys of the transient sky. Recently, Gezari et al. reported a discovery of a new class of tidal disruption events: the disruption of a helium-rich stellar core, thought to be a remnant of a red giant (RG) star. Motivated by this discovery and in anticipation of others, we consider tidal interaction of an RG star with a supermassive black hole (SMBH) which leads to the stripping of the stellar envelope and subsequent inspiral of the compact core toward the black hole. Once the stellar envelope is removed the inspiral of the core is driven by tidal heating as well as the emission of gravitational radiation until the core either falls into the SMBH or is tidally disrupted. In the case of the tidal disruption candidate PS1-10jh, we find that there is a set of orbital solutions at high eccentricities in which the tidally stripped hydrogen envelope is accreted by the SMBH before the helium core is disrupted. This places the RG core in a portion of parameter space where strong tidal heating can lift the degeneracy of the compact remnant and disrupt it before it reaches the tidal radius. We consider how this sequence of events explains the puzzling absence of the hydrogen emission lines from the spectrum of PS1-10jh and gives rise to its other observational features.
Decarbonylation and hydrogenation reactions of allyl alcohol and acrolein on Pd(110)
Shekhar, Ratna; Barteau, Mark A.
1994-11-01
Allyl alcohol and acrolein reactions on the Pd(110) surface were investigated using temperature programmed desorption. For both unsaturated oxygenates, three coverage-dependent reaction pathways were observed. At low coverages, allyl alcohol decomposed completely to CO, hydrogen and carbonaceous species on the surface. For θ > 0.15 monolayer, ethylene (and small amounts of ethane) desorbed at ca. 295 K. Near saturation coverages, desorption of propanal was detected at ca. 235 K. The parent molecule, allyl alcohol, desorbed only after exposures sufficient to saturate these channels. Acrolein decomposition spectra were similar to those observed for allyl alcohol decomposition on the clean surface. Additional experiments with allyl alcohol on hydrogen- and deuterium-precoveredPd(110) surfaces demonstrated increased hydrogenation of the C 2-hydrocarbon products along with hydrogenation of allyl alcohol to 1-propanol. However, in contrast to previous results for allyl alcohol on the Pd(111) surface, there was no evidence for C-O scission reactions of any C 3 oxygenate on Pd(110).
DEFF Research Database (Denmark)
Morozzo della Rocca, Blasco; Smith, C I; Tesauro, Cinzia
2010-01-01
The adsorption of a cysteine–tryptophan dipeptide has been monitored at a Au(110)/electrolyte interface using reflection anisotropy spectroscopy. At −0.6 V the dipeptide adsorbed through the formation of Au–S bonds and a link between the NH2 group at the Au surface. As the applied potential...
Geissel, H.; Gilg, H.; Gillitzer, A.; Hayano, R. S.; Hirenzaki, S.; Itahashi, K.; Iwasaki, M.; Kienle, P.; Münch, M.; Münzenberg, G.; Schott, W.; Suzuki, K.; Tomono, D.; Weick, H.; Yamazaki, T.; Yoneyama, T.
2002-03-01
We observed well-separated 1s and 2p π- states in 205Pb in the 206Pb(d,3He) reaction at Td = 604.3 MeV. The binding energies and the widths determined are B1s = 6.762+/-0.061 MeV, Γ1s = 0.764+0.171-0.154 MeV, B2p = 5.110+/-0.045 MeV, and Γ2p = 0.321+0.060-0.062 MeV. They are used to deduce the real and imaginary strengths of the s-wave part of the pion-nucleus interaction, which translates into a positive mass shift of π- in 205Pb.
Structural and magnetic anisotropy in the epitaxial FeV2O4 (110) spinel thin films
Shi, Xiaolan; Wang, Yuhang; Zhao, Kehan; Liu, Na; Sun, Gaofeng; Zhang, Liuwan
2015-11-01
The epitaxial 200-nm-thick FeV2O4(110) films on (110)-oriented SrTiO3, LaAlO3 and MgAl2O4 substrates were fabricated for the first time by pulsed laser deposition, and the structural, magnetic, and magnetoresistance anisotropy were investigated systematically. All the films are monoclinic, whereas its bulk is cubic. Compared to FeV2O4 single crystals, films on SrTiO3 and MgAl2O4 are strongly compressively strained in [001] direction, while slightly tensily strained along normal [110] and in-plane [ 1 1 ¯ 0 ] directions. In contrast, films on LaAlO3 are only slightly distorted from cubic. The magnetic hard axis is in direction, while the easier axis is along normal [110] direction for films on SrTiO3 and MgAl2O4, and in-plane [ 1 1 ¯ 0 ] direction for films on LaAlO3. Magnetoresistance anisotropy follows the magnetization. The magnetic anisotropy is dominated by the magnetocrystalline energy, and tuned by the magneto-elastic coupling.
Neyman, Konstantin M; Inntam, Chan; Matveev, Alexei V; Nasluzov, Vladimir A; Rösch, Notker
2005-08-24
Single d-metal atoms on oxygen defects F(s) and F(s+) of the MgO(001) surface were studied theoretically. We employed an accurate density functional method combined with cluster models, embedded in an elastic polarizable environment, and we applied two gradient-corrected exchange-correlation functionals. In this way, we quantified how 17 metal atoms from groups 6-11 of the periodic table (Cu, Ag, Au; Ni, Pd, Pt; Co, Rh, Ir; Fe, Ru, Os; Mn, Re; and Cr, Mo, W) interact with terrace sites of MgO. We found bonding with F(s) and F(s+) defects to be in general stronger than that with O2- sites, except for Mn-, Re-, and Fe/F(s) complexes. In M/F(s) systems, electron density is accumulated on the metal center in a notable fashion. The binding energy on both kinds of O defects increases from 3d- to 4d- to 5d-atoms of a given group, at variance with the binding energy trend established earlier for the M/O2- complexes, 4d period, group 7 atoms are slightly destabilized compared to their group 6 congeners in both the F(s) and F(s+) complexes; for later transition elements, the binding energy increases gradually up to group 10 and finally decreases again in group 11, most strongly on the F(s) site. This trend is governed by the negative charge on the adsorbed atoms. We discuss implications for an experimental detection of metal atoms on oxide supports based on computed core-level energies.
Directory of Open Access Journals (Sweden)
Abbas Haddadi
2017-03-01
Full Text Available We report the demonstration of high-performance long-wavelength infrared (LWIR nBn photodetectors based on InAs/InAs1− xSbx type-II superlattices. A new saw-tooth superlattice design was used to implement the electron barrier of the photodetectors. The device exhibited a cut-off wavelength of ∼10 μ m at 77 K. The photodetector exhibited a peak responsivity of 2.65 A/W, corresponding to a quantum efficiency of 43%. With an R × A of 664 Ω · cm 2 and a dark current density of 8 × 10−5 A/cm2, under −80 mV bias voltage at 77 K, the photodetector exhibited a specific detectivity of 4.72 × 1011 cm· Hz / W and a background–limited operating temperature of 110 K.
41 CFR 101-4.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
.... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... action and self-evaluation. 101-4.110 Section 101-4.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 4-NONDISCRIMINATION...
International Nuclear Information System (INIS)
Ruhter, W.D.
1977-12-01
A megachannel pulse-height analysis system using a 32,000-word PDP-8/E minicomputer and two moving-head disk memories was developed. The system has a storage capacity of 2 18 events at any of 2 20 data locations, is capable of processing 1,040 events/s, and provides on-line sorting and disk storage. An X- or Y- pulse-height spectrum in coincidence with one to four arithmetically combined pulse-height windows can be assembled in core for scope display and spectral analysis within 2 to 20 seconds. The software for the system was written extensively in machine language. Excellent energy and timing resolution were achieved. An energy resolution of 2.3 keV fwhm and a timing resolution of 8.5 ns fwhm were obtained for 60 Co at a singles rate of 10,000 counts/s. The prompt timing peak remained Gaussian down to the fwtm by gating the TAC with SCAs which discriminated against low-energy events. The coincidence electronics also allowed on-line subtraction of accidental coincidence events. Alignment of the detectors and tests of the system's performance were made by measuring solid-angle correction factors for the Ge(Li) detectors through the correlation measurements of the 0 + --2 + --0 + cascade in 106 Pd, and by measuring the angular spread of positron annihilation radiation coincidences. Results were in excellent agreement with theoretical solid-angle correction factors calculated for the detector and source sizes used. Directional correlation data were obtained for gamma-ray cascades in 134 Ba and 110 Cd. Analyses of these data gave E2/M1 mixing ratios which are in excellent agreement with results obtained by other investigators. The improved resolution and data processing capabilities of this system gave new results for the 563-keV transition in 134 Ba and the 1505-keV transition in 110 Cd. E2/M1 mixing ratios of 13.3/sup +2.3/sub -1.8/ for the 563-keV transition and -1.24 +- 0.20 for the 1505-keV transition were measured
40 CFR 417.110 - Applicability; description of the SO3 solvent and vacuum sulfonation subcategory.
2010-07-01
... solvent and vacuum sulfonation subcategory. 417.110 Section 417.110 Protection of Environment... POINT SOURCE CATEGORY SO3 Solvent and Vacuum Sulfonation Subcategory § 417.110 Applicability; description of the SO3 solvent and vacuum sulfonation subcategory. The provisions of this subpart are...
2013-09-16
...-F2013227943] South Bay Salt Pond Restoration Project, Phase 2 (Ponds R3, R4, R5, S5, A1, A2W, A8, A8S, A19... South Bay Salt Pond Restoration Project and consists of restoring and enhancing over 2,000 acres of... Pollution Control Plant located at 700 Los Esteros Road, San Jose, California. The details of the public...
Directory of Open Access Journals (Sweden)
Claudia Regina Vieira
2008-09-01
Full Text Available O presente trabalho teve como objetivo extrair enzimaticamente as proteínas de uma farinha comercial de arroz. Visando aumentar o Rendimento de Extração Protéica (REP, os seguintes parâmetros foram avaliados: tipo de enzima (protease alcalina e neutra; temperatura (40, 50 e 60 °C; pH (9,5, 10,5 e 11,0; tratamento físico da amostra (sem tratamento, ultra-turrax a 16.000 rpm e ultra-som a 120 W, ambos por 5, 10 e 15 minutos; relação Enzima:Substrato (E:S de 5:100 e 10:100; e concentração inicial de matéria-prima (1:3, 1:5 e 1:10 p/v. Os teores de proteínas da farinha de arroz e dos resíduos foram determinados para o cálculo do REP. Os resultados mostraram que a melhor condição de extração protéica, que levou ao maior REP, foi a que empregou a concentração inicial de matéria-prima a 1:10 (p/v, sem tratamento físico, com pH 10,5, com a protease alcalina na relação E:S de 10:100, a 50 °C, tendo atingido um REP de 63,4%.The enzymatic extraction of proteins from a commercial rice flour was studied in this work. In order to increase the Protein Extraction Yield (PEY, the following parameters were evaluated: enzyme type (alkaline and neutral protease; temperature (40, 50 and 60 °C; pH (9.5, 10.5 and 11.0; physical treatment of the sample (no treatment; Ultra-Turrax at 16.000 rpm and ultrasound at 120 W, both for 5, 10 and 15 minutes; enzyme:substrate ratio (E:S of 5:100 and 10:100 and initial concentration of raw material (1:3, 1:5 and 1:10 w/v. The PEY was calculated using the protein contents of rice flour and the extraction residues. The results showed that the best condition for protein extraction, which gave the highest PEY (63.4%, was that using an initial concentration of raw material of 1:10 (w/v, no physical treatment, pH 10.5, the alkaline protease, an E:S of 10:100, at 50 °C.
Ferreira-Junior, J B; Vieira, C A; Soares, S R S; Guedes, R; Rocha Junior, V A; Simoes, H G; Brown, L E; Bottaro, M
2014-12-01
It has been demonstrated that body cooling may decrease neuromuscular performance. However, the effect of a single session of whole body cryotherapy (-110°C) on neuromuscular performance has not been well documented. Thus, the aim of this study was to evaluate the effects of a single exposure of WBC on elbow flexor neuromuscular performance. Thirteen physically active, healthy young men (age=27.9±4.2 years, mass=79.4±9.7 kg, height=176.7±5.2 cm) were randomly exposed to 2 different experimental conditions separated by a minimum of 72 h: 1) whole body cryotherapy- 3 min at -110°C; 2) control- 3 min at 21°C. All subjects were tested for maximal isokinetic elbow flexion at 60°.s(-1) 30 min before and 10 min after each condition. There were no significant differences in peak torque, average power, total work or muscle activity between conditions. Peak torque was lower at post-test compared to pre-test in both conditions (F=6.58, p=0.025). However, there were no differences between pre-test and post-test for any other variables. These results indicate that strength specialists, athletic trainers and physical therapists might utilize whole body cryotherapy before training or rehabilitation without compromising neuromuscular performance of the elbow flexors. © Georg Thieme Verlag KG Stuttgart · New York.
InGaAs/GaAs (110) quantum dot formation via step meandering
Energy Technology Data Exchange (ETDEWEB)
Diez-Merino, Laura; Tejedor, Paloma [Department of Nanostructures and Surfaces, Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Ines de la Cruz 3, 28049-Madrid (Spain)
2011-07-01
InGaAs (110) semiconductor quantum dots (QDs) offer very promising prospects as a material base for a new generation of high-speed spintronic devices, such as single electron transistors for quantum computing. However, the spontaneous formation of InGaAs QDs is prevented by two-dimensional (2D) layer-by-layer growth on singular GaAs (110) substrates. In this work we have studied, by using atomic force microscopy and photoluminescence spectroscopy (PL), the growth of InGaAs/GaAs QDs on GaAs (110) stepped substrates by molecular beam epitaxy (MBE), and the modification of the adatom incorporation kinetics to surface steps in the presence of chemisorbed atomic hydrogen. The as-grown QDs exhibit lateral dimensions below 100 nm and emission peaks in the 1.35-1.37 eV range. It has been found that a step meandering instability derived from the preferential attachment of In adatoms to [110]-step edges relative to [11n]-type steps plays a key role in the destabilization of 2D growth that leads to 3D mound formation on both conventional and H-terminated vicinal substrates. In the latter case, the driving force for 3D growth via step meandering is enhanced by H-induced upward mass transport in addition to the lower energy cost associated with island formation on H-terminated substrates, which results in a high density array of InGaAs/GaAs dots selectively nucleated on the terrace apices with reduced lateral dimensions and improved PL efficiency relative to those of conventional MBE-grown samples.
InGaAs/GaAs (110) quantum dot formation via step meandering
International Nuclear Information System (INIS)
Diez-Merino, Laura; Tejedor, Paloma
2011-01-01
InGaAs (110) semiconductor quantum dots (QDs) offer very promising prospects as a material base for a new generation of high-speed spintronic devices, such as single electron transistors for quantum computing. However, the spontaneous formation of InGaAs QDs is prevented by two-dimensional (2D) layer-by-layer growth on singular GaAs (110) substrates. In this work we have studied, by using atomic force microscopy and photoluminescence spectroscopy (PL), the growth of InGaAs/GaAs QDs on GaAs (110) stepped substrates by molecular beam epitaxy (MBE), and the modification of the adatom incorporation kinetics to surface steps in the presence of chemisorbed atomic hydrogen. The as-grown QDs exhibit lateral dimensions below 100 nm and emission peaks in the 1.35-1.37 eV range. It has been found that a step meandering instability derived from the preferential attachment of In adatoms to [110]-step edges relative to [11n]-type steps plays a key role in the destabilization of 2D growth that leads to 3D mound formation on both conventional and H-terminated vicinal substrates. In the latter case, the driving force for 3D growth via step meandering is enhanced by H-induced upward mass transport in addition to the lower energy cost associated with island formation on H-terminated substrates, which results in a high density array of InGaAs/GaAs dots selectively nucleated on the terrace apices with reduced lateral dimensions and improved PL efficiency relative to those of conventional MBE-grown samples.
[A recent trial of chemo-radiation with S-1 against gastric cancer].
Saikawa, Yoshiro; Kiyota, Tsuyoshi; Nakamura, Rieko; Wada, Norihito; Yoshida, Masashi; Kubota, Tetsuro; Kumai, Koichiro; Shigematsu, Naoyuki; Kubo, Atsushi; Kitajima, Masaki
2006-06-01
A recent development of novel anticancer agents like S-1, CPT-11 or taxanes has improved a therapeutic outcome for advanced gastric cancer, while conventional anticancer agents showed less anticancer effect against gastric cancer. The present main drug in Japan is S-1, which is easily used for outpatient with a high efficacy rate and low toxicity, also shows better effect in combination with other anticancer drugs than S-1 alone. In the present article, we demonstrated significant meaning of additional radiation therapy with anticancer drugs like S-1. With novel anticancer drugs like S-1, we will expose a clinical advantage and appropriateness for chemo-radiation therapy against gastric cancer discussed in the present references according to chemo-radiation therapy. Although chemo-radiation therapy has been recognized as one of the standard therapies for gastric cancer in Western countries, radiation therapy was selected in Japan for palliation therapy of recurrent disease or a terminal cancer to improve patients' QOL. On the other hand, we demonstrated in our trial of chemo-radiation therapy with S-1/low-dose CDDP/radiation (TSLDR), which was applied to initial treatment against highly advanced Stage IV gastric cancer and revealed the usefulness of the regimen in anticancer effect and toxicity. In addition, chemo-radiation therapy including novel anticancer agents like S-1 will be discussed based on various kinds of view points, expecting a better clinical outcome of multimodal therapies against advanced gastric cancer.
7 CFR 1221.110 - Powers and duties.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.110 Powers and duties. The Board shall have the following powers and duties: (a) To...
Mechanisms of self-diffusion on Pt(110)
DEFF Research Database (Denmark)
Lorensen, Henrik Qvist; Nørskov, Jens Kehlet; Jacobsen, Karsten Wedel
1999-01-01
The self-diffusion of Pt on the missing row reconstructed Pt(110) surface is discussed based on density functional calculations of activation energy barriers. Different competing diffusion mechanisms are considered and we show that several different diffusion paths along the reconstruction troughs...
Beam steering application for W-band data links with moving targets in 5G wireless networks
DEFF Research Database (Denmark)
Morales Vicente, Alvaro; Rodríguez Páez, Juan Sebastián; Gallardo, Omar
2017-01-01
to this problem, RoF (Radio-over-Fiber) architectures have been proposed as low-latency, cost-effective candidates. Two elements are introduced to extend the RoF approach. First, the carrier frequency is raised into the W-band (75–110 GHz) to increase the available capacity. Second, a mechanical beam......-steering solution based on a Stewart platform is adopted for the transmitter antenna to allow it to follow a moving receiver along a known path, thereby enhancing the coverage area. The performance of a system transmitting a 2.5 Gbit/s non-return-to-zero signal generated by photonic up-conversion over a wireless...
Hjörvarsson, B; Olafsson, S; Karlsson, E B; Birch, J; Sundgren, J E
1997-01-01
We have investigated the hydrogen distribution within multilayered Mo/V (110) and (001) artificial superlattices. The hydrogen concentration, determined by the sup 1 H( sup 1 sup 5 N, alpha gamma) sup 1 sup 2 C nuclear resonance reaction, is found to decrease with decreasing layer thickness. The decrease is attributed to an interface region with reduced hydrogen content. The extension of this interface region is found to be two monolayers in Mo/V (110), compared to the previously reported three monolayers in Mo/V (001) superlattices. In the (110) oriented samples the relative amount of H in the interface region decreases with increasing average H content (H/V (atomicratio) approx. 0.3-0.5). This effect is shown to be related to the orientation of the hydrogen planes with respect to the boundaries implied by the Mo/V interfaces. The hydrogen induced volume change, obtained by conventional theta-2 theta x-ray diffraction (XRD) and reciprocal space mapping, is found to be smaller for the (110) samples than for t...
International Nuclear Information System (INIS)
Wang, Y; Gong, M; Yan, P; Huang, L; Li, D
2009-01-01
A monolithic Nd:YAG microchip laser with [110] cut Cr 4+ :YAG is presented. The output beam is linearly polarized with polarization ratio higher than 100:1. The polarization direction is stable, independent of pump power, crystal temperature, LD temperature. In single longitudinal mode operation, stable 259 ps pulses at 2.5 kHz with 82 kW peak power and diffraction limited beam mode are output. With a simple and compact one-pass Nd:YVO 4 amplifier, 144 kW peak power is achieved. Single longitudinal and fundamental transverse mode is kept after passing through the amplifier stage. The microchip laser can be operated in two longitudinal modes with two sets of output pulses by increasing the pump power
Directory of Open Access Journals (Sweden)
Tudor Voicu Moga1,
2016-12-01
Full Text Available OBJECTIVES CEUS improved the characterization of focal lesions of the liver (FLLs, but it remains an operator-dependent method. The goal of this scientific paper was to test a computer assisted diagnosis (CAD prototype. MATERIALS AND METHODS 97 CEUS videos [34% hepatocellular carcinomas (HCC, 12.3% hypervascular metastases (HiperM, 11.3% hypovascular metastases (HipoM, 24.7% hemangiomas (HMG, 17.5% focal nodular hyperplasia (FNH] were used to develop a CAD prototype based on an algorithm that tested a binary decision classifier. Two young MDs, two experts and the CAD prototype, reevaluated 50 CEUS videos (diagnosis of benign vs. malignant lesions, in order to evaluate the beginner vs. expert diagnostic gap, the first being blinded by clinical data. RESULTS I-Beginner misdiagnosed 4/10-FNH, 3/10-HCC, 2/10-HMG, 1/10-HiperM, 1/10-HipoM. After being informed about the clinical data 2/10-FNH, 1/10-HCC. II-beginner misdiagnosed: 3/10-FNH; 3/10-HCC, 2/10- HMG, 1/10-HiperM. Unblinded: 1/10-HCC, 1/10- HMG. I-Expert: only 1/10-FNH, 1/10-HCC, 1/10- HMG misdiagnosed. Unblinded: all lesions were correctly diagnosed. II-Expert: 1/10-FNH, 1/10-HCC misdiagnosed. Unblinded: only 1/10-FNH was misdiagnosed. The CAD classifier managed a 75.2% overall correct classification rate. The overall classification before and after the uncovering of clinical data was: I beginner 78 %; 94%, II 82%; 96%. I expert 94%; 100%. II 96%; 98%. CONCLUSIONS The CAD prototype can assist a beginner for a better CEUS diagnostic accuracy. The integration of clinical data in the CAD algorithm is essential. Graphical abstract: Average Intensity variation in Arterial and Late Phase with supra unitary (meaning wash in and sub unitary pattern (meaning washout. REFERENCES 1.Sugimoto K, Shiraishi J, Moriyasu F, Doi K. Computer-aided diagnosis for contrast-enhanced ultrasound in the liver. World J Gastroenterol. 2010;2:215-223. 2. Gatos I, Tsantis S, Spiliopoulos S, Skouroliakou A, Theotokas I
41 CFR 102-79.110 - What Integrated Workplace policy must Federal agencies strive to promote?
2010-07-01
... capital costs over a substantial time period; and (i) Support alternative workplace arrangements... Workplace policy must Federal agencies strive to promote? 102-79.110 Section 102-79.110 Public Contracts and... Integrated Workplace § 102-79.110 What Integrated Workplace policy must Federal agencies strive to promote...
International Nuclear Information System (INIS)
Markelov, V.A.; Novikov, V.V.; Kon'kov, V.F.; Tselishchev, A.V.; Dologov, A.B.; Zmitko, M.; Maserik, V.; Kocik, J.
2008-01-01
As structural materials for VVER 1000 fuel rod claddings and FA components use is made of zirconium alloys E110 (Zr 1Nb) and E635 (Zr 1.2Sn 1Nb 0.35Fe) that meet the design parameters of operation. Nonetheless, the work is in progress to perfect those alloys to reach higher corrosion and shape change resistance. At VNIINM updated E110M and E635M alloys have been developed on E110 and E635 bases. To assess the corrosion behaviour of the updated alloys in comparison to the base alloys their cladding samples were tested in RVS 3 loop of LWR 15 reactor (NRI, Rez) in PWR water chemistry with coolant surface and volume boiling. The data are presented on the influence effected by in pile irradiation for up to 324 days on oxide coat thickness and microstructure of fuel claddings produced from the four tested alloys. It has been revealed that E110 alloy its updated version E110M and E635M alloy compared to E635 have higher corrosion resistances. The paper discusses th+e results on the in pile corrosion of cladding samples from the alloys under study in comparison to the results acquired for similar samples tested in LWR 15 inactive channel and under autoclave conditions. Using methods of TEM, EDX analyses of extraction replicas dislocation structure and phase composition changes were studied in samples of all four alloy claddings LWR 15 reactor irradiated to the material damage dose of 1.5 dpa. The interrelation is discussed between irradiation effected strengthening and corrosion of fuel claddings made of E110 and E635 type zirconium alloys and the evolution of their structure and phase states
Measurement of $CP$ asymmetry in $B^0_s \\rightarrow D^{\\mp}_s K^{\\pm}$ decays
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-11-13
We report on measurements of the time-dependent CP violating observables in $B^0_s\\rightarrow D^{\\mp}_s K^{\\pm}$ decays using a dataset corresponding to 1.0 fb$^{-1}$ of pp collisions recorded with the LHCb detector. We find the CP violating observables $C_f=0.53\\pm0.25\\pm0.04$, $A^{\\Delta\\Gamma}_f=0.37\\pm0.42\\pm0.20$, $A^{\\Delta\\Gamma}_{\\bar{f}}=0.20\\pm0.41\\pm0.20$, $S_f=-1.09\\pm0.33\\pm0.08$, $S_{\\bar{f}}=-0.36\\pm0.34\\pm0.08$, where the uncertainties are statistical and systematic, respectively. We use these observables to make the first measurement of the CKM angle $\\gamma$ in $B^0_s\\rightarrow D^{\\mp}_s K^{\\pm}$ decays, finding $\\gamma$ = (115$_{-43}^{+28}$)$^\\circ$ modulo 180$^\\circ$ at 68% CL, where the error contains both statistical and systematic uncertainties.
Modified energetics and growth kinetics on H-terminated GaAs (110)
International Nuclear Information System (INIS)
Galiana, B.; Benedicto, M.; Díez-Merino, L.; Tejedor, P.; Lorbek, S.; Hlawacek, G.; Teichert, C.
2013-01-01
Atomic hydrogen modification of the surface energy of GaAs (110) epilayers, grown at high temperatures from molecular beams of Ga and As 4 , has been investigated by friction force microscopy (FFM). The reduction of the friction force observed with longer exposures to the H beam has been correlated with the lowering of the surface energy originated by the progressive de-relaxation of the GaAs (110) surface occurring upon H chemisorption. Our results indicate that the H-terminated GaAs (110) epilayers are more stable than the As-stabilized ones, with the minimum surface energy value of 31 meV/Å 2 measured for the fully hydrogenated surface. A significant reduction of the Ga diffusion length on the H-terminated surface irrespective of H coverage has been calculated from the FFM data, consistent with the layer-by-layer growth mode and the greater As incorporation coefficient determined from real-time reflection high-energy electron diffraction studies. Arsenic incorporation through direct dissociative chemisorption of single As 4 molecules mediated by H on the GaAs (110) surface has been proposed as the most likely explanation for the changes in surface kinetics observed
Modified energetics and growth kinetics on H-terminated GaAs (110)
Energy Technology Data Exchange (ETDEWEB)
Galiana, B. [Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Departamento de Física, Universidad Carlos III de Madrid, Avenida de la Universidad 30, 28911 Madrid (Spain); Benedicto, M.; Díez-Merino, L.; Tejedor, P. [Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Lorbek, S.; Hlawacek, G.; Teichert, C. [Institut für Physik, Montanuniversität Leoben, Franz Josef St., 18A-8700 Leoben (Austria)
2013-10-28
Atomic hydrogen modification of the surface energy of GaAs (110) epilayers, grown at high temperatures from molecular beams of Ga and As{sub 4}, has been investigated by friction force microscopy (FFM). The reduction of the friction force observed with longer exposures to the H beam has been correlated with the lowering of the surface energy originated by the progressive de-relaxation of the GaAs (110) surface occurring upon H chemisorption. Our results indicate that the H-terminated GaAs (110) epilayers are more stable than the As-stabilized ones, with the minimum surface energy value of 31 meV/Å{sup 2} measured for the fully hydrogenated surface. A significant reduction of the Ga diffusion length on the H-terminated surface irrespective of H coverage has been calculated from the FFM data, consistent with the layer-by-layer growth mode and the greater As incorporation coefficient determined from real-time reflection high-energy electron diffraction studies. Arsenic incorporation through direct dissociative chemisorption of single As{sub 4} molecules mediated by H on the GaAs (110) surface has been proposed as the most likely explanation for the changes in surface kinetics observed.
High-Statistics Study of the β+/EC-Decay of 110In
Diaz Varela, A.; Garrett, P. E.; Ball, G. C.; Banjay, J. C.; Cross, D. S.; Demand, G. A.; Finlay, P.; Garnsworthy, A. B.; Green, K. L.; Hackman, G.; Kulp, W. D.; Leach, K. G.; Orce, J. N.; Phillips, A. A.; Rand, E. T.; Svensson, C. E.; Sumithrarachchi, C.; Triambak, S.; Wong, J.; Wood, J. L.; Yates, S. W.
2014-03-01
A study of the 110In β+/EC decay was performed at the TRIUMF Isotope Separator and Accelerator (ISAC) facility to probe the nuclear structure of 110Cd. The data were collected in scaled-down γ-ray singles, γ - γ coincidence, and γ-electron coincidence mode. The data were sorted and a random-background subtracted γ - γ matrix was created containing a total of 850 million events. We expanded the level scheme of 110Cd significantly by identifying 75 levels under 3.8 MeV, including 12 new ones, and increased the number of previously observed transitions from these levels to 273. The γ-ray branching intensities have been extracted through an analysis of the coincidence intensities. The branching ratios were combined with a reanalysis of lifetimes measurements obtained in an (n, n'γ) reaction with monoenergetic neutrons for the calculation of B(E2) values and these results have lead to the proposal of a γ-soft rotor, or O(6) nucleus, rather than a vibrational, or U(5) pattern for the nature of the low-lying, low-spin levels in 110Cd.
High-Statistics Study of the β+/EC-Decay of 110In
Directory of Open Access Journals (Sweden)
Varela A. Diaz
2014-03-01
Full Text Available A study of the 110In β+/EC decay was performed at the TRIUMF Isotope Separator and Accelerator (ISAC facility to probe the nuclear structure of 110Cd. The data were collected in scaled-down γ-ray singles, γ − γ coincidence, and γ-electron coincidence mode. The data were sorted and a random-background subtracted γ − γ matrix was created containing a total of 850 million events. We expanded the level scheme of 110Cd significantly by identifying 75 levels under 3.8 MeV, including 12 new ones, and increased the number of previously observed transitions from these levels to 273. The γ-ray branching intensities have been extracted through an analysis of the coincidence intensities. The branching ratios were combined with a reanalysis of lifetimes measurements obtained in an (n, n'γ reaction with monoenergetic neutrons for the calculation of B(E2 values and these results have lead to the proposal of a γ-soft rotor, or O(6 nucleus, rather than a vibrational, or U(5 pattern for the nature of the low-lying, low-spin levels in 110Cd.
Man in his 50s with chest pain and dyspnoea.
Obayashi, Yuki; Izumi, Chisato; Nakagawa, Yoshihisa
2018-05-01
A man in his 50s with sudden-onset chest pain and dyspnoea was transferred to the emergency room. He had a history of aortic valve replacement due to aortic regurgitation with a mechanical valve 6 years previously. Heart rate was 90 bpm, and blood pressure was too low to measure. In the emergency room, he presented with severe dyspnoea and a chest X-ray showed severe lung congestion (figure 1A). ECG showed complete left bundle branch block. His respiratory status rapidly worsened, and he went into cardiopulmonary arrest. After cardiopulmonary resuscitation, transthoracic echocardiography was performed (figure 1B, online supplementary video 1).DC1SP110.1136/heartjnl-2017-312477.supp1Supplementary file 1 heartjnl;104/10/868/F1F1F1Figure 1(A) Chest X-ray. (B) Colour Doppler image from apical five-chamber view. What is the most likely cause of the patient's cardiopulmonary arrest?Myocardial infarction in left main trunkAortic dissectionProsthetic valve thrombosisProsthetic valve embolisationPulmonary embolism. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
15 CFR 8a.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
.... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... self-evaluation. 8a.110 Section 8a.110 Commerce and Foreign Trade Office of the Secretary of Commerce NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...
33 CFR 110.60 - Captain of the Port, New York.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Captain of the Port, New York... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.60 Captain of the Port, New York. (a) Western... point of origin. (d) New York Harbor. (1) Newark Bay, Southeast. All waters bound by the following...
Shurygin, A. V.; Korochentsev, V. V.; Cherednichenko, A. I.; Mirochnik, A. G.; Kalinovskaya, I. V.; Vovna, V. I.
2018-03-01
Adducts of tris-β-diketonates of the rare earth metal Eu(III) with 1,10-phenanthroline are studied by photoelectron spectroscopy and quantum chemistry methods. The electronic structure, peculiarities of the nature of chemical bonds, and the geometric structure of the adducts are determined. The interpretation of UV photoelectron spectra of vapors and X-ray photoelectron spectra of solid is carried out with the chosen technique. DFT/TDDFT methods make it possible to study the 1,10-phenanthroline molecule influence on the adduct electronic structure and to analyze the electronic effects of substitution of methyl groups by trifluoromethyl groups in the ligands. At transition from the tris-β-diketonate complexes to the adducts, it is observed an increase of the absorption region and a decrease in the energy gap that contributes to the efficiency growth in electronic excitation energy transfer in the ligand-metal. Moreover, phenanthroline displaces water groups, that are luminescence quenchers, from the first coordination sphere, closes coordination in the adduct, and blocks their further attachment. Both factors contribute to an increase in the luminescence intensity.
Structural changes during oxidation of Au(110)
International Nuclear Information System (INIS)
Hale, P.; Thurgate, S.; Wilkie, P.; Parker, A.J.
2000-01-01
Full text: We have constructed an Ultra High vacuum (UHV) system interfaced to an electro-chemical cell. The UHV system is equipped with Low Energy Electron Diffraction (LEED) and X-ray Photoelectron Spectroscopy (XPS). We have used these techniques to examine the oxidation of the Au(110) surface. The gold (110) single crystal exhibits a (2x1) surface structure when clean, but when immersed in 0.01 M HCIO 4 under potential control, the structure has been found to change. Throughout the double layer region the structure remains as (2x1) but when the potential is increased above 0.9-1.0V vs Ag/AgCI, (the pre-oxidation region) the surface structure changes to a centred rectangular structure found to represent a c(2x2) over-layer. This structure is fairly stable and reproducible. After the initial oxidation the structure prevails until 1.2-1.3V whereupon oxidation occurs on a larger scale and the surface structure becomes (1x1). These structures return to (2x1) after the reduction of the oxide, proving that the structural changes are reversible. XPS of these regions has shown a difference in the chemical state of the oxygen. Adsorbed perchlorate ion is initially the only oxygen component but as the potential increases the peak shifts into the hydroxide region and finally it splits into a hydroxide peak and a metal oxide peak. This study indicates a new way of looking at the structure and composition of the gold surface and provides insight into the nature of the interaction between the surface and the solution