Studies of biological effects of fluoride stannous and UV short in Escherichia coli BH110
Energy Technology Data Exchange (ETDEWEB)
Ferreira da C, R., E-mail: rogercosta1@hotmail.com [Federal Institute of Education, Science and Technology of Goias, Campus Uruacu, Rua Formosa Qd 28 e 29, Loteamento Santana, 76400-000 Uruacu, Goias (Brazil)
2015-10-15
Full text: The amount of UV rays on the Earth's surface has increased due to depletion of the ozone layer, and this has worried society, since these radiation although not considered ionizing can cause damage to biological membrane and especially to DNA. The DNA has cell repair mechanisms that can work in lesions caused by electromagnetic radiation such as ultraviolet -short (UV C)and agents causing oxidative stress, such as tin salts. Among the repair mechanisms can highlight the adaptive repair, which consists of smaller doses to cells pre-exposure of an oxidizing agent, and when these cells are exposed to larger doses of the agent even if there is a reduction in mortality rate which leads to complete that repair mechanisms are activated in the pre-exposure reducing cell mortality. Several publications have shown the genotoxic effects of stannous salts such as stannous fluoride (SnF{sub 2}), which shows the importance of the study, since these salts are widely used in industry as components in toothpastes and mouthwashes. So we check whether pretreatment with UV C is able to induce adaptive response reducing the cytotoxic effects caused by exposure of the strains to SnF{sub 2}. We use a strain of Escherichia coli BH110 (BH110 E. coli) deficient in three genes (fpg, nfo and xth) involved in the excision repair bases. To verify the induction of adaptive response to strain BH110 was exposed to various doses of UV C and then treated with SnF{sub 2} a concentration of 110 u M. Our results showed that the LD10 of strain BH110 is 20 J/m{sup 2} and pre-treatment with UV C does not seem to induce adaptive repair in BH110 strains. (Author)
STS-110 Extravehicular Activity (EVA)
2002-01-01
STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.
Directory of Open Access Journals (Sweden)
Jianbo Sun
2016-03-01
Full Text Available The novel Cr-containing low alloy steels have exhibited good corrosion resistance in CO2 environment, mainly owing to the formation of Cr-enriched corrosion film. In order to evaluate whether it is applicable to the CO2 and H2S coexistence conditions, the corrosion behavior of low-chromium steels in CO2-H2S environment with high pressure and high temperature was investigated using weight loss measurement and surface characterization. The results showed that P110 steel suffered localized corrosion and both 3Cr-P110 and 5Cr-P110 steels exhibited general corrosion. However, the corrosion rate of 5Cr-P110 was the highest among them. The corrosion process of the steels was simultaneously governed by CO2 and H2S. The outer scales on the three steels mainly consisted of FeS1−x crystals, whereas the inner scales on Cr-containing steels comprised of amorphous FeS1−x, Cr(OH3 and FeCO3, in contrast with the amorphous FeS1−x and FeCO3 mixture film of P110 steel. The more chromium the steel contains, the more chromium compounds the corrosion products contain. The addition of chromium in steels increases the uniformity of the Cr-enriched corrosion scales, eliminates the localized corrosion, but cannot decrease the general corrosion rates. The formation of FeS1−x may interfere with Cr-enriched corrosion scales and lowering the corrosion performance of 3Cr-P110 and 5Cr-P110 steels.
Sun, Jianbo; Sun, Chong; Lin, Xueqiang; Cheng, Xiangkun; Liu, Huifeng
2016-01-01
The novel Cr-containing low alloy steels have exhibited good corrosion resistance in CO2 environment, mainly owing to the formation of Cr-enriched corrosion film. In order to evaluate whether it is applicable to the CO2 and H2S coexistence conditions, the corrosion behavior of low-chromium steels in CO2-H2S environment with high pressure and high temperature was investigated using weight loss measurement and surface characterization. The results showed that P110 steel suffered localized corrosion and both 3Cr-P110 and 5Cr-P110 steels exhibited general corrosion. However, the corrosion rate of 5Cr-P110 was the highest among them. The corrosion process of the steels was simultaneously governed by CO2 and H2S. The outer scales on the three steels mainly consisted of FeS1−x crystals, whereas the inner scales on Cr-containing steels comprised of amorphous FeS1−x, Cr(OH)3 and FeCO3, in contrast with the amorphous FeS1−x and FeCO3 mixture film of P110 steel. The more chromium the steel contains, the more chromium compounds the corrosion products contain. The addition of chromium in steels increases the uniformity of the Cr-enriched corrosion scales, eliminates the localized corrosion, but cannot decrease the general corrosion rates. The formation of FeS1−x may interfere with Cr-enriched corrosion scales and lowering the corrosion performance of 3Cr-P110 and 5Cr-P110 steels. PMID:28773328
Effect of MeV Electron Radiation on Europa’s Surface Ice Analogs
Gudipati, Murthy; Henderson, Bryana; Bateman, Fred
2017-10-01
MeV electrons that impact Europa’s trailing hemisphere and cause both physical and chemical alteration of the surface and near-surface. The trailing hemisphere receives far lower fluxes above 25 MeV as compared with lower energy particles, but can cause significant chemical and physical modifications at these energies. With NASA's planned Europa Clipper mission and a Europa Lander Concept on the horizon, it is critical to understand and quantify the effect of Europa’s radiation environment on the surface and near surface.Electrons penetrate through ice by far the deepest at any given energy compared to protons and ions, making the role of electrons very important to understand. In addition, secondary radiation - Bremsstrahlung, in X-ray wavelengths - is generated during high-energy particle penetration through solids. Secondary X-rays are equally lethal to life and penetrate even deeper than electrons, making the cumulative effect of radiation on damaging organic matter on the near surface of Europa a complex process that could have effects several meters below Europa’s surface. Other physical properties such as coloration could be caused by radiation.In order to quantify this effect under realistic Europa trailing hemisphere conditions, we devised, built, tested, and obtained preliminary results using our ICE-HEART instrument prototype totally funded by JPL’s internal competition funding for Research and Technology Development. Our Ice Chamber for Europa High-Energy Electron And Radiation-Environment Testing (ICE-HEART) operates at ~100 K. We have also implemented a magnet that is used to remove primary electrons subsequent to passing through an ice column, in order to determine the flux of secondary X-radiation and its penetration through ice.Some of the first results from these studies will be presented and their relevance to understand physical and chemical properties of Europa’s trailing hemisphere surface.This work has been carried out at Jet
Directory of Open Access Journals (Sweden)
Rabea eMüller
2013-03-01
Full Text Available In cells cultured from neocortex of newborn rats, phosphoinositide-3-kinases of class I regulate the DNA synthesis in a subgroup of astroglial cells. We have studied the location of these cells as well as the kinase isoforms which facilitate the S phase entry. Using dominant negative isoforms as well as selective pharmacological inhibitors we quantified S phase entry by nuclear labeling with bromodeoxyuridine. Only in astroglial cells harvested from the marginal zone of the neocortex inhibition of phosphoinositide-3-kinases reduced the nuclear labeling with bromodeoxyuridine, indicating that neocortical astroglial cells differ in the regulation of proliferation. The two kinase isoforms p110 and p110were essential for S phase entry. p110 diminished the level of the p27Kip1 which inactivates the complex of cyclin E and CDK2 necessary for entry into the S phase. p110phosphorylated and inhibited glycogen synthase kinase-3which can prevent S-phase entry. Taken together, both isoforms mediated S phase in a subgroup of neocortical astroglial cells and acted via distinct pathways.
Effect of gamma-radiation on cercariae of Schistosoma incognitum and S. spindale
Energy Technology Data Exchange (ETDEWEB)
Bhaskara Rao, T; Rao, B V; Hafeez, Md [College of Veterinary Sciences, Tirupati (India). Dept. of Parasitology
1989-06-01
In the present study an attempt has been made to study the effect of gamma radiation on cercariae of Schistosoma incognitum and S. spindale in mice at different dose levels of radiation, so as to note differences in their developmental patterns, compared with non-irradiated controls. (author). 10 refs.
Radiation Dose Effects into LCO in Technical Specification by Iodine in Hanul units 1,2
Energy Technology Data Exchange (ETDEWEB)
Lee, Hye Min; Lee, Seung Chan [KHNP Central Research Institute, Daejeon (Korea, Republic of)
2015-05-15
This study estimates the impact of the 1-th coolant system in NPP to the LCO (Limiting Condition of Operation) limits which is in the site boundary. Dose limit is merged into the effective dose from whole body and thyroid dose limits, that is possible to combine the two LCOs to a unified LCO. To estimate the limits, the radiation dose of one of the designed accidents should be chosen to check the radiation dose response. The selected accident is based on Seung Chan Lee's study at KHNP in 2011. Using the selected accident, Iodine dose effect is reviewed depending on the LCO limiting responsibility and the specific behavior. In order to evaluate the radiation dose effect in Technical Specification of Hanul 1,2, SGTR is selected for some sensitivity analysis. From the results, in Hanul site, the case of LOOP plus ADV plus GIS is the most severe case and the dose limit margin is about 110% in LCO.
E.S.R. studies of mechanisms of radiation protection effect by cysteine and cystine
International Nuclear Information System (INIS)
Xue-Peng, L.; Tie-Cheng, T.; Nian-Yun, L.
1981-01-01
By means of E.S.R. the repair mechanism of radiation induced spin transfer from dTMP to cysteine in binary system dTMP-cysteine has been confirmed. Furthermore, a new marked radiation protection effect, exerted by cysteine or cystine on thymine irradiated and observed at low temperature, has been detected. Another sort of fast protection mechanism, including electron transfer and excitation transfer, has been proposed, based on recent advances of primary radiation process of pyrimidine bases and analysed by molecular orbital theory. This fast radiation protection mechanism provides the possibility to utilize electrophilic sulfhydryl protectors for realizing excellent protection effect. (author)
Evaluation of low dose ionizing radiation effect on some blood components in animal model
El-Shanshoury, H.; El-Shanshoury, G.; Abaza, A.
2016-01-01
Exposure to ionizing radiation is known to have lethal effects in blood cells. It is predicted that an individual may spend days, weeks or even months in a radiation field without becoming alarmed. The study aimed to discuss the evaluation of low dose ionizing radiation (IR) effect on some blood components in animal model. Hematological parameters were determined for 110 animal rats (divided into 8 groups) pre- and post-irradiation. An attempt to explain the blood changes resulting from both ...
Perspectives and opportunities for research in radiation effects on materials in the 1990's
International Nuclear Information System (INIS)
Mansur, L.K.
1992-01-01
Needs for research in radiation effects on materials span a broad range, from investigations of fundamental mechanisms to requirements on irradiation parameters suitable for technological studies in no less than a dozen reactor systems and subsystems. In the 1970's, 1980's and again in 1990, workshops were convened to refocus attention on progress and needs in these areas. Critical review papers and smaller meetings have also considered more specialized questions and identified important needs. In the present report, one author's view of current status and desirable avenues for radiation effects research are presented. Issues are discussed covering point defect production and availability, considerations peculiar to widely different classes of materials and radiation effects phenomena, and irradiation conditions needed for current and planned reactor systems. Research recommendations cannot be made independently of the availability of experimental facilities. Needs in the latter area are reflected in the paper
RADIATION EFFECTS IN PHYSICAL AGING OF BINARY As-S AND As-Se GLASSES
International Nuclear Information System (INIS)
Golovchak, Roman; Shpotyuk, O.; Kozdras, A.; Riley, Brian J.; Sundaram, S.K.; McCloy, John S.
2011-01-01
Radiation-induced physical aging effects are studied in binary As x S 100-x and As x Se 100-x (30 (le) x (le) 42) glasses by conventional differential scanning calorimetry (DSC) method. It is shown that γ-irradiation (Co 60 source, ∼ 3 MGy dose) of glassy As x S 100-x caused a measurable increase in glass transition temperature and endothermic peak area in the vicinity of glass transition region, which was associated with acceleration of structural relaxation processes in these materials. In contrast to sulfide glasses, the samples of As-Se family did not exhibit any significant changes in DSC curves after γ-irradiation. The observed difference in radiation-induced physical aging between sulfides and selenides was explained by more effective destruction-polymerization transformations and possible metastable defects formation in S-based glassy network.
Radiation vulcanization of rubbers
Energy Technology Data Exchange (ETDEWEB)
Makuuchi, Keizo [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment
2002-02-01
An abstract of the radiation process of polymer materials and the polymer reaction by radiation is explained. Main radiation is 250 keV to 10 MeV of electron rays in the industry. Radiation cross-linked rubber has less the tensile strength than that by sulfur and organic peroxide crosslinking. The main origins of low tensile strength are caused by cut of backbone chain and ozone depend on radiation. Acceleration of crosslinking and short time of radiation are necessary to improve these defects. To accelerate crosslinking, we used crosslinking accelerators, for example, three poly-functional monomers (PFM). The maximum tensile strength of styrene-butadiene rubber (SBR) not added crosslinking accelerators showed 3 MPa at 110 kGy, but SBR added A-TMMT (tetramethylolmethane tetraacrylate) showed 5.5 MPa at 110 kGy. Radiation crosslinking of many kinds of rubber: isoprene (IR), SBR, CR, nitrile rubber (NBR), hydrogenated nitrile rubber (HNBR), butyl rubber (IIR), chlorinated butyl rubber (CIIR), EPM and TPE are explained. (S.Y.)
Radiation vulcanization of rubbers
International Nuclear Information System (INIS)
Makuuchi, Keizo
2002-01-01
An abstract of the radiation process of polymer materials and the polymer reaction by radiation is explained. Main radiation is 250 keV to 10 MeV of electron rays in the industry. Radiation cross-linked rubber has less the tensile strength than that by sulfur and organic peroxide crosslinking. The main origins of low tensile strength are caused by cut of backbone chain and ozone depend on radiation. Acceleration of crosslinking and short time of radiation are necessary to improve these defects. To accelerate crosslinking, we used crosslinking accelerators, for example, three poly-functional monomers (PFM). The maximum tensile strength of styrene-butadiene rubber (SBR) not added crosslinking accelerators showed 3 MPa at 110 kGy, but SBR added A-TMMT (tetramethylolmethane tetraacrylate) showed 5.5 MPa at 110 kGy. Radiation crosslinking of many kinds of rubber: isoprene (IR), SBR, CR, nitrile rubber (NBR), hydrogenated nitrile rubber (HNBR), butyl rubber (IIR), chlorinated butyl rubber (CIIR), EPM and TPE are explained. (S.Y.)
Qin, Qi-Zhong; Chen, Yu; Fu, Ting-Ting; Ding, Li; Han, Ling-Li; Li, Jian-Chao
2012-03-01
To understand electromagnetic radiation field strength and its influencing factors of certain 110-kV high-voltage lines in one urban area of Chongqing by measuring 110-kV high-voltage line's electromagnetic radiation level. According to the methodology as determined by the National Hygienic Standards, we selected certain adjacent residential buildings, high-voltage lines along a specific street and selected different distances around its vertical projection point as monitoring points. The levels of electromagnetic radiations were measured respectively. In this investigation within the frequency of 5-1,000 Hz both the electric field strength and magnetic field strength of each monitoring sites were lower than the public exposure standards as determined by the International Commission on Non-Ionizing Radiation Protection. However, the electrical field strength on the roof adjacent to the high-voltage lines was significantly higher than that as measured on the other floors in the same buildings (p electromagnetic radiation measurements of different monitoring points, under the same high-voltage lines, showed the location which is nearer the high-voltage line maintain a consistently higher level of radiation than the more distant locations (p Electromagnetic radiation generated by high-voltage lines decreases proportionally to the distance from the lines. The buildings can to some extent shield (or absorb) the electric fields generated by high-voltage lines nearby. The electromagnetic radiation intensity near high-voltage lines may be mitigated or intensified by the manner in which the high-voltage lines are set up, and it merits attention for the potential impact on human health.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Default. 110.110 Section 110.110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Hearings § 110.110 Default. When a participant fails to act within a specified time, the presiding officer may consider him in default, issue an...
Synthesis of Responses to Vatican Statement from 110 U.S. Catholic Colleges.
Gallin, Sr. Alice
1986-01-01
The situation of U.S. Catholic colleges and universities is outlined, and the responses of 110 American Catholic college and university presidents to the Vatican's statement concerning the role and relationships of Catholic universities worldwide are synthesized. (MSE)
11 CFR 110.11 - Communications; advertising; disclaimers (2 U.S.C 441d).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Communications; advertising; disclaimers (2 U.S... AND EXPENDITURE LIMITATIONS AND PROHIBITIONS § 110.11 Communications; advertising; disclaimers (2 U.S... through radio or television, or through any broadcast, cable, or satellite transmission, must comply with...
Radiation processing in the U.S.S.R.
Pikaev, A. K.
The present paper is a short review of the modern status of radiation processing in the U.S.S.R. Data on ionizing radiation sources used in radiation processing are reported. The main directions of the development of this field of technology: radiation modification of materials, radiation curing of coatings, radiation-chemical methods of synthesis, radiation sterilization of medical products, radiation treatment of food, application of ionizing radiation for the solution of ecological problems etc. -are considered.
International Nuclear Information System (INIS)
Dehnbostel, C.; Feltgen, R.; Hoffmann, G.
1990-01-01
The radiative deexcitation cross section for He * (2 1 S) in collisions with He has been measured in the collision energy range from 40 to 110 meV. The experimental results agree well with quantal distorted-wave calculations of Zygelman and Dalgarno [Phys. Rev. A 38, 1877 (1988)]. The measured radiative quenching cross sections for the systems He * (2 1 S)+Ar,Kr,Xe manifest a scaling law for fixed collision energy with α 2 as the scaling parameter, where α is the static dipole polarizability of the heavier rare gas
Effects of correlation in transition radiation of super-short electron bunches
Danilova, D. K.; Tishchenko, A. A.; Strikhanov, M. N.
2017-07-01
The effect of correlations between electrons in transition radiation is investigated. The correlation function is obtained with help of the approach similar to the Debye-Hückel theory. The corrections due to correlations are estimated to be near 2-3% for the parameters of future projects SINBAD and FLUTE for bunches with extremely small lengths (∼1-10 fs). For the bunches with number of electrons about ∼ 2.5 ∗1010 and more, and short enough that the radiation would be coherent, the corrections due to correlations are predicted to reach 20%.
International Nuclear Information System (INIS)
Stephenson, J.D.; Kelhae, V.; Tilli, M.; Tuomi, T.
1978-01-01
'White' synchrotron radiation topography has been employed to reconstruct almost complete, though slightly shape distorted topographs of polycrystalline samples. Those used in the experiments were commercial (110) Fe-3wt%Si crystals containing several misorientated subgrains and were of thickness between 0.15 and 0.20 mm. The topographs were reassembled 'jig-saw puzzle' fashion from photographically enlarged subgrain mini-topographs located near the centres of each film. Magnetic domains were observed in several subgrain topographs recorded in the Laue-reflection and Laue-transmission modes. The technique emphasizes one of the advantages in using 'white' synchrotron radiation to produce rapid high resolution topographs of polycrystalline samples in relatively hazard free radiation conditions. (Auth.)
Czech Academy of Sciences Publication Activity Database
Sedláček, Ondřej; Kučka, Jan; Monnery, B. D.; Šlouf, Miroslav; Vetrík, Miroslav; Hoogenboom, R.; Hrubý, Martin
2017-01-01
Roč. 137, March (2017), s. 1-10 ISSN 0141-3910 R&D Projects: GA ČR(CZ) GA13-08336S; GA MZd(CZ) NV15-25781A; GA MZd(CZ) NV16-30544A; GA MŠk(CZ) LH14079; GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : biocompatible polymers * radiation crosslinking * polymer radiotherapeutics Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 3.386, year: 2016
Effects of Simulated Mobile Phone Electromagnetic Radiation on Fertilization and Embryo Development.
Chen, Hong; Qu, Zaiqing; Liu, Wenhui
2017-04-01
This study investigated the effects of 935-MHz electromagnetic radiation (ER) on fertilization and subsequent embryonic development in mice. Ovulating mice were irradiated at three ER intensities for 4 h/day (d) or 2 h/d for three consecutive days; the ova were then harvested for in vitro fertilization to observe the 6-h fertilization rate (6-FR), 72-h morula rate (72-MR), and 110-h blastula rate (110-BR). Compared with the control group, the 6-FR, 72-MR, and 110-BR were decreased in the low ER intensity group, but the differences were not significant; in the mid- and high-intensity ER groups, 72-MR and 110-BR in the 4 h/d and 2 h/d subgroups were decreased, showing significant differences compared with the control group. Moreover, the comparison between 4 h/d and 2 h/d subgroups showed significant differences. Mid- and high-intensity ER at 935 MHz can reduce the fertilization rate in mice, and reduce the blastulation rate, thus reducing the possibility of embryo implantation.
Effects of Low Dose DD Radiation on Callus Growth of Lithospermum erythrorhizon S
International Nuclear Information System (INIS)
Hwang, H.Y.; Kim, J.S.
2001-01-01
The effect of low dose DD-radiation on the callus growth of Lithospermum erythrorhizon S. cultured on different medium and lighting condition was investigated. The 8 Gy irradiation stimulated callus growth on LS medium supplemented with BA 2 mg/L and NAA 2mg/L, however, the growth of callus was more effective on LS medium supplemented with BA 1 mg/L and NAA 1 mg/L under 16 hrs day light
Energy Technology Data Exchange (ETDEWEB)
Malyar, I. V., E-mail: imalyar@yandex.ru; Stetsyura, S. V., E-mail: stetsyurasv@info.sgu.ru [Chernyshevsky Saratov State University (Russian Federation)
2011-07-15
As a result of a complex study of the heterophase photosensitive material CdS-PbS by the methods of scanning electron microscopy and Auger spectrometry, it has been found that the radiation resistance of this material depends on the morphology and phase composition at its surface. It is shown that, as the temperature of annealing is increased, aggregations with predominant content of PbS grow; simultaneously, the composition of these aggregations varies as a consequence of the reaction of substitution of sulfur atoms with oxygen atoms. The latter of the aforementioned processes brings about a decrease in the radiation resistance of the heterophase photosensitive material CdS-PbS, which is accounted for by a decrease in the gettering due to appearance of an intermediate oxidized layer between PbS and CdS. An increase in the sizes and number of spherical aggregations at the surface, which consist of crystallites with predominant content of PbS, brings about an increase in the radiation resistance.
21 CFR 226.110 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR TYPE A MEDICATED ARTICLES Records and Reports § 226.110 Distribution records. Complete records shall be maintained for each shipment of Type A medicated article(s) in... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 226.110 Section 226.110 Food...
International Nuclear Information System (INIS)
Tatsuno, Ikuro; Tada, Akira; Choutou, Shuichi
1985-01-01
S Adchnon 50 (300 mg/day) was administered, in combination with radiation therapy, to 30 patients with malignancy. Two patients were excluded from the study because one had side effects of S Adchnon 50 and another had leukopenia induced by other drugs. When the rate of decrease in WBC counts was 35 % or less or 45 % or less after the completion of radiation therapy (Criteria I) and when postirradiation WBC counts were 3,500/mm 3 or more (Criteria II), patients were regarded as responding to the drug. WBC counts decreased by 23.4 % during radiation therapy and by 22.5 % after the completion of radiation therapy. The response rates were 79 % for the Criteria I and 89 % for the Criteria II. It is therefore concluded that S Adchnon is an effective and safe drug in preventing leukopenia from radiation therapy. (Namekawa, K.)
[A recent trial of chemo-radiation with S-1 against gastric cancer].
Saikawa, Yoshiro; Kiyota, Tsuyoshi; Nakamura, Rieko; Wada, Norihito; Yoshida, Masashi; Kubota, Tetsuro; Kumai, Koichiro; Shigematsu, Naoyuki; Kubo, Atsushi; Kitajima, Masaki
2006-06-01
A recent development of novel anticancer agents like S-1, CPT-11 or taxanes has improved a therapeutic outcome for advanced gastric cancer, while conventional anticancer agents showed less anticancer effect against gastric cancer. The present main drug in Japan is S-1, which is easily used for outpatient with a high efficacy rate and low toxicity, also shows better effect in combination with other anticancer drugs than S-1 alone. In the present article, we demonstrated significant meaning of additional radiation therapy with anticancer drugs like S-1. With novel anticancer drugs like S-1, we will expose a clinical advantage and appropriateness for chemo-radiation therapy against gastric cancer discussed in the present references according to chemo-radiation therapy. Although chemo-radiation therapy has been recognized as one of the standard therapies for gastric cancer in Western countries, radiation therapy was selected in Japan for palliation therapy of recurrent disease or a terminal cancer to improve patients' QOL. On the other hand, we demonstrated in our trial of chemo-radiation therapy with S-1/low-dose CDDP/radiation (TSLDR), which was applied to initial treatment against highly advanced Stage IV gastric cancer and revealed the usefulness of the regimen in anticancer effect and toxicity. In addition, chemo-radiation therapy including novel anticancer agents like S-1 will be discussed based on various kinds of view points, expecting a better clinical outcome of multimodal therapies against advanced gastric cancer.
International Nuclear Information System (INIS)
Morawek, W.
1991-07-01
In the framework of this thesis the excitation functions of the systems 110 Pd + 110 Pd and 110 Pd + 104 Ru could be measured. The evaporation-residual-nucleus cross sections is deviating from lighter systems dominated by channels, which arise from evaporation of α particles. In the reaction 110 Pd + 110 Pd no xn channels were observed. In comparison to other reactions qualitatively a strong fusion hindrance of this system is shown. (orig./HSI) [de
Nuclear-physical properties of 105,106m,110mAg
International Nuclear Information System (INIS)
Popov, Yu. S.; Zakharova, L. V.; Sadulin, V. V.; Andreev, O. I.; Pakhomov, A. N.
2005-01-01
The nuclear-physical properties of the nuclides 105,106m,110m Ag, which are concomitant nuclides in reactor production of 103 Pd and 109 Cd used in metrology of ionizing radiations and in nuclear medicine, were studied. The following quantities were determined by semiconductor X-ray and γ-ray spectrometry: the parameter K α /K β of X-ray K radiation accompanying the decay of 110m Ag and the intensities of γ-ray quanta with the energies of 280 and 345 keV ( 105 Ag); 430, 451, and 512 keV ( 106m Ag); 658, 764, 885, 938, and 1384 keV ( 110m Ag). The half-lives determined using the above γ-ray lines are as follows: T 1/2 ( 105 Ag) = 41.2 ± 0.1 days; T 1/2 ( 106m Ag) = 8.30 ± 0.07 days. The errors are given for 95% confidence level [ru
Amirhoseiny, M.; Hassan, Z.; Ng, S. S.
2012-08-01
Photoelectrochemical etched Si layers were prepared on n-type (110) oriented silicon wafer. The photoluminescence (PL), Fourier transformed infrared (FTIR) absorption and Raman spectroscopies of etched Si (110) at two different current densities were studied. Both samples showed PL peak in the visible spectral range situated from 650 nm to 750 nm. The corresponding changes in Raman spectra at different current density are discussed. The blue shift in the PL and Raman peaks is consequent of the quantum confinement effect and defect states of surface Si nanocrystallites complexes and hydrogen atoms of the photoelectrochemical etched Si (110) samples. The attenuated total reflection (ATR) results show both hydrogen and oxygen related IR modes in the samples which can be used to explain the PL effect.
Radiation protection effect of selenium on the Rat's prostate
Energy Technology Data Exchange (ETDEWEB)
Choi, Hyung Seok; Choi, Jun Hyeok; Jung, Do Young; Kim, Jang Oh; Shin, Ji Hye; Kim, Joo Hee; Min, Byung In [Inje University, Kimhae (Korea, Republic of)
2017-06-15
High-tech medical equipment has increased the utilization of radiation in the medical field. As a result, research on radiation protection using natural materials has become an important social issue. Selenium is a natural substance that is highly expressed in prostate known that an essential role in prostate cells. Selenium was orally administered to Rat and irradiated with 10 Gy of radiation. Then, the prostate tissue was used as a target organ for 1 day, 7 days and 21 days to investigate the radiation protection effect of selenium through changes of blood components, Superoxide Dismutase and histological changes. As a result, there was a significant protective effect of hematopoietic immune system(hemoglobin concentration, neutrophil, platelet) in the group irradiated with selenium(p<0.05). The observation of tissue changes selenium is an effective component to increase Superoxide Dismutase activity, and it was confirmed that it has an effect of inhibiting the expression of hypertrophy of prostate by irradiation. Therefore, it is considered that selenium can be utilized as a radioprotective agent by inducing prevention of prostate-related diseases.
Efficient reduction of Cys110 thiyl radical by glutathione in human myoglobin
Nagao, Satoshi; Asami, Osamu; Yasui, Hiroyuki; Hirota, Shun
2011-01-01
Human myoglobin (hMb) possesses a cysteine (Cys) residue which is rare among mammalian Mbs. To investigate the effects of this unique Cys residue at the amino acid position 110 (Cys110) on hMb reactions, we studied the reactions of wild type (WT) methMb and its alanine mutant at Cys110 (C110A) with H2O2, particularly in the presence of reduced glutathione (GSH) which is well known as a reducing agent. The formation rates of the ferryloxo (Fe(IV) = O) species by H2O2 under air were about the s...
Radiobiology: Biologic effects of ionizing radiations
International Nuclear Information System (INIS)
Held, K.D.
1987-01-01
The biologic effects after exposure to ionizing radiation, such as cell death or tissue injury, result from a chain of complex physical, chemical, metabolic, and histologic events. The time scale of these radiation actions spans many orders of magnitude. The physical absorption of ionizing radiation occurs in about 10 -18 s, while late carcinogenic and genetic effects are expressed years or even generations later. Collectively, these effects form the science of radiobiology. Many of the concepts discussed in this chapter have been developed through the study of effects generated in tissues by external radiation sources, but they apply generally and often specifically to internally distributed radiopharmaceuticals which form the central topic of this book
24 CFR 110.30 - Effect of failure to display poster.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Effect of failure to display poster... FAIR HOUSING FAIR HOUSING POSTER Enforcement § 110.30 Effect of failure to display poster. Any person... Secretary pursuant to part 105 of this chapter. A failure to display the fair housing poster as required by...
Morgan, William F.
2003-01-01
The goal of this review is to summarize the evidence for non-targeted and delayed effects of exposure to ionizing radiation in vivo. Currently, human health risks associated with radiation exposures are based primarily on the assumption that the detrimental effects of radiation occur in irradiated cells. Over the years a number of non-targeted effects of radiation exposure in vivo have been described that challenge this concept. These include radiation-induced genomic instability, bystander effects, clastogenic factors produced in plasma from irradiated individuals that can cause chromosomal damage when cultured with nonirradiated cells, and transgenerational effects of parental irradiation that can manifest in the progeny. These effects pose new challenges to evaluating the risk(s) associated with radiation exposure and understanding radiation-induced carcinogenesis.
7 CFR 922.110 - Container exemption.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Container exemption. 922.110 Section 922.110... COUNTIES IN WASHINGTON Container Exemption; Waivers of Inspection and Certification § 922.110 Container exemption. Whenever container limitations are effective pursuant to § 922.52, a handler may make test...
Radiation effects in charge coupled devices
International Nuclear Information System (INIS)
Williams, R.A.; Nelson, R.D.
1975-01-01
Charge coupled devices (CCD s) exhibit a number of advantages (low cost, low power, high bit density) in their several applications (serial memories, imagers, digital filters); however, fairly elementary theoretical considerations indicate that they will be very vulnerable to permanent radiation damage, by both neutrons and ionizing radiation, and to transient upset by pulsed ionizing radiation. Although studies of permanent ionizing-radiation damage in CCD's have been reported, little information has been published concerning their overall nuclear radiation vulnerability. This paper presents a fairly comprehensive experimental study of radiation effects in a 256-cell surface-channel, CCD shift-register. A limited amount of similar work is also presented for a 128-cell surface-channel device and a 130 cell peristaltic CCD shift register. The radiation effects phenomena discussed herein, include transient-ionizing-radiation responses, permanent ionizing- radiation damage to transfer efficiency, charge-carrying capacity and input transfer gate bias, and neutron damage to storage time--determined from dark current and charge-up time measurements
Li, Sheng-Shi; Ji, Wei-Xiao; Li, Ping; Hu, Shu-Jun; Cai, Li; Zhang, Chang-Wen; Yan, Shi-Shen
2017-06-28
The quantum spin Hall (QSH) effect is promising for achieving dissipationless transport devices due to their robust gapless edge states inside insulating bulk gap. However, the currently discussed QSH insulators usually suffer from ultrahigh vacuum or low temperature due to the small bulk gap, which limits their practical applications. Searching for large-gap QSH insulators is highly desirable. Here, the tunable QSH state of a Bi(110) films with a black phosphorus (BP) structure, which is robust against structural deformation and electric field, is explored by first-principles calculations. It is found that the two-monolayer BP-Bi(110) film obtains a tunable large bulk gap by strain engineering and its QSH effect shows a favorable robustness within a wide range of combinations of in-plane and out-of-plane strains, although a single in-plane compression or out-of-plane extension may restrict the topological phase due to the self-doping effect. More interestingly, in view of biaxial strain, two competing physics on band topology induced by bonding-antibonding and p x,y -p z band inversions are obtained. Meanwhile, the QSH effect can be persevered under an electric field of up to 0.9 V/Å. Moreover, with appropriate in-plane strain engineering, a nontrivial topological phase in a four-monolayer BP-Bi(110) film is identified. Our findings suggest that these two-dimensional BP-Bi(110) films are ideal platforms of the QSH effect for low-power dissipation devices.
Therapeutic effect of beta radiation on onychomycosis: An innovative treatment
International Nuclear Information System (INIS)
Afroz, S.; Islam, N.; Rashid, H.; Shahidullah, M.; Ali, S.; Islam, S.K.M.; Hossain, S.; Ali, N.
2005-01-01
Full text: Onychomycosis is the most frequent cause of nail disease and the most prevalent type of dermatophytosis in Bangladesh. The humid and warm climate of this tropical country is congenial for the growth of fungi. Therapeutic limitations of conventional antimycotic agents in respect of low cure rates, high relapse rate, inherent side effects, long duration of treatment and high cost in treating onychomycosis have provided clear incentives to explore alternative forms of treatment procedure. The objectives of the present thesis work were: (i) To use beta radiation as a curative therapy for Onychomycosis, optimisation of its dosages and to promote an innovative clinical development in the field of therapeutic application of nuclear medicine; (ii) To assess the efficacy of beta radiation either alone or in combination with conventional antifungal therapy; and (iii) To reduce the duration of drug exposure and cost of treatment for onychomycosis. This is a PhD research work under the University of Dhaka and was sponsored by the Ministry of Science and Information and Communication Technology, Government of the people's republic of Bangladesh. This study is an open, randomised and controlled trial to verify the efficacy of beta radiation in patients with onychomycosis. Using the appropriate statistical formula, sample size of the study population was determined and in each group 92 patients were assigned. With an assumption of patients drop out and for better statistical analysis, a total of 330 patients, who fulfilled the inclusion criterion having diagnosed to have onychomycosis clinically and mycological were randomly allocated to enter in therapeutic regimen. Study population was randomised in three groups. Group A (n =110) received griseofulvin orally 500 mg once daily for 12-16 weeks; Group B (n=110) received beta radiation, 500 rads bi-weekly for 3 weeks (total 2500 rads); and Group C (n=110) received combined beta radiation (total 2500 rads in 3 weeks) and
29 CFR 1978.110 - Judicial review.
2010-07-01
... Labor, shall not be subject to judicial review in any criminal or other civil proceedings (49 U.S.C... law judge, shall be transmitted by the Administrative Review Board, United States Department of Labor... 29 Labor 9 2010-07-01 2010-07-01 false Judicial review. 1978.110 Section 1978.110 Labor...
International Nuclear Information System (INIS)
Gorelic, L.; Parker, D.
1978-01-01
The effects of 254-nm radiation on the structural integrities of free and 50S ribosome-bound 5S and 23S ribosomal ribonucleic acids (rRNA) have been elucidated. Irradiation of aqueous solutions of Escherichia coli 50S ribosomes with 253.7-nm radiation results in the formation of single-strand breaks in double-stranded regions of the 23S rRNA component, but not in rRNA chain scission, and destabilization of the secondary structure of the 23S rRNA toward denaturation. The minimum doses of 253.7-nm radiation required for the first detection of the two effects are 7 x 10 19 quanta for the production of single-strand breaks in double-stranded regions of the 23S rRNA, and 19 quanta for destabilization of the 23S rRNA secondary structure. Free 23S rRNA is resistant toward photoinduced chain breakage at doses of 253.7-nm radiation up to at least 2.3 x 10 20 and is much less sensitive toward destabilization of secondary structure than ribosome-bound 23S rRNA. In contrast to the photosensitivity of 50S ribosome-bound 23S rRNA toward chain breakage, 50S ribosome-bound 5S rRNA is resistant toward chain breakage at doses of 253.7-nm radiation up to at least 2.3 x 10 20 quanta. Ribosome-bound 5S and 23S rRNA are also not photosensitive toward intermolecular 5S/23S rRNA cross-linkage
International Nuclear Information System (INIS)
Saad, Moez Ben; Rohnean, Adela; Sigal-Cinqualbre, Anne; Adler, Ghazal; Paul, Jean-Francois
2009-01-01
There are only a few reports on the diagnostic accuracy, and the technical and clinical feasibility, of multidetector CT (MDCT) in infants with congenital heart disease (CHD). To evaluate the image quality and radiation dose of DSCT in babies with CHD. From November 2006 to November 2007, 110 consecutive infants with CHD referred for pre- or postoperative CT evaluation were included. All these infants had a spiral angiothoracic DSCT scan after injection of 300 mg/ml iopromide at 0.5-1 ml/s with a power injector using a low-dose protocol (80 kVp and 10 mAs/kg). Of these infants, 34 also underwent an ECG-gated coronary CT scan for evaluation of the course of the coronary arteries. No serious adverse events were recorded. The mean dose-length product was 8±6 mGy.cm (effective dose 0.5±0.2 mSv) and 21±9 mGy.cm (effective dose 1.3±0.6 mSv) during the non-ECG-gated spiral acquisition and ECG-gated acquisition, respectively. Diagnostic quality images were achieved with the spiral acquisition in 89% of cases. Compared to the spiral mode, ECG-gated acquisition significantly improved the visualization of the coronary arteries, with a diagnostic rate of 91% and 84% for the left and right coronary arteries, respectively. DSCT together with iopromide at 300 mg/ml is a valuable tool for the routine clinical evaluation of infants with CHD. ECG-gated acquisition provides reliable visualization of the course of the coronary arteries. (orig.)
Modeling Radiation Effectiveness for Inactivation of Bacillus Spores
2015-09-17
radiation . 3.6.1 Ionizing Radiation Damage. Some of the ROS’ discussed in Section 3.3 cause indirect damage to the spore’s DNA. They can produce... ionizing radiation damage has focused on the effects of charged particles in their tracks. The charged particles create radiation - induced products and...3.8.1 Reaction-Diffusion of ROS Within the Spore. A demonstrative scenario will be explored in order to simulate the indirect effects of ionizing
Directory of Open Access Journals (Sweden)
Nevy Triditha Putri
2016-12-01
Full Text Available Intraoral periapical radiograph examination is the additional examination which is the most widely used in Dentistry. This radiograph examination using an x-ray ionizing radiation with low LET (Linear Energy Transfer, and may affect submandibular salivary gland. Ionizing radiation exposure can cause damage by inducing a series of changes at the molecular and cellular level. This study aimed to prove the effects of x-ray ionizing radiation with low LET towards the catalase activity of Rattus norvegicus strain Wistar’s submandibular gland. The subjects were 28 male Wistar rats and divided into 4 groups (n=7. Three groups were exposed 4, 8 and 14 times to radiation with 0.002 µSv for each exposure. The catalase activity of each rat was examined by a spectrophotometer. Data were analyzed using one-way ANOVA followed by Bonferroni test. The results showed the average of catalase activity on Wistar rat’s submandibular gland, respectively for: 0.150±0.0895 (KK, 0.1405±0.0607 (K1, 0.1228±0.0290 (K2, 0.1227±0.0556 (K3. Data showed significant differences of catalase activity between test groups, but showed not significant differences of catalase activity between each groups of Rattus norvegicus strain Wistar’s submandibular gland. In this study concluded decreased catalase activity of Rattus norvegicus strain Wistar’s submandibular gland resulting from x-rays ionizing radiation by 4 times, 8 times and 14 times exposures.
Effectiveness of radiation processing in elimination of Campylobacter from poultry meat
International Nuclear Information System (INIS)
Raut, Amol D.; Shashidhar, Ravindranath; Bandekar, Jayant R.; Kapadnis, Balu P.
2012-01-01
Campylobacter, a common poultry intestine commensal, is a well known cause of human gastric illnesses across the globe. Consumption of contaminated poultry meat is a major cause of Campylobacter related infections. In the present study, radiation sensitivity of indigenous strains of C. jejuni and C. coli isolated from poultry was evaluated. The decimal reduction dose (D 10 ) values of different Campylobacter isolates at 0-4 o C in saline and blood broth were in the range of 0.120-0.210 kGy and 0.170-0.234 kGy, respectively. D 10 values in chicken meat homogenate for Campylobacter were in the range of 0.110-0.190 kGy. Chicken meat samples were inoculated with C. jejuni and exposed to gamma radiation to study the effectiveness of radiation treatment in elimination of Campylobacter. Radiation treatment with a dose of 1 kGy could achieve complete elimination of 10 5 CFU of Campylobacter/g in poultry meat samples. No recovery of Campylobacter was observed, even after enrichment and selective plating in 1 kGy treated chicken meat samples stored at 4 o C up to 7 days. Present study shows that irradiation of poultry meat with 1 kGy can ensure safety of poultry meat. - Highlights: → Campylobacter isolates were sensitive to gamma radiation. → Low dose of 1 kGy is effective for 5-log reduction of Campylobacter in chicken meat. → No recovery of Campylobacter in radiation processed samples during storage. → First report on radiation sensitivity of Indian Campylobacter isolates.
Effectiveness of radiation processing in elimination of Campylobacter from poultry meat
Energy Technology Data Exchange (ETDEWEB)
Raut, Amol D. [Department of Microbiology, University of Pune, Pune, Ganeshkhind 411007 (India); Shashidhar, Ravindranath [Food Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Bandekar, Jayant R., E-mail: jrb@barc.gov.in [Food Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kapadnis, Balu P. [Department of Microbiology, University of Pune, Pune, Ganeshkhind 411007 (India)
2012-01-15
Campylobacter, a common poultry intestine commensal, is a well known cause of human gastric illnesses across the globe. Consumption of contaminated poultry meat is a major cause of Campylobacter related infections. In the present study, radiation sensitivity of indigenous strains of C. jejuni and C. coli isolated from poultry was evaluated. The decimal reduction dose (D{sub 10}) values of different Campylobacter isolates at 0-4 {sup o}C in saline and blood broth were in the range of 0.120-0.210 kGy and 0.170-0.234 kGy, respectively. D{sub 10} values in chicken meat homogenate for Campylobacter were in the range of 0.110-0.190 kGy. Chicken meat samples were inoculated with C. jejuni and exposed to gamma radiation to study the effectiveness of radiation treatment in elimination of Campylobacter. Radiation treatment with a dose of 1 kGy could achieve complete elimination of 10{sup 5} CFU of Campylobacter/g in poultry meat samples. No recovery of Campylobacter was observed, even after enrichment and selective plating in 1 kGy treated chicken meat samples stored at 4 {sup o}C up to 7 days. Present study shows that irradiation of poultry meat with 1 kGy can ensure safety of poultry meat. - Highlights: > Campylobacter isolates were sensitive to gamma radiation. > Low dose of 1 kGy is effective for 5-log reduction of Campylobacter in chicken meat. > No recovery of Campylobacter in radiation processed samples during storage. > First report on radiation sensitivity of Indian Campylobacter isolates.
Effect of calcium-binding protein S100A8 expression on early phase of radiation pulmonary fibrosis
International Nuclear Information System (INIS)
Rao Yalan; Li Ming; Cong Yue; Li Fengsheng; Chen Xiaohua; Dong Bo; Zhang Junquan; Gao Ling; Mao Bingzhi
2008-01-01
The study explores the expression and effect of calcium-binding protein S100A8 on early phase of radiation pulmonary fibrosis via in vivo and in vitro experiments. In vivo experiment, the thoracic regions of rats were irradiated under 20Gy 60 Co γ-rays to establish radiation pulmonary fibrosis. After irradiation, the lung specimens of the sacrificed rats were separately harvested by the ends of the first, second, and fourth weeks respectively. The protein expression of S100A8 was tested through immunohistochemistry, the mRNA expression of S100A8 and its heterodimeric S100A9 were investigated by RT-PCR method. In vitro experiment, RT-PCR method was also applied to measure the mRNA expression of S100A8 in mouse macrophage cell line RAW264.7 after γ-rays irradiation and/or lipopolysaccharide (LPS). It shows that the protein expression of S100A8 was increased in the plasma of lung macrophages samples and the mRNA expression of S100A8 and S100A9 was also increased in the lung tissue samples in four weeks after irradiation in vivo experiment. And in vitro experiment it shows that the cooperation between γ-rays and LPS can increase the mRNA expression of S100A8 in RAW264.7. These phenomena suggest that S100A8 can exert the chemotactic activity, participate in the inflammatory response, and influence the establishment of radiation pulmonary fibrosis. (authors)
49 CFR 110.110 - After-grant requirements.
2010-10-01
... PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.110 After-grant requirements. The Associate... must submit all financial, performance, and other reports required as a condition of the grant, within...
Exposure to Mobile Phone Radiation Opens New Horizons in Alzheimer’s Disease Treatment
Mortazavi, SAR; Shojaei-Fard, MB; Haghani, M; Shokrpour, N; Mortazavi, SMJ
2013-01-01
Alzheimer’s disease, the most common type of dementia and a progressive neurodegenerative disease, occurs when the nerve cells in the brain die. Although there are medications that can help delay the development of Alzheimer’s disease, there is currently no cure for this disease. Exposure to ionizing and non-ionizing radiation may cause adverse health effects such as cancer. Looking at the other side of the coin, there are reports indicating stimulatory or beneficial effects after exposure to cell phone radiofrequency radiation. Mortazavi et al. have previously reported some beneficial cognitive effects such as decreased reaction time after human short-term exposure to cell phone radiation or occupational exposure to radar microwave radiation. On the other hand, some recent reports have indicated that RF radiation may have a role in protecting against cognitive impairment in Alzheimer’s disease. Although the majority of these data come from animal studies that cannot be easily extrapolated to humans, it can be concluded that this memory enhancing approach may open new horizons in treatment of cognitive impairment in Alzheimer disease. PMID:25505755
Exposure to Mobile Phone Radiation Opens New Horizons in Alzheimer’s Disease Treatment
Directory of Open Access Journals (Sweden)
Mortazavi SAR
2013-09-01
Full Text Available Alzheimer’s disease, the most common type of dementia and a progressive neurodegenerative disease, occurs when the nerve cells in the brain die. Although there are medications that can help delay the development of Alzheimer’s disease, there is currently no cure for this disease. Exposure to ionizing and non-ionizing radiation may cause adverse health effects such as cancer. Looking at the other side of the coin, there are reports indicating stimulatory or benefcial effects after exposure to cell phone radiofrequency radiation. Mortazavi et al. have previously reported some benefcial cognitive effects such as decreased reaction time after human short-term exposure to cell phone radiation or occupational exposure to radar microwave radiation. On the other hand, some recent reports have indicated that RF radiation may have a role in protecting against cognitive impairment in Alzheimer’s disease. Although the majority of these data come from animal studies that cannot be easily extrapolated to humans, it can be concluded that this memory enhancing approach may open new horizons in treatment of cognitive impairment in Alzheimer disease.
Directory of Open Access Journals (Sweden)
Wilhelm Rojewski
2015-06-01
Full Text Available The paper discusses the interoperability of the German compensated 110 kV grid and the Polish effectively earthed 110 kV grid. It is assumed that an area of one grid, separated from its power system, will be temporarily supplied from the other grid in its normal regime. Reference is made to the risks associated with phase-to-earth faults in grids so interconnected. Particular attention is paid to the working conditions of surge arresters and voltage transformers in the Polish 110 kV grid deprived of its neutral earthing when supplied from the German grid.
Acute Radiation Effects Resulting from Exposure to Solar Particle Event-Like Radiation
Kennedy, Ann; Cengel, Keith
2012-07-01
A major solar particle event (SPE) may place astronauts at significant risk for the acute radiation syndrome (ARS), which may be exacerbated when combined with other space flight stressors, such that the mission or crew health may be compromised. The National Space Biomedical Research Institute (NSBRI) Center of Acute Radiation Research (CARR) is focused on the assessment of risks of adverse biological effects related to the ARS in animal models exposed to space flight stressors combined with the types of radiation expected during an SPE. As part of this program, FDA-approved drugs that may prevent and/or mitigate ARS symptoms are being evaluated. The CARR studies are focused on the adverse biological effects resulting from exposure to the types of radiation, at the appropriate energies, doses and dose-rates, present during an SPE (and standard reference radiations, gamma rays or electrons). The ARS is a phased syndrome which often includes vomiting and fatigue. Other acute adverse biologic effects of concern are the loss of hematopoietic cells, which can result in compromised bone marrow and immune cell functions. There is also concern for skin damage from high SPE radiation doses, including burns, and resulting immune system dysfunction. Using 3 separate animal model systems (ferrets, mice and pigs), the major ARS biologic endpoints being evaluated are: 1) vomiting/retching and fatigue, 2) hematologic changes (with focus on white blood cells) and immune system changes resulting from exposure to SPE radiation with and without reduced weightbearing conditions, and 3) skin injury and related immune system functions. In all of these areas of research, statistically significant adverse health effects have been observed in animals exposed to SPE-like radiation. Countermeasures for the management of ARS symptoms are being evaluated. New research findings from the past grant year will be discussed. Acknowledgements: This research is supported by the NSBRI Center of Acute
Effect of different treatments on 110m Ag plant uptake in various soil types
International Nuclear Information System (INIS)
Szerbin, P.; Koblinger-Bokori, E.
1996-01-01
110m Ag contamination may occur as a result of atmospheric release either during normal operation of nuclear power plants or in accidental circumstances. The gamma peaks of 110m Ag and radiocaesium are very close, and not every laboratory could make distinction between them. Therefore very few references are available on 110m Ag environmental behaviour and plant uptake. In the present study plant uptake of 110m Ag from four different types of soil was investigated, and the results are presented in relation to major soil characteristics. In addition, effects of two different treatments (phosphate and organic matter fertilizations) are determined in each type of soil. Our study clearly demonstrates that a carefully selected post-accident treatment can significantly reduce the environmental consequences of radioactive releases. Methods to be developed on bases of such studies could be used for remedial actions of agricultural lands polluted with radioactive substances
STS-110 M.S. Ross in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-110 Mission Specialist Jerry Ross waits his turn at driving the M-113 armored personnel carrier, part of Terminal Countdown Demonstration Test activities. In the background, right, is Mission Specialist Lee Morin. TCDT includes emergency egress training and a simulated launch countdown, and is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
International Nuclear Information System (INIS)
Lorenzo, P.
1997-01-01
Losses in rice grain in quantity and quality during storage are caused by insects infestations. In this paper the effect of 60 Co gamma radiation on the mortality of Oryzaephilus surinamensis L., Cryptolestes pusillus S. and Cryptolestes ferrugineus S. adults was study. Insects were irradiated with doses from 0,20 to 1,00 kGy at dose rates from 0,97 to 0,94 kGy.h -1 . After the treatment, the radiation damages were evaluated taking in consideration the sterility and mortality produced in the irradiated populations. According to the experimental results it was confirmed that irradiation doses from 0,40 to 0,60 kGy were effective to control the insects pests of stored rice in Cuba [es
International Nuclear Information System (INIS)
Gomes, R.A.
1976-01-01
The stages of processes leading to radiation damage are studied, as well as, the direct and indirect mechanics of its production. The radiation effects on nucleic acid and protein macro moleculas are treated. The physical and chemical factors that modify radiosensibility are analysed, in particular the oxygen effects, the sensibilization by analogues of nitrogen bases, post-effects, chemical protection and inherent cell factors. Consideration is given to restoration processes by excision of injured fragments, the bloching of the excision restoration processes, the restoration of lesions caused by ionizing radiations and to the restoration by genetic recombination. Referring to somatic effects of radiation, the early ones and the acute syndrome of radiation are discussed. The difference of radiosensibility observed in mammalian cells and main observable alterations in tissues and organs are commented. Referring to delayed radiation effects, carcinogeneses, alterations of life span, effects on growth and development, as well as localized effects, are also discussed [pt
DEFF Research Database (Denmark)
Sambaraju, R.; Zibar, Darko; Caballero Jambrina, Antonio
2010-01-01
Record wireless signal capacity of up to 40 Gb/s is demonstrated in the 75-110 GHz band. All-optical OFDM and photonic up-conversion are used for generation and digital coherent detection for demodulation....
Emission of Lyman α radiation in H2 + H*(2s) collisions at thermal energies
International Nuclear Information System (INIS)
Stern, B.
1991-01-01
A previously-published study of the thermal-energy collision between H 2 and metastable H*(2s), which could lead to the emission of Lyman α radiation, is reconsidered to take into account possible polarization effects. The total was function of the system is expanded in terms of the molecular states of the intermediate complex H 2 * , which constitute the minimal basis of the four adiabatic states dissociating into H 2 + H*(n=2) where they are normally degenerate in energy. The results of the calculation show the existence, between three of those states, of average values of the separation distance R (R ≅ 10 atomic units) of long range (ΔR ≅ 2 au) electronic interactions which depend on the geometric form of the H 2 * molecule. From the molecular data the hypothesis of no longer considering H 2 with H*(2s) as a rigid rotator is postulated and justified, after a purely quantum mechanical treatment of the radial equations. The mean ratio of the (oscillating) polarization angular differential cross sections tot he elastic ones is found important (> ∼ 1/10). The inelastic phenomena are anticipated to be more marked in the ortho than in the para hydrogen at a low collision energy (75 meV). (15 refs., 2 tabs., 9 figs.)
Effective electron collection in highly (110)-oriented ZnO porous nanosheet framework photoanode
International Nuclear Information System (INIS)
Wang Xiangyan; Tian Zhipeng; Yu Tao; Tian Hanmin; Zhang Jiyuan; Yuan Shikui; Zhang Xiaobo; Li Zhaosheng; Zou Zhigang
2010-01-01
A highly (110)-oriented ZnO porous nanosheet framework is designed as the photoanode in photoelectrochemical systems, by virtue of its anisotropic electronic properties. It can be facilely prepared in large scale via a hydrothermal method. X-ray diffraction (XRD) analyses show that the orientation index of the (110) diffraction plane is 3.54, indicating the films possess (110) preferred orientation. Field-emission scanning electron microscope (FE-SEM) images exhibit that most of the nanosheets stand nearly perpendicularly on the substrate. The {002} lattice planes work just like conducting wires and induce the electrons to transport to the substrate. Chronoamperometry measurement demonstrates an effective electron collection. When the nanostructured photoanode is introduced to dye-sensitized solar cells, a conversion efficiency of 3.7% is obtained. The photoanode also has potential application in the other photoelectrochemical systems, such as photocatalytical splitting of water.
Health effects in residents of high background radiation regions
International Nuclear Information System (INIS)
Hanson, G.P.
1984-01-01
Although the health effects of radiation doses in occupationally exposed persons had received attention, it was not until the 1950s, when the atmospheric atom bomb tests of the United States and the Soviet Union had raised the level of environmental radioactivity, that the long-term effects of low-level radiation dosage became a matter of popular concern throughout the world. The United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR) was created, and the World Health Organization (WHO) appointed an expert committee to provide advice concerning radiation and human health. In its first report, the WHO expert committee identified several areas of high natural radiation where studies of the exposed population might possibly provide information concerning the effects of chromic low-level radiation dosage
CARCINOGENIC EFFECTS OF LOW DOSES OF IONIZING RADIATION
Carcinogenic Effects of Low Doses of Ionizing RadiationR Julian Preston, Environmental Carcinogenesis Division, NHEERL, U.S. Environmental Protection Agency, Research Triangle Park, NC 27711The form of the dose-response curve for radiation-induced cancers, particu...
Energy Technology Data Exchange (ETDEWEB)
Uematsu, Minoru (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Radiology Dept. of Radiology, National Defense Medical College, Saitama (Japan)); Kondo, Makoto (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Radiology); Hiramatsu, Hideko (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Radiology); Ikeda, Yasuo (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Hematology); Mikata, Sumio (Chiba Univ. (Japan). School of Medicine); Katayama, Michiaki (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Radiology); Ito, Hisao (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Radiology); Kusano, Shoichi (Dept. of Radiology, National Defense Medical College, Saitama (Japan)); Kubo, Asuchishi (Keio Univ. School of Medicine, Tokyo (Japan). Dept. of Radiology)
1993-01-01
Seventeen patients with stage IA non-Hodgkin's lymphoma of the Waldeyer's ring were treated with radiation therapy with or without chemotherapy. All lesions were judged as having intermediate grade malignancy in the Working Formulation. Eight patients received combined treatment with three cycles of cylcophosphamide, doxorubicin, vincristine and prednison (CHOP) and radiation therapy with 30 to 40 Gy. Another 9 patients were treated with radiation therapy 40 to 60 Gy alone. After a median follow-up of 69 months, all 8 patients, treated with combined modality were alive and relapse-free whereas 4 of the 9 treated with irradiation alone had relapsed. All relapses occurred transdiaphragmatically. Two of the 4 relapsing patients were saved, but the other two died of the disease. The 5-year relapse-free and cause-specific survival rates were 100% and 100% in the combined modality group, and 56% and 76% in the radiation therapy alone group (relapse-free: p=0.04, cause-specific: p=0.16). There were no serious complications related to treatment, although most patients complained of mouth dryness and most patients given CHOP had paresthesia. Our opinion was that the total impact of these two side-effects on quality of life was less pronounced after combined modality than after radiation therapy alone. Limited chemotherapy and radiation therapy seemed to be more beneficial than radiation therapy alone not only in relapse-free survival but also in quality of life after treatment. (orig.).
The transient radiation effects and hardness of programmed device
International Nuclear Information System (INIS)
Du Chuanhua; Xu Xianguo; Zhao Hailin
2014-01-01
A review and summary of research and development in the investigation of transient ionizing radiation effects in device and cirviut is presented. The transient ionizing radiation effects in two type of programmed device, that's 32 bit Microcontroller and antifuse FPGA, were studied. The expeiment test data indicate: The transient ionizing radiation effects of 32 bit Microcontroller manifested self-motion restart and Latchup, the Latchup threshold was 5 × 10"7 Gy (Si)/s. The transient ionizing radiation effects of FPGA was reset, no Latchup. The relationship of circuit effects to physical mechanisms was analized. A new method of hardness in circiut design was put forward. (authors)
Biological effects of radiation and health risks from exposure to low levels of ionizing radiation
International Nuclear Information System (INIS)
Kotian, Rahul P.; Kotian, Sahana Rahul; Sukumar, Suresh
2013-01-01
The very fact that ionizing radiation produces biological effects is known from many years. The first case of injury reported by Sir Roentgen was reported just after a few months after discovery of X-rays in 1895. As early as 1902, the first case of X-ray induced cancer was reported in the literature. Early human evidence of harmful effects as a result of exposure to radiation in large amounts existed in the 1920s and 1930s, based upon the experience of early radiologists, miners exposed to airborne radioactivity underground, persons working in the radium industry, and other special occupational groups. The long-term biological significance of smaller, repeated doses of radiation, however, was not widely appreciated until relatively recently, and most of our knowledge of the biological effects of radiation has been accumulated since World War II. The mechanisms that lead to adverse health effects after exposure to ionizing radiation are still not fully understood. Ionizing radiation has sufficient energy to change the structure of molecules, including DNA, within the cells of the body. Some of these molecular changes are so complex that it may be difficult for the body's repair mechanisms to mend them correctly. However, the evidence is that only a small fraction of such changes would be expected to result in cancer or other health effects. The most thoroughly studied individuals for the evaluation of health effects of ionizing radiation are the survivors of the Hiroshima and Nagasaki atomic bombings, a large population that includes all ages and both sexes.The Radiation Effects Research Foundation (RERF) in Japan has conducted followup studies on these survivors for more than 50 years. An important finding from these studies is that the occurrence of solid cancers increases in proportion to radiation dose. More than 60% of exposed survivors received a dose of radiation of less than 100 mSv (the definition of low dose used by the BEIR VII report). (author)
33 CFR 118.110 - Daymarks and lateral lighting on bridges.
2010-07-01
... bridges. 118.110 Section 118.110 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LIGHTING AND OTHER SIGNALS § 118.110 Daymarks and lateral lighting on bridges. (a... through bridges with U.S. aids to navigation system lateral marks and lights installed on the...
Genetical effects of radiations from products of nuclear explosions
Energy Technology Data Exchange (ETDEWEB)
Spiers, F W
1955-01-01
Relative radiation dose-rates to man and to Drosophila are discussed. Data previously presented by Prof. J.B.S. Haldane on the genetical effects of radiation resulting from nuclear explosions are reviewed. A reply from Prof. Haldane presents revised calculations of radiation dose rates.
Radiation-induced caries as the late effect of radiation therapy in the head and neck region
Directory of Open Access Journals (Sweden)
Katarzyna Dobroś
2015-10-01
Full Text Available Overall improvement in the nationwide system of medical services has consequently boosted the number of successfully treated patients who suffer from head and neck cancer. It is essential to effectively prevent development of radiation-induced caries as the late effect of radiation therapy. Incidence and severity of radiation-induced changes within the teeth individually vary depending on the patient’s age, actual radiation dose, size of radiation exposure field, patient’s general condition and additional risk factors. Inadequately managed treatment of caries may lead to loss of teeth, as well as prove instrumental in tangibly diminishing individual quality of life in patients. Furthermore, the need to have the teeth deemed unyielding or unsuitable for the application of conservative methods of treatment duly extracted is fraught for a patient with an extra hazard of developing osteoradionecrosis (ORN, while also increasing all attendant therapeutic expenditures. The present paper aims to offer some practical insights into currently available methods of preventing likely development of radiation-induced caries.
Fiber Wireless Transmission of 8.3 Gb/s/ch QPSK-OFDM Signals in 75-110 GHz Band
DEFF Research Database (Denmark)
Deng, Lei; Beltrán Ramírez, Marta; Pang, Xiaodan
2012-01-01
In this paper, we present a scalable high speed Wband (75-110 GHz) fiber wireless communication system. By using an optical frequency comb generator, 3-channel 8.3 Gb/s/ch optical orthogonal frequency division multiplexing (OOFDM) baseband signals in a 15 GHz bandwidth are seamlessly translated f...
Effects of radiation on photographic film. A study
International Nuclear Information System (INIS)
Dutton, D.M.
1971-01-01
This study of the effects of radiation on photographic film is related to the Nevada Test Site's underground nuclear testing program, which has been active since implementation of the Limited Test Ban Treaty of 1963. Residual radioactivity, which has accidentally been released on several tests, adversely affects the photographic film used in test data acquisition. The report defines this problem in terms of radiation-caused image degradation, radiation/matter interactions, types of radiation released by accidental venting, and the photographic effects of gamma and x radiation. Techniques and experimental findings are documented that may be useful in recovering information from radiation-fogged film. Techniques discussed include processing methods, shielding, image enhancement techniques, and operational handling of potentially irradiated film. (U.S.)
Performance Enhancement of Power Transistors and Radiation effect
International Nuclear Information System (INIS)
Hassn, Th.A.A.
2012-01-01
amplification factor (β+1) controlled in the transistor stability under radiation filed, and the external temperature effects. Stability factors S(ICO) ,S(VBE) and S(β) were studied under the effect of radiation and temperature, where S(ICO) were sensitive to radiation while S(VBE) and S(β) were more affected by temperature. The effect of radiation and temperature were various for the same type NPN of device BJT with different models.The main objective of this scientific research is studying the characteristic of bipolar junction transistor device and its performance under radiation fields and temperature effect as a control element in many power circuits. In this work we present the results of experimental measurements and analytical simulation of gamma – radiation effects on the electrical characteristics and operation of power transistor types 2N3773, 2N3055 (as complementary silicon power transistor are designed for general-purpose switching and amplifier applications), three samples of each type were irradiated by gamma radiation with doses, 1 K rad, 5 K rad, 10 K rad, 30 K rad, and 10 Mrad, the experimental data are utilized to establish an analytical relation between the total absorbed dose of gamma irradiation and corresponding to effective density of generated charge in the internal structure of transistor, the electrical parameters which can be measured to estimate the generated defects in the power transistor are current gain, collector current and collected emitter leakage current , these changes cause the circuit to case proper functioning. Collector current and transconductance of each device are calibrated as a function of irradiated dose. Also the threshold voltage and transistor gain can be affected and also calibrated as a function of dose. A silicon NPN power transistor type 2N3773 intended for general purpose applications, were used in this work. It was designed for medium current and high power circuits. Performance and characteristic were discusses
The effect of feeding Bt MON810 maize to pigs for 110 days on intestinal microbiota.
Directory of Open Access Journals (Sweden)
Stefan G Buzoianu
Full Text Available OBJECTIVE: To assess the effects of feeding Bt MON810 maize to pigs for 110 days on the intestinal microbiota. METHODOLOGY/PRINCIPAL FINDINGS: Forty male pigs (∼40 days old were blocked by weight and litter ancestry and assigned to one of four treatments; 1 Isogenic maize-based diet for 110 days (Isogenic; 2 Bt maize-based diet (MON810 for 110 days (Bt; 3 Isogenic maize-based diet for 30 days followed by a Bt maize-based diet for 80 days (Isogenic/Bt; 4 Bt maize-based diet for 30 days followed by an isogenic maize-based diet for 80 days (Bt/Isogenic. Enterobacteriaceae, Lactobacillus and total anaerobes were enumerated in the feces using culture-based methods on days 0, 30, 60 and 100 of the study and in ileal and cecal digesta on day 110. No differences were found between treatments for any of these counts at any time point. The relative abundance of cecal bacteria was also determined using high-throughput 16 S rRNA gene sequencing. No differences were observed in any bacterial taxa between treatments, with the exception of the genus Holdemania which was more abundant in the cecum of pigs fed the isogenic/Bt treatment compared to pigs fed the Bt treatment (0.012 vs 0.003%; P≤0.05. CONCLUSIONS/SIGNIFICANCE: Feeding pigs a Bt maize-based diet for 110 days did not affect counts of any of the culturable bacteria enumerated in the feces, ileum or cecum. Neither did it influence the composition of the cecal microbiota, with the exception of a minor increase in the genus Holdemania. As the role of Holdemania in the intestine is still under investigation and no health abnormalities were observed, this change is not likely to be of clinical significance. These results indicate that feeding Bt maize to pigs in the context of its influence on the porcine intestinal microbiota is safe.
Large signal S-parameters: modeling and radiation effects in microwave power transistors
International Nuclear Information System (INIS)
Graham, E.D. Jr.; Chaffin, R.J.; Gwyn, C.W.
1973-01-01
Microwave power transistors are usually characterized by measuring the source and load impedances, efficiency, and power output at a specified frequency and bias condition in a tuned circuit. These measurements provide limited data for circuit design and yield essentially no information concerning broadbanding possibilities. Recently, a method using large signal S-parameters has been developed which provides a rapid and repeatable means for measuring microwave power transistor parameters. These large signal S-parameters have been successfully used to design rf power amplifiers. Attempts at modeling rf power transistors have in the past been restricted to a modified Ebers-Moll procedure with numerous adjustable model parameters. The modified Ebers-Moll model is further complicated by inclusion of package parasitics. In the present paper an exact one-dimensional device analysis code has been used to model the performance of the transistor chip. This code has been integrated into the SCEPTRE circuit analysis code such that chip, package and circuit performance can be coupled together in the analysis. Using []his computational tool, rf transistor performance has been examined with particular attention given to the theoretical validity of large-signal S-parameters and the effects of nuclear radiation on device parameters. (auth)
Hawking Radiation-Quasinormal Modes Correspondence for Large AdS Black Holes
Directory of Open Access Journals (Sweden)
Dao-Quan Sun
2017-01-01
Full Text Available It is well-known that the nonstrictly thermal character of the Hawking radiation spectrum generates a natural correspondence between Hawking radiation and black hole quasinormal modes. This main issue has been analyzed in the framework of Schwarzschild black holes, Kerr black holes, and nonextremal Reissner-Nordstrom black holes. In this paper, by introducing the effective temperature, we reanalyze the nonstrictly thermal character of large AdS black holes. The results show that the effective mass corresponding to the effective temperature is approximatively the average one in any dimension. And the other effective quantities can also be obtained. Based on the known forms of frequency in quasinormal modes, we reanalyze the asymptotic frequencies of the large AdS black hole in three and five dimensions. Then we get the formulas of the Bekenstein-Hawking entropy and the horizon’s area quantization with functions of the quantum “overtone” number n.
The Effect of 5-FU and Radiation on A549 Cells In Vitro
Energy Technology Data Exchange (ETDEWEB)
Lee, Myung Za [Hanyang University College of Medicine, Seoul (Korea, Republic of); Chun, Ha Chong [Medical College of Virgina, Richmond (United States); Lee, Won Young [Yonsei University College of Medicine, Seoul (Korea, Republic of)
1989-06-15
Effects of ionizing radiation alone and combined with chemotherapy on tumor growth and it clonal specificity Monitored by changes in distribution of chromosome number were studies in A549 cell line originated from human adenocarcinoma of the lung. Radiation (300 rad, 600 rad and 900 rad) were delivered with or without 5-FU. Forty eight hours later, 57.5% of growth inhibition of cell was Seen in cells treated with 5-FU concentration of 0.47g/ml for 24 hr exposure. Cell survival carves after radiation with and without 5-FU were made. Chromosomal analysis of cells in metaphase in control, and in cells treated with 300 rad of radiation, or 0.47g/ml of 5-FU treatment, and combined treatment of cloth were 77ne to examine the changes in ploidy and number of chromosome. Radiation combined with 5-FU enhanced growth inhibition of A549 cells. However, no evidence of synergetic effects in growth inhibition was observed in the cells treated with the combination therapy. Pattern of chromosomal distribution of survived cells were shifted from hyperploidy to hypoploidy by single dose of radiation(300 rad). As radiation dose increased a large number of hypoploidy cells were observed. Following treatment of cells with 5-FU, chomosomal distribution of survived cells were also shifted to hypodiploidy, which were seen in cells treated with radiation. The cell treated with 5-FU and followed by radiation within 24 hrs had cell with increased number of hypodiploidy cells. Almost same type of chromosomal changes were reproduced in cells treated with combined treatment with radiation and 5-FU. Minor differences were that cells with fewer number of chromosome were more frequent in cells treated with combined therapy. Further increase in cells of hypoploidy(93%) having 1-10 chromosome were induced by additional radiation. Therefore, the enhanced therapeutic effect of 5-FU combined with radiation of A549 cells appeared to be additive rather than synergistic.
Directory of Open Access Journals (Sweden)
J. Ojeda
2016-03-01
Full Text Available A tuneable repetition rate extreme ultraviolet source (Harmonium for time resolved photoelectron spectroscopy of liquids is presented. High harmonic generation produces 30–110 eV photons, with fluxes ranging from ∼2 × 1011 photons/s at 36 eV to ∼2 × 108 photons/s at 100 eV. Four different gratings in a time-preserving grating monochromator provide either high energy resolution (0.2 eV or high temporal resolution (40 fs between 30 and 110 eV. Laser assisted photoemission was used to measure the temporal response of the system. Vibrational progressions in gas phase water were measured demonstrating the ∼0.2 eV energy resolution.
Late radiation effects: status and needs of epidemiologic research
International Nuclear Information System (INIS)
Miller, R.W.
1974-01-01
Epidemiologic studies of late radiation effects in man are reviewed, based on exposure to the atomic bomb, radiotherapy, diagnostic radiations, and occupational or accidental exposures. Areas studied include: genetic effects, fertility, immunology, cancer, congenital malformations, growth and development, aging, cataracts, psychiatric effects, interactions with drugs or viruses, host susceptibility, and radiation factors. Cancer areas discussed include leukemia; thyroid, lung, breast, bone, and liver cancers; lymphoma; salivary gland tumors; brain tumors; nonleukemia cancers; intrauterine exposures; and preconception irradiation and childhood cancers. (U.S.)
International Nuclear Information System (INIS)
Fidorra, J.
1982-07-01
The biological effectiveness of ionizing radiation is based upon the absorption of energy in molecular structures of a cell. Because of the quantum nature of radiation large fluctuations of energy concentration in subcellulare regions has to be considered. In addition both the spatial distribution of a sensitive molecular target and cellulare repair processes has to be taken into consideration for an assessment of radiation action. In radiation protection the difference between the quality factor and the Relative Biological Effectiveness has a fundamental meaning and will be discussed in more detail. The present report includes a short review on some relevant models on radiation action and a short discussion on effects of low dose irradiation. (orig.) [de
Transistor Small Signal Analysis under Radiation Effects
International Nuclear Information System (INIS)
Sharshar, K.A.A.
2004-01-01
A Small signal transistor parameters dedicate the operation of bipolar transistor before and after exposed to gamma radiation (1 Mrad up to 5 Mrads) and electron beam(1 MeV, 25 mA) with the same doses as a radiation sources, the electrical parameters of the device are changed. The circuit Model has been discussed.Parameters, such as internal emitter resistance (re), internal base resistance, internal collector resistance (re), emitter base photocurrent (Ippe) and base collector photocurrent (Ippe). These parameters affect on the operation of the device in its applications, which work as an effective element, such as current gain (hFE≡β)degradation it's and effective parameter in the device operation. Also the leakage currents (IcBO) and (IEBO) are most important parameters, Which increased with radiation doses. Theoretical representation of the change in the equivalent circuit for NPN and PNP bipolar transistor were discussed, the input and output parameters of the two types were discussed due to the change in small signal input resistance of the two types. The emitter resistance(re) were changed by the effect of gamma and electron beam irradiation, which makes a change in the role of matching impedances between transistor stages. Also the transistor stability factors S(Ico), S(VBE) and S(β are detected to indicate the transistor operations after exposed to radiation fields. In low doses the gain stability is modified due to recombination of induced charge generated during device fabrication. Also the load resistance values are connected to compensate the effect
31 CFR 17.110 - Self-evaluation.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Self-evaluation. 17.110 Section 17... § 17.110 Self-evaluation. (a) The agency shall, by two years after the effective date of this part... handicaps, to participate in the self-evaluation process. (c) The agency shall, until three years following...
International Nuclear Information System (INIS)
Menzel, H-G.; Harrison, J.D.
2012-01-01
Practical implementation of the International Commission on Radiological Protection’s (ICRP) system of protection requires the availability of appropriate methods and data. The work of Committee 2 is concerned with the development of reference data and methods for the assessment of internal and external radiation exposure of workers and members of the public. This involves the development of reference biokinetic and dosimetric models, reference anatomical models of the human body, and reference anatomical and physiological data. Following ICRP’s 2007 Recommendations, Committee 2 has focused on the provision of new reference dose coefficients for external and internal exposure. As well as specifying changes to the radiation and tissue weighting factors used in the calculation of protection quantities, the 2007 Recommendations introduced the use of reference anatomical phantoms based on medical imaging data, requiring explicit sex averaging of male and female organ-equivalent doses in the calculation of effective dose. In preparation for the calculation of new dose coefficients, Committee 2 and its task groups have provided updated nuclear decay data (ICRP Publication 107) and adult reference computational phantoms (ICRP Publication 110). New dose coefficients for external exposures of workers are complete (ICRP Publication 116), and work is in progress on a series of reports on internal dose coefficients to workers from inhaled and ingested radionuclides. Reference phantoms for children will also be provided and used in the calculation of dose coefficients for public exposures. Committee 2 also has task groups on exposures to radiation in space and on the use of effective dose.
Oxygen effect in radiation biology: caffeine and serendipity
International Nuclear Information System (INIS)
Kesavan, P.C.
2005-01-01
The 'hit theory' developed in 1920s to explain the actions of ionizing radiation on cells and organisms was purely physical, and its limitation was its inadequacy to address the contemporary findings such as the oxygen enhancement of radiobiological damage, and the increased radio- sensitivity of dividing compared to non-dividing cells. The textbooks written prior to 1970s did not either refer at all to oxygen as a radiosensitizer, or had mentioned it only in a passing manner; yet 'oxygen effect' was emerging as the central dogma in radiation biology. The oxygen effect in radiation biology is highly interdisciplinary encompassing atomic physics (i.e. interaction of photon with matter), radiation chemistry (formation of reactive oxygen species), molecular signalling, gene expression and genetic alterations in cells (mutation, cancer) or the cell death (apoptosis, necrosis, mitotic catastrophe, etc.). Cell death in higher organisms is now recognized as the precursor of possible error-free cell replacement repair. (author)
Hawking radiation, effective actions and covariant boundary conditions
International Nuclear Information System (INIS)
Banerjee, Rabin; Kulkarni, Shailesh
2008-01-01
From an appropriate expression for the effective action, the Hawking radiation from charged black holes is derived, using only covariant boundary conditions at the event horizon. The connection of our approach with the Unruh vacuum and the recent analysis [S.P. Robinson, F. Wilczek, Phys. Rev. Lett. 95 (2005) 011303, (gr-qc/0502074); S. Iso, H. Umetsu, F. Wilczek, Phys. Rev. Lett. 96 (2006) 151302, (hep-th/0602146); R. Banerjee, S. Kulkarni, (arXiv: 0707.2449 [hep-th])] of Hawking radiation using anomalies is established
Directory of Open Access Journals (Sweden)
Parreira Kleber Simônio
2002-01-01
Full Text Available Fixed bin frequencies for the VNTR loci D2S44, D4S139, D5S110, and D8S358 were determined in a Minas Gerais population sample. The data were generated by RFLP analysis of HaeIII-digested genomic DNA and chemiluminescent detection. The four VNTR loci have met Hardy-Weinberg equilibrium, and there was no association of alleles among VNTR loci. The frequency data can be used in forensic analyses and paternity tests to estimate the frequency of a DNA profile in the general Brazilian population.
Biological effects of ionizing radiation
International Nuclear Information System (INIS)
Heribanova, A.
1995-01-01
The basic principles and pathways of effects of ionizing radiation on living organisms and cells are outlined. The following topics are covered: effects of radiation on living matter (direct effects, radical or indirect effects, dual radiation action, and molecular biological theories); effects of radiation on cells and tissues (cell depletion, changes in the cytogenetic information, reparation mechanisms), dose-response relationship (deterministic effects, stochastic effects), and the effects of radiation on man (acute radiation sickness, acute local changes, fetus injuries, non-tumorous late injuries, malignant tumors, genetic changes). (P.A.). 3 tabs., 2 figs., 5 refs
2018-01-01
radiation physicists. As an example, a special issue of Health Physics [3] presents a body of experimental work characterizing the outdoor...Terrorist Attack involving Ionising Radiation. Campus Vesta, Belgium September 25-29, 2016. [3] Health Physics (Special Issue) 2016:110;399- 547...of Radiobiology & Radiation Protection 128 Szaserów Street 04-141 Warsaw POLAND Email: mjaniak@wihe.waw.pl Mr. Tjerk KUIPERS Health Physics
Ben-Hur, E; Fulder, S
1981-01-01
Panax ginseng saponin and Eleutherococcus senticosus extract were applied to cells in culture in order to assess the effect of these substances on resistance to gamma-irradiation. Eleutherococcus was slightly radio protective. However, ginseng saponin at a dose of 10 microgram/ml was significantly radioprotective (Do = 2.25 Gy) compared to control (Do = 1.80 Gy) when it was present prior to gamma-irradiation. It enhanced radiation response if it was also present for 4-6 hours after gamma-irradiation (Do = 1.10 Gy). Ginseng-treated cells made 30% less RNA and 14% more protein during a 1 hour pulse of labeled intermediates. The cells were morphologically altered. It is concluded that ginseng saponin can increase radiation resistance. The effect is indirect, due to alterations in cell physiology rather than DNA repair processes.
High-temperature oxidation kinetics of sponge-based E110 cladding alloy
Yan, Yong; Garrison, Benton E.; Howell, Mike; Bell, Gary L.
2018-02-01
Two-sided oxidation experiments were recently conducted at 900°C-1200 °C in flowing steam with samples of sponge-based Zr-1Nb alloy E110. Although the old electrolytic E110 tubing exhibited a high degree of susceptibility to nodular corrosion and experienced breakaway oxidation rates in a relatively short time, the new sponge-based E110 demonstrated steam oxidation behavior comparable to Zircaloy-4. Sample weight gain and oxide layer thickness measurements were performed on oxidized E110 specimens and compared to oxygen pickup and oxide layer thickness calculations using the Cathcart-Pawel correlation. Our study shows that the sponge-based E110 follows the parabolic law at temperatures above 1015 °C. At or below 1015 °C, the oxidation rate was very low when compared to Zircaloy-4 and can be represented by a cubic expression. No breakaway oxidation was observed at 1000 °C for oxidation times up to 10,000 s. Arrhenius expressions are given to describe the parabolic rate constants at temperatures above 1015 °C and cubic rate constants are provided for temperatures below 1015 °C. The weight gains calculated by our equations are in excellent agreement with the measured sample weight gains at all test temperatures. In addition to the as-fabricated E110 cladding sample, prehydrided E110 cladding with hydrogen concentrations in the 100-150 wppm range was also investigated. The effect of hydrogen content on sponge-based E110 oxidation kinetics was minimal. No significant difference was found between as-fabricated and hydrided samples with regard to oxygen pickup and oxide layer thickness for hydrogen contents below 150 wppm.
Radiation effects and radioprotectors
Energy Technology Data Exchange (ETDEWEB)
Purohit, R.K., E-mail: dr_rajendra_purohit@yahoo.co.in [Radiation Biology Laboratory, Department of Zoology, Govt. Dungar College, Bikaner (India); Bugalia, Saroj [Department of Zoology, S.K. Kalyan College, Sikar (India); Dakshene, Monika [Department of Chemistry, Govt. College, Kota (India)
2012-07-01
Radiation exposure causes damage to biological systems and these damages are mediated by the generation of free radicals and reactive oxygen species targeting vital cellular components such as DNA and membranes. DNA repair systems and the endogenous cellular biochemical defense mechanisms against reactive oxygen species and antioxidants enzymes like reduced Glutathione (GSH), Superoxide dismutase, Glutathione peroxidase catalase etc. fail upon exposures to higher as well as chronic radiation doses leading to alterations in cell functions, cell death or mutations. Radioprotectors prevent these alterations and protect cells and tissues from the deleterious effects of radiations. Radioprotectors are of great importance due to their possible and potential application during planned radiation exposures such as radiotherapy, diagnostic scanning, clean up operations in nuclear accidents, space expeditions etc. and Unplanned radiations exposures such as accidents in nuclear industry, nuclear terrorism, natural background radiation etc. Many of the available synthetic radioprotectors are toxic to mammalian system at doses required to be effective as radioprotector. Increasing uses of ionizing radiation have drawn the attention of many radiobiologists towards their undesired side effects produced in various tissues and for modifying them to facilitate the beneficial uses of radiation. Modification of radiation response is obtained by means of chemical substances that can significantly decrease the magnitude of response when present in a biological system during irradiation. Radioprotectors are chemicals that modify a cell's response to radiation. Radioprotectors are drugs that protect normal (non cancerous) cells from the damage caused by radiation therapy. These agents promote the repair of normal cells that are exposed to radiation. Various chemicals, like Cysteamine, MPG , WR-2721 have been tested for the protection against harmful effects of radiation. These radio
Radiation effects and radioprotectors
International Nuclear Information System (INIS)
Purohit, R.K.; Bugalia, Saroj; Dakshene, Monika
2012-01-01
Radiation exposure causes damage to biological systems and these damages are mediated by the generation of free radicals and reactive oxygen species targeting vital cellular components such as DNA and membranes. DNA repair systems and the endogenous cellular biochemical defense mechanisms against reactive oxygen species and antioxidants enzymes like reduced Glutathione (GSH), Superoxide dismutase, Glutathione peroxidase catalase etc. fail upon exposures to higher as well as chronic radiation doses leading to alterations in cell functions, cell death or mutations. Radioprotectors prevent these alterations and protect cells and tissues from the deleterious effects of radiations. Radioprotectors are of great importance due to their possible and potential application during planned radiation exposures such as radiotherapy, diagnostic scanning, clean up operations in nuclear accidents, space expeditions etc. and Unplanned radiations exposures such as accidents in nuclear industry, nuclear terrorism, natural background radiation etc. Many of the available synthetic radioprotectors are toxic to mammalian system at doses required to be effective as radioprotector. Increasing uses of ionizing radiation have drawn the attention of many radiobiologists towards their undesired side effects produced in various tissues and for modifying them to facilitate the beneficial uses of radiation. Modification of radiation response is obtained by means of chemical substances that can significantly decrease the magnitude of response when present in a biological system during irradiation. Radioprotectors are chemicals that modify a cell's response to radiation. Radioprotectors are drugs that protect normal (non cancerous) cells from the damage caused by radiation therapy. These agents promote the repair of normal cells that are exposed to radiation. Various chemicals, like Cysteamine, MPG , WR-2721 have been tested for the protection against harmful effects of radiation. These radio
Radiation degradation of poly(olefin sulphone)s - Fundamental research to practical applications
International Nuclear Information System (INIS)
Bowden, M.J.; O'Donnell, J.H.
1985-01-01
The degradation of poly(olefin sulphone)s by high energy radiation, particularly by γ-rays and electron beams, provides an example of the application of fundamental science to high technology industry. Scientific interest in the radiation degradation of these polymers was first aroused by the discovery that they underwent highly specific bond scission in the backbone chain as the primary result of absorption of high energy radiation and in fact they were the first polymers in which such an effect had been demonstrated. This conclusion was initially based mainly on evidence from electron spin resonance spectroscopy and was subsequently verified by studies of molecular weight changes. These studies showed that the poly(olefin sulphone)s not only degraded by main chain scission but were also among the most radiation-sensitive polymers known. The extremely high sensitivity of poly(olefin sulphone)s to radiation-induced main-chain scission has found application in the field of microelectronics. Electron beam writing on poly(olefin sulphone) films is used to produce lithographic masks for the manufacture of integrated circuits on silicon wafers. Poly(1-butene sulphone) (PBS) is currently used in the production of a substantial proportion of the masks for the industry. The fundamental aspects of the radiation degradation of poly(olefin sulphone)s and the practical applications to high technology are reviewed. (author)
The Brookhaven Radiation Effects Facility
Energy Technology Data Exchange (ETDEWEB)
Grand, P.; Snead, C.L.; Ward, T.
1988-01-01
The Neutral Particle Beam (NPB) Radiation Effects Facility (REF), funded by the Strategic Defense Initiative Office (SDIO) through the Defense Nuclear Agency (DNA) and the Air Force Weapons Laboratory (AFWL), has been constructed at Brookhaven National Laboratory (BNL). Operation started in October 1986. The facility is capable of delivering pulsed H{sup -}, H{sup o}, and H{sup +} beams of 100 to 200 MeV energy up to 30 mA peak current. Pulses can be adjusted from 5 {mu}s to 500 {mu}s length at a repetition rate of 5 pps. The beam spot on target is adjustable from 3 to 100 cm diameter (2 {sigma}) resulting in a maximum dose of about 10 MRads (Si) per pulse (small beam spot). Experimental use of the REF is being primarily supported by the SDI lethality (LTH-4) program. The program has addressed ionization effects in electronics, both dose rate and total dose dependence, radiation-sensitive components, and dE/dx effects in energetic materials including propellants and high explosives (HE). This paper describes the facility, its capabilities and potential, and the experiments that have been carried out to date or are being planned. 2 refs., 10 figs.
The Brookhaven Radiation Effects Facility
International Nuclear Information System (INIS)
Grand, P.; Snead, C.L.; Ward, T.
1988-01-01
The Neutral Particle Beam (NPB) Radiation Effects Facility (REF), funded by the Strategic Defense Initiative Office (SDIO) through the Defense Nuclear Agency (DNA) and the Air Force Weapons Laboratory (AFWL), has been constructed at Brookhaven National Laboratory (BNL). Operation started in October 1986. The facility is capable of delivering pulsed H - , H/sup o/, and H + beams of 100 to 200 MeV energy up to 30 mA peak current. Pulses can be adjusted from 5 μs to 500 μs length at a repetition rate of 5 pps. The beam spot on target is adjustable from 3 to 100 cm diameter (2 σ) resulting in a maximum dose of about 10 MRads (Si) per pulse (small beam spot). Experimental use of the REF is being primarily supported by the SDI lethality (LTH-4) program. The program has addressed ionization effects in electronics, both dose rate and total dose dependence, radiation-sensitive components, and dE/dx effects in energetic materials including propellants and high explosives (HE). This paper describes the facility, its capabilities and potential, and the experiments that have been carried out to date or are being planned. 2 refs., 10 figs
PROPER MOTIONS OF THE HH 110/270 SYSTEM
Energy Technology Data Exchange (ETDEWEB)
Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)
2012-05-15
We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.
Adsorption of ethyl xanthate on ZnS(110) surface in the presence of water molecules: A DFT study
Energy Technology Data Exchange (ETDEWEB)
Long, Xianhao [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Chen, Jianhua, E-mail: jhchen@gxu.edu.cn [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Guangxi Colleges and University Key Laboratory of Minerals Engineering, 530004 (China); Chen, Ye, E-mail: fby18@126.com [College of Resources and Metallurgy, Guangxi University, Nanning 530004 (China)
2016-05-01
Graphical abstract: - Highlights: • Adsorption of water molecules decreases the reactivity of surface Zn atom. • Copper impurities decrease the band gap of ZnS surface. • Copper impurities enhance the adsorption of xanthate on the ZnS surface. • Water molecules have little influence on the properties of Cu-substituted ZnS surface. • The xanthate S atom can interact with the surface S atom of Cu-substituted ZnS surface. - Abstracts: The interaction of collector with the mineral surface plays a very important role in the froth flotation of sphalerite. The adsorptions occurred at the interface between the mineral surface and waters; however most of DFT simulations are performed in vacuum, without consideration of water effect. Semiconductor surface has an obvious proximity effect, which will greatly influence the surface reactivity. To understand the mechanism of xanthate interacting with sphalerite surface in the presence of water molecules, the ethyl xanthate molecule adsorption on un-activated and Cu-activated ZnS(110) surface in the absence and presence of water molecules were performed using the density functional theory (DFT) method. The calculated results show that the adsorption of water molecules dramatically changes the properties of ZnS surface, resulting in decreasing the reactivity of surface Zn atoms with xanthate. Copper activation of ZnS surface changes the surface properties, leading to the totally different adsorption behaviors of xanthate. The presence of waters has little influence on the properties of Cu-activated ZnS surface. The xanthate S atom can interact with the surface S atom of Cu-substituted ZnS surface, which would result in the formation of dixanthogen.
DEFF Research Database (Denmark)
Deng, Lei; Pang, Xiaodan; Beltrán, Marta
2012-01-01
We demonstrate scalable optical comb- and heterodyning-based generation, optical and 1.3-m wireless transmission, and electrical heterodyne detection of multiband OFDM up to 38.2 Gb/s occupying 14.4-GHz RF bandwidth, for high-capacity optical-wireless links in 75-110 GHz....
The effect of iron and copper impurities on the wettability of sphalerite (110) surface.
Simpson, Darren J; Bredow, Thomas; Chandra, Anand P; Cavallaro, Giuseppe P; Gerson, Andrea R
2011-07-15
The effect of impurities in the zinc sulfide mineral sphalerite on surface wettability has been investigated theoretically to shed light on previously reported conflicting results on sphalerite flotation. The effect of iron and copper impurities on the sphalerite (110) surface energy and on the water adsorption energy was calculated with the semi-empirical method modified symmetrically orthogonalized intermediate neglect of differential overlap (MSINDO) using the cyclic cluster model. The effect of impurities or dopants on surface energies is small but significant. The surface energy increases with increasing surface iron concentration while the opposite effect is reported for increasing copper concentration. The effect on adsorption energies is much more pronounced with water clearly preferring to adsorb on an iron site followed by a zinc site, and copper site least favorable. The theoretical results indicate that a sphalerite (110) surface containing iron is more hydrophilic than the undoped zinc sulfide surface. In agreement with the literature, the surface containing copper (either naturally or by activation) is more hydrophobic than the undoped surface. Copyright © 2011 Wiley Periodicals, Inc.
Radiative capture of slow electrons by tungsten surface
International Nuclear Information System (INIS)
Artamonov, O.M.; Belkina, G.M.; Samarin, S.N.; Yakovlev, I.I.
1987-01-01
Isochromatic spectra of radiation capture of slow electrons by the surface of mono- and polycrystal tungsten recorded on 322 and 405 nm wave lengths are presented. The effect of oxygen adsorption on isochromates of the (110) face of tungsten monocrystal is investigated. The obtained isochromatic spectra are compared with energy band structure of tungsten. Based on the analysis of the obtained experimental results it is assumed that optical transition to the final state at the energy of 7.3 eV relatively to Fermi level is conditioned by surface states of the tungsten face (110)
Radiation effects on the integrity of paper
International Nuclear Information System (INIS)
Otero D'Almeida, Maria Luiza; Medeiros Barbosa, Patricia de Souza; Boaratti, Marcelo Fernando Guerra; Borrely, Sueli Ivone
2009-01-01
Books and documents attacked by fungi and insects have already been treated by radiation for disinfestations purposes. However, there is still need to investigate the influence of radiation on the cellulose paper structure. The aim of this research was to study the effects of radiation on paper properties, especially those related to strength and appearance. Paper sheets for this study were prepared in the laboratory, using bleached eucalyptus pulp as raw material. No additives were used to concentrate the attention only on the effects of irradiation on the pure cellulose matrix. The samples were irradiated at IPEN's 60 Co Gammacell irradiator with six radiation doses, from 3 to 15 kGy at the dose rate 0.817 Gy/s. The properties of paper sheets were tested after irradiation and compared with unirradiated samples according to ISO methods. No significant changes were detected in paper samples irradiated up to 15 kGy.
Biological effects of ionizing radiation
International Nuclear Information System (INIS)
Marko, A.M.
1981-05-01
In this review radiation produced by the nuclear industry is placed into context with other sources of radiation in our world. Human health effects of radiation, derivation of standards and risk estimates are reviewed in this document. The implications of exposing the worker and the general population to radiation generated by nuclear power are assessed. Effects of radiation are also reviewed. Finally, gaps in our knowledge concerning radiation are identified and current research on biological effects, on environmental aspects, and on dosimetry of radiation within AECL and Canada is documented in this report. (author)
Biological Effects of Ionizing Radiation
Ingram, M.; Mason, W. B.; Whipple, G. H.; Howland, J. W.
1952-04-07
This report presents a review of present knowledge and concepts of the biological effects of ionizing radiations. Among the topics discussed are the physical and chemical effects of ionizing radiation on biological systems, morphological and physiological changes observed in biological systems subjected to ionizing radiations, physiological changes in the intact animal, latent changes following exposure of biological systems to ionizing radiations, factors influencing the biological response to ionizing radiation, relative effects of various ionizing radiations, and biological dosimetry.
Effects of radiation-counselling convergence education on radiation awareness
International Nuclear Information System (INIS)
Seoung, Youl Hun
2017-01-01
The purpose of study was to analysis on the effects of radiation-counselling convergence education on radiation awareness. The survey objects were students of radiation-counselling convergence education from 12th May to 22th June in 2016. The questionnaires were education satisfactions and radiation awareness (risk, benefit, control) by Likert-type 5 scales. The analysis results revealed that education satisfactions of men students showed a significant higher female students and correlation coefficient of education satisfactions were the best high in the benefit and control of radiation. Finally radiation-counselling convergence education had a significant effect on radiation benefit. This convergence education influenced positive recognition on radiation benefit and it was indicated that radiation-counselors could treat clients on the basis of radiation benefit
Effects of radiation-counselling convergence education on radiation awareness
Energy Technology Data Exchange (ETDEWEB)
Seoung, Youl Hun [Dept. of Radiological Science, College of Health Science, Cheongju University, Cheongju (Korea, Republic of)
2017-06-15
The purpose of study was to analysis on the effects of radiation-counselling convergence education on radiation awareness. The survey objects were students of radiation-counselling convergence education from 12th May to 22th June in 2016. The questionnaires were education satisfactions and radiation awareness (risk, benefit, control) by Likert-type 5 scales. The analysis results revealed that education satisfactions of men students showed a significant higher female students and correlation coefficient of education satisfactions were the best high in the benefit and control of radiation. Finally radiation-counselling convergence education had a significant effect on radiation benefit. This convergence education influenced positive recognition on radiation benefit and it was indicated that radiation-counselors could treat clients on the basis of radiation benefit.
Effects of UV radiation on freshwater metazooplankton
International Nuclear Information System (INIS)
Tartarotti, B.
1999-06-01
There is evidence that fluxes of solar ultraviolet-B radiation (UV-B, 290-320 nm) are increasing over wide parts of the earth's surface due to stratospheric ozone depletion. UV radiation (290-400 nm) can have damaging effects on biomolecules and cell components that are common to most living organisms. The aim of this thesis is to gain a more thorough understanding of the potential impacts of solar radiation on freshwater metazooplankton. To detect UV-vulnerability in zooplankton populations dominating the zooplankton community of two clear-water, high mountain lakes located one in the Austrian Alps and another in the Chilean Andes, the survival of two copepod species was studied. The organisms were exposed to a 10- to 100-fold increase in UV-B radiation compared to those levels found at their natural, maximum daytime distribution. Both species vertically migrate and are pigmented. UV-absorbing compounds with a maximum absorption at ∼334 nm were also detected. Cyclops abyssorum tatricus, a common cyclopoid copepod species of Alpine lakes, was highly resistant to UV-B radiation and no significant lethal effect was observed. The calanoid copepod Boeckella gracilipes, frequent in Andean lakes, had a mortality ∼5 times higher in the treatment receiving full sunlight than in the UV-B excluded treatment (3.2 %) only when exposed for 70 h. The resistance of B. gracilipes was higher than that reported in the literature for the same species suggesting the existence of intraspecific differences in UV sensitivity. Survival, fecundity and development of the zooplankton community of a clear-water, high elevation Andean lake (33 o S) were studied with mesocosms experiments after prolonged UV exposure (48 days). When exposed to full sunlight, the population of the cladoceran Chydorus sphaericus and the rotifer Lepadella ovalis were strongly inhibited by UV-B, whereas both species were resistant to UV-A radiation. Conversely, UV-B radiation had no effect on the survival of the
Health effects of low level radiation
Energy Technology Data Exchange (ETDEWEB)
Hattori, Sadao [Central Research Inst. of Electric Power Industry, Tokyo (Japan)
1998-12-31
In 1982, Prof. Thomas Don Luckey of Missouri Univ. asserted `Radiation Hormesis` on the Journal of Health Physics and he published two books. CRIEPI initiated the research program on Radiation Hormesis following his assertion to confirm `is it true or not?` After nearly ten year research activities on data surveys and animal tests with many Universities, we are realizing scientific truth of bio-positive effects by low level radiation exposures. The interesting bio-positive effects we found could be categorized in following five groups. 1) Rejuvenation of cells such as increase of SOD and cell membrane permeability, 2) Moderation of psychological stress through response of key enzymes, 3) Suppression and therapy of adult-diseases such as diabetes and hypertension, 4) Suppression of cancer through enhancement of immune systems such as lymphocytes, 5) Suppression of cancer and ratio-adaptive response by activation of DNA repair and apoptosis. In the responses of many specialists to our initiation of radiation hormesis research program following T.D. Luckey`s claim about low level radiation, I have to pick up for the first, the great success of Prof. Sakamoto. Prof. Sakamoto had been already applying whole body low dose irradiation for ten years before our radiation hormesis research started on the therapy to suppress the cancer reappearing after treatment. He reported about his successful trial to real patients and showed an enhancement of immune system. (author)
International Nuclear Information System (INIS)
Kiefer, J.
1989-01-01
The book covers all aspects of biological radiation effects. The physical basis is dealt with in some detail, and the effects at the subcellular and the cellular level are discussed, taking into account modern developments and techniques. The effects on the human organism are reviewed, both from the point of view of applications in medicine as well as with regard to radiation hazards (teratogenic, gonadal and carcinogenic effects)
Sup(110)Sn/110In - a new generator system for positron emission tomography
International Nuclear Information System (INIS)
Lundqvist, H.; Einarsson, L.; Malmborg, P.; Scott-Robson, S.
1991-01-01
A generator system, 110 Sn/ 110 In, is suggested for use in the labelling of leukocytes with this short-lived (t 1/2 = 1.15 h) positron emitting (62%) isotope of indium. The half-life gives the labelled leukocytes time to be adequately distributed but is short enough to allow repeated studies within a few hours. The mother radionuclide 110 Sn (t 1/2 = 4.15 h) is produced by the reaction nat In(p, xn) 110 Sn which has a maximum cross-section of 110 mb at approx. 70 MeV and a practical yield of 400 MBq/μAh. (author)
V. Physical effects in ionizing radiation passage through matter
International Nuclear Information System (INIS)
1984-01-01
The ionization of the medium during absorption of alpha particles is described. The ranges are given of alpha particles in the air and in certain liquids and solids. The absorption of protons and deuterons takes place similarly as in alpha particles but protons and deuterons have a bigger range at the same energy. The term half-thickness has been introduced for the absorption of beta particles. For different energies of beta particles the absorption of these particles is graphically represented for different materials. The greatest attention is devoted to the absorption of electromagnetic radiation, i.e., X radiation and gamma radiation. The mechanisms are explained of absorption by photoelectric effect, the Compton effect and electron pair formation. In X radiation radiotherapy, filters are used, mostly aluminium, copper or zinc plates. The values are given of radiation intensity for different thicknesses of aluminium and copper filters and a survey is given of combined filters for 220 to 400 kV. For radiotherapy purposes great attention is devoted to the calculation of the depth dose. The effects are discussed of ionizing radiation on photographic emulsion, on changes in the colouring of some substances and fluorescence. Also given are the biological effects of ionizing radiation and the theory of direct and indirect effects is briefly described. (E.S.)
International Nuclear Information System (INIS)
Franco, Rossella Di; Calvanese, MariaGrazia; Murino, Paola; Manzo, Roberto; Guida, Cesare; Gennaro, Davide Di; Anania, Caterina; Ravo, Vincenzo
2012-01-01
This is an observational study and the aim is to evaluate the effect of dietary supplements based on Resveratrol, Lycopene, Vitamin C and Anthocyanins (Ixor ® ) in reducing skin toxicity due to external beam radiotherapy in patients affected by breast cancer. 71 patients were enrolled and they were divided in two different groups: a control group (CG) of 41 patients treated with prophylactic topical therapy based on hyaluronic acid and topical steroid therapy in case of occurrence of radiodermatitis, and a Ixor-Group (IG) of 30 patients treated also with an oral therapy based on Resveratrol, Lycopene, Vitamin C and Anthocyanin (Ixor ® ) at a dose of 2 tablets/day, starting from 10 days before the radiation treatment until 10 days after the end of treatment. Skin toxicity has been related to PTV, to breast volume that received a radiation dose equal or lower than 107%, included between 107% and 110%, or greater than 110% of the prescribed dose. Moreover it's been studied the relationship between skin toxicity and the chemotherapy schedule used before treatment. We calculated in both groups the percentage of patients who had a skin toxicity of grade 2 or 3 (according to RTOG scale). Absolute risk reduction (ARR), relative risk (RR) and odds ratio (OR) have been calculated for each relationship. Control Group (CG) patients with a PTV > 500 ml presented skin toxicity G2 + G3 in 30% of cases, versus 25% of Ixor-Group (IG) [OR 0.77]. In patients with a PTV < 500 ml G2 + G3 toxicity was 0% in the IG compared to 18% in CG (OR 0.23). When Dmax was less than or equal to 107% of the prescribed dose skin toxicity was G2 + G3 in 12.5% in CG, versus 0% in IG (OR 0.73), instead when Dmax was included between 107 and 110% of the prescribed dose, G2 + G3 skin toxicity was 35% in CG and 21% in IG (OR 0.50). In patients undergoing chemotherapy with anthracyclines and taxanes, G2 + G3 toxicity was 27% in CG, against 20% in IG (OR 0.68). The protective effect of Resveratrol
International Nuclear Information System (INIS)
Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Atac, M.; Auchincloss, P.; Azzi, P.; Bacchetta, N.; Baden, A.R.; Badgett, W.; Bailey, M.W.; Bamberger, A.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Bensinger, J.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Biery, K.; Bhadra, S.; Binkley, M.; Bisello, D.; Blair, R.; Blocker, C.; Bodek, A.; Bolognesi, V.; Booth, A.W.; Boswell, C.; Brandenburg, G.; Brown, D.; Buckley-Geer, E.; Budd, H.S.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carey, R.; Carithers, W.; Carlsmith, D.; Carroll, J.T.; Cashmore, R.; Castro, A.; Cen, Y.; Cervelli, F.; Chadwick, K.; Chapman, J.; Chiarelli, G.; Chinowsky, W.; Cihangir, S.; Clark, A.G.; Cobal, M.; Connor, D.; Contreras, M.; Cooper, J.; Cordelli, M.; Crane, D.; Cunningham, J.D.; Day, C.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Eno, S.; Errede, S.; Etchegoyen, A.; Farhat, B.; Frautschi, M.; Feldman, G.J.; Flaugher, B.; Foster, G.W.; Franklin, M.; Freeman, J.; Frisch, H.; Fuess, T.; Fukui, Y.; Gagliardi, G.; Garfinkel, A.F.; Gauthier, A.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Gold, M.; Gonzalez, J.; Goulianos, K.; Grassmann, H.; Grieco, G.M.; Grindley, R.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Handler, R.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Hessing, T.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Hubbard, B.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huth, J.; Hylen, J.; Incagli, M.; Ino, T.; Iso, H.; Jensen, H.; Jessop, C.P.; Johnson, R.P.; Joshi, U.; Kadel, R.W.; Kamon, T.; Kanda, S.; Kardelis, D.A.
1995-01-01
We have sought evidence for radiative decays of neutralinos produced in proton-antiproton collisions at √s=1.8TeV. Events containing two photons plus large missing transverse energy were investigated. The observed event rate and the missing transverse energy distribution of the two-photon events are consistent with QCD predictions. Inferred limits on squark and gluino masses depend on the supersymmetry model parameters. The particular choices μ=-40GeV/c 2 and tanβ=1.5 lead to 90%-confidence-level asymptotic lower limits of 110 GeV/c 2 and 140 GeV/c 2 for squarks and gluinos, respectively
Biological effects of particle radiation
International Nuclear Information System (INIS)
Sakamoto, Kiyohiko
1988-01-01
Conventional radiations such as photons, gamma rays or electrons show several physical or biological disadvantages to bring tumors to cure, therefore, more and more attentions is being paid to new modalitie such as fast neutrons, protons, negative pions and heavy ions, which are expected to overcome some of the defects of the conventional radiations. Except for fast neutrons, these particle radiations show excellet physical dose localization in tissue, moreover, in terms of biological effects, they demonstrate several features compared to conventional radiations, namely low oxygen enhancement ratio, high value of relative biological effectiveness, smaller cellular recovery, larger therapeutic gain factor and less cell cycle dependency in radiation sensitivity. In present paper the biological effects of particle radiations are shown comparing to the effects of conventional radiations. (author)
STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
Biological effects of ionising radiation
International Nuclear Information System (INIS)
Anon.
1987-01-01
The paper reports the proceedings of a conference organised jointly by Friends of the Earth (U.K.) and Greenpeace (International). The aim of the conference was to discuss the effects of low level radiation, particularly on man, within the terms of dose/risk relationships. The topics discussed included: sources of radiation, radiation discharges from nuclear establishments, predictive modelling of radiation hazards, radiation effects at Hiroshima, low dose effects and ICRP dose limits, variation in sensitivity to radiation, and the link between childhood cancer and nuclear power. (U.K.)
Radiation Effects on Ytterbium-doped Optical Fibers
2014-06-02
conducted on Er- doped fiber amplifiers (Lezius, et al., 2012; Ahrens, et al., 1999; Ahrens, Jaques , LuValle, DiGiovanni, & Windeler, 2001; Ott, 2004...Ahrens, R. G., Abate, J. A., Jaques , J. J., Presby, H. M., Fields, A. B., DiGiovanni, D. J., LuValle, M. J. (1999). Radiation reliability of rare... Jaques , J. J., LuValle, M. J., DiGiovanni, D. J., & Windeler, R. S. (2001). Radiation effects on optical fibers and amplifiers. Testing, Reliability
High temperature behaviour of E110G and E110 fuel claddings in various mixtures of steam and air
International Nuclear Information System (INIS)
Perez-Feró, Erzsébet; Novotny, Tamás; Horváth, Márta; Kunstár, Mihály; Vér, Nóra; Hózer, Zoltán
2014-01-01
Experiments with sponge base E110G and the traditional E110 were carried out to compare the oxidation kinetics of these alloys in steam, in hydrogen rich steam, in steam-air and in air atmosphere and to study the effect of hydrogen- and nitrogen-containing environment on the oxidation. The effect of oxidizing atmosphere on the mechanical behaviour of the claddings was also investigated. The new and the traditional types of cladding rings were oxidised at high temperature (600°C – 1200°C). Oxidation of both alloys in steam-air mixture and in air atmosphere resulted in faster oxidation kinetics compared to steam. In many cases bumpy, porous oxide layer have been found. The presence of hydrogen in the steam atmosphere had no significant effect on the oxidation kinetics. Comparing the two alloys, more favourable behaviour of oxidised E110G was observed regarding the oxidation kinetics, breakaway oxidation and load bearing capability in all cases. (author)
Nutritional supplementation with arginine protects radiation-induced effects: an experimental study
Energy Technology Data Exchange (ETDEWEB)
Pinto, Flavia Cristina Morone, E-mail: fcmorone@gmail.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil); Campos-Silva, Pamella; Souza, Diogo Benchimol de; Costa, Waldemar Silva; Sampaio, Francisco Jose Barcellos [Universidade do Estado do Rio de Janeiro (UERJ), Rio de Janeiro, RJ (Brazil)
2016-10-15
Purpose: To investigate the protective effect of L-arginine on the prostate (nonneoplasic) of rats with radiation-induced injury. Methods: Twenty-nine Wistar rats, male adult, allocated into three groups: Control group (C) was not exposed to irradiation (n=10); Radiated group (R) had undergone pelvic irradiation (n=10); Supplemented and radiated group (R+S) had undergone pelvic irradiation plus L-arginine supplementation (n=9). The animals were observed for signs of toxicity. After euthanization, the prostate was dissected under magnification and stained by hematoxylin and eosin to study acinar structures and stained with Picrosirius red for collagen analysis. Results: After radiation exposure, all animals presented diarrhea, but supplementation with L-arginine reduced this effect. The weight gain in the R+S group was significantly higher than in the C and R groups. In the R+S group the collagen density and the prostate acinar area was similar to the R and C groups. Epithelial height was significantly reduced in group R compared with group C (p<0.0001). When comparing the group R+S with R, a statistical difference was observed to be present (p<0.0001). Conclusions: Pelvic radiation promotes systemic effects and some structural modifications in the ventral prostate of rats. These modifications can be prevented by oral supplementation with L-arginine. (author)
International Nuclear Information System (INIS)
Kusakabe, Kiyoko; Yokoyama, Kunihiko; Ito, Koichi
2012-01-01
This study was undertaken to measure the radiation exposure level of caregivers following outpatient NaI (I-131) 1,110 MBq therapy for remnant thyroid ablation after total thyroidectomy in patients with differentiated thyroid cancer, and to evaluate the influence of activities of daily living on radiation exposure level, with the goal of proposing an optimum method of I-131 therapy. The study included 37 patients with differentiated thyroid cancer, who had undergone total thyroidectomy and received outpatient based remnant thyroid ablation using NaI (I-131) 1,110 MBq, who were satisfying the following requirements: patients who have no evidence of distant metastases, whose living environments were appropriate for outpatient I-131 (1,110 MBq) therapy, and patients who gave written informed consent. The dose rate at a distance of 1 m from the body surface of the patient at the moment of release was measured using survey meters of the GM type or ionization chamber type. The dose level for the caregiver was measured with a personal dosimeter in all cases. The dose rate at a distance of 1 m from the patient's body surface 1 h after I-131 administration was in the range of 29-115 μSv/h (mean 63.8 μSv/h). The 7-day cumulative effective dose of caregivers was 0.11±0.08 mSv, on an average, in 34 dosimeters. In 31 of 34 dosimeters, cumulative effective dose of caregivers was below 0.2 mSv. Dose levels exceeding 0.2 mSv were recorded in 3 cases (0.21, 0.35 and 0.43 mSv in one case each). These results suggest that the exposure level of family members (caregiver and others) was minimal and is lower than the radiation levels affecting human environments. Outpatient-based remnant thyroid ablation with I-131 (1,110 MBq) performed after total thyroidectomy in patients with differentiated thyroid cancer is safe if applied in accordance with the appropriate supervision and guidance by experts with certain qualifications. (author)
Potential Hazards of Cellular Phone Radiation: Responses to Fear and Uncertainty
Wisz, Jamie T.
2002-01-01
In recent years, the public has become concerned that the electromagnetic radio-frequency radiation (“RF radiationâ€) emitted by cellular telephones may pose serious health risks, including the risk of cancer. There are over 110 million cell phone users in the United States and many of them may not know that cell phones actually send electromagnetic waves into the user’s brain. Depending on how close the cell phone antenna is to oneâ&euro...
Health effects of radiation and the implications for radiation safety
International Nuclear Information System (INIS)
Gonzalez, A.J.; Anderer, J.
1991-01-01
In this Paper two elements of a multiphase analysis of radiation exposures in the living environment - the human health effects of ionizing radiation and the implications for radiation safety policy and practices - are presented. Part 1 draws together the current state of scientific knowledge and insight about the human health effects of radiation, describing these in terms of known cause-related deterministic effects and of the estimated incidence of stochastic effects as defined by biostatistics and biological models. The 1988 UNSCEAR report provides an authoritative basis for such an examination. Part 2 explores some of the major implications that the state-of-the-art of radiation biology has - or should have - for radiation safety policy and practices. (author)
Cosmic radiation exposure of aircraft crew: compilation of measured and calculated data
Czech Academy of Sciences Publication Activity Database
Lindborg, L.; Bartlett, D.; Beck, P.; McAulay, I.; Schnuer, K.; Schraube, H.; Spurný, František
2004-01-01
Roč. 110, 1-4 (2004), s. 417-422 ISSN 0144-8420 Grant - others:EC project(XE) FIGM-CT2000-00068 Institutional research plan: CEZ:AV0Z1048901 Keywords : cosmic radiation exposure * aircraft crew * measurement Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.617, year: 2003
International Nuclear Information System (INIS)
Gonzales, Marcial Alvaran
2007-04-01
A radiosensitivity study coupled with tissue culture technique was conducted as preliminary to mutation breeding of the three species of ground orchids (Spathoglottis plicata, S. kimballiana var. angustifolia, and S. tomentosa). It aimed to compare the effects of varying dose levels of gamma radiation applied to the germinated embryos (protocorms) of the three species. Also it sought to determine the lethal dose of gamma radiation on the three species and to determine their optimum dose or the dose level that will lead to production of more mutants. The protocorms of the three species were irradiated at 10 Gy, 20 Gy, 30 Gy, 40 Gy, and 50 Gy dose levels of gamma radiation. Results of the study showed that as the dose level administered increases, percent mortality of seedlings also increases. Further, seedling height, number of roots and root length decreases. However, there was an increase in number of leaves at certain dose levels due to the emergence of furcations, but further increase in the dose levels of radiation decreases the number of leaves.Furthermore, some qualitative characters such as albinism, pigmentation, forked leaves, furcations, and multiple branching came out as responses to gamma radiation. It further shows that the three species have varied radiosensitivity as affected by their individual phenotype. It was found that S. kimballiana var. angustifolia was the least radiosensitive among the species, and could have a great potential for a wide array of genetic variations due to the observed emergence of more morphological mutations that came out as effect of gamma radiation. (Author)
Energy Technology Data Exchange (ETDEWEB)
Gonzales, Marcial Alvaran
2007-04-15
A radiosensitivity study coupled with tissue culture technique was conducted as preliminary to mutation breeding of the three species of ground orchids (Spathoglottis plicata, S. kimballiana var. angustifolia, and S. tomentosa). It aimed to compare the effects of varying dose levels of gamma radiation applied to the germinated embryos (protocorms) of the three species. Also it sought to determine the lethal dose of gamma radiation on the three species and to determine their optimum dose or the dose level that will lead to production of more mutants. The protocorms of the three species were irradiated at 10 Gy, 20 Gy, 30 Gy, 40 Gy, and 50 Gy dose levels of gamma radiation. Results of the study showed that as the dose level administered increases, percent mortality of seedlings also increases. Further, seedling height, number of roots and root length decreases. However, there was an increase in number of leaves at certain dose levels due to the emergence of furcations, but further increase in the dose levels of radiation decreases the number of leaves.Furthermore, some qualitative characters such as albinism, pigmentation, forked leaves, furcations, and multiple branching came out as responses to gamma radiation. It further shows that the three species have varied radiosensitivity as affected by their individual phenotype. It was found that S. kimballiana var. angustifolia was the least radiosensitive among the species, and could have a great potential for a wide array of genetic variations due to the observed emergence of more morphological mutations that came out as effect of gamma radiation. (Author)
Radiation effects and radiation risks
International Nuclear Information System (INIS)
Lengfelder, E.; Forst, D.; Feist, H.; Pratzel, H.
1988-01-01
The book presents the facts and the principles of assessment and evaluation of biological radiation effects in general and also with particular reference to the reactor accident of Chernobyl, reviewing the consequences and the environmental situation on the basis of current national and international literature, including research work by the authors. The material compiled in this book is intended especially for physicians, but will also prove useful for persons working in the public health services, in administration, or other services taking care of people. The authors tried to find an easily comprehensible way of presenting and explaining the very complex processes and mechanisms of biological radiation effects and carcinogenesis, displaying the physical primary processes and the mechanisms of the molecular radiation effects up to the effects of low-level radiation, and present results of comparative epidemiologic studies. This section has been given considerable space, in proportion to its significance. It also contains literature references for further reading, offering more insight and knowledge of aspects of special subject fields. The authors also present less known results and data and discuss them against the background of well-known research results and approaches. Apart from the purpose of presenting comprehensive information, the authors intend to give an impact for further thinking about the problems, and helpful tools for independent decisions and action on the basis of improved insight and assessment, and in this context particularly point to the problems induced by the Chernobyl reactor accident. (orig./MG) With 8 maps in appendix [de
110GHz-500kW long-pulse gyrotron with built-in quasi-optical mode converter
International Nuclear Information System (INIS)
Sakamoto, Keishi; Kariya, Tsuyoshi; Hayashi, Ken-ichi.
1994-01-01
We have designed, fabricated, and tested a 110 GHz-500 kW long-pulse gyrotron. The gyrotron incorporates a quasi-optical mode converter which transforms the oscillation mode, TE 22,2 , into a Gaussian radiation beam. The adoption of a built-in mode converter enabled us to design the electron beam collector so as to be capable of tolerating a 2 MW heat load. Attention was also paid to designing the gyrotron cavity and output window so as to permit long-pulse operations. In an experiment, we observed a maximum output power of 550 kW and achieved 1.3 s operation at a power level of 410 kW. (author)
Simulation of first-wall radiation effects
International Nuclear Information System (INIS)
Logan, C.M.; Anderson, J.D.; Hansen, L.F.
1975-01-01
Many of the effects induced in metals as a result of exposure to a radiation environment are intimately associated with the energy of primary recoil atoms (PKAs). Protons with an energy of 16 MeV closely reproduce the PKA energy spectrum which will be present at the first wall in a D--T fusion reactor and should therefore closely reproduce the radiation effects induced by PKAs in the first wall. A preliminary experiment with protons was conducted to measure the sputtering rate and to look for the phenomenon of chunk emission recently observed by Kaminsky and co-workers in samples exposed to 14-MeV neutrons. We are also able to observe the average projected transport range of activated PKAs. (U.S.)
Biological effects of radiation
International Nuclear Information System (INIS)
2013-01-01
This fourth chapter presents: cell structure and metabolism; radiation interaction with biological tissues; steps of the production of biological effect of radiation; radiosensitivity of tissues; classification of biological effects; reversibility, transmissivity and influence factors; pre-natal biological effects; biological effects in therapy and syndrome of acute irradiation
Using mortality data to estimate radiation effects on breast cancer incidence
International Nuclear Information System (INIS)
Hoel, D.G.; Dinse, G.E.
1990-01-01
In this paper we combine Japanese data on radiation exposure and cancer mortality with U.S. data on cancer incidence and lethality to estimate the effects of ionizing radiation on cancer incidence. The analysis is based on the mathematical relationship between the mortality rate and the incidence and lethality rates, as well as on statistical models that relate Japanese incidence rates to U.S. incidence rates and radiation risk factors. Our approach assumes that the risk of death from causes other than the cancer does not depend on whether or not the cancer is present, and among individuals with the cancer, the risk of death attributable to the cancer is the same in Japan and the U.S. and is not affected by radiation exposure. In particular, we focus on the incidence of breast cancer in Japanese women and how this incidence is affected by radiation risk factors. The analysis uses Japanese exposure and mortality data from the Radiation Effects Research Foundation study of atomic bomb survivors and U.S. incidence and lethality data from the Surveillance, Epidemiology, and End Results Registry. Even without Japanese incidence data, we obtain reasonable estimates of the incidence of breast cancer in unexposed Japanese women and identify the radiation risk factors that affect this incidence. Our analysis demonstrates that the age at exposure is an important risk factor, but that the incidence of breast cancer is not affected by the city of residence (Nagasaki versus Hiroshima) or the time since exposure
Catalytic hydrolysis of COS over CeO_2 (110) surface: A density functional theory study
International Nuclear Information System (INIS)
Song, Xin; Ning, Ping; Wang, Chi; Li, Kai; Tang, Lihong; Sun, Xin
2017-01-01
Graphical abstract: CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. H_2O plays a role as a bridge in the process of joint adsorption. Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Highlights: • H_2O is easier adsorbed on the CeO_2 (110) surface than COS. • When COS and H_2O jointly adsorb on the CeO_2 (110) surface, the H_2O molecule plays a role as a bridge. • Ce−O−H bond can enhance the adsorption effect. • Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Abstract: Density functional theory (DFT) calculations were performed to investigate the reaction pathways for catalytic hydrolysis of COS over CeO_2 (110) surface using Dmol"3 model. The thermodynamic stability analysis for the suggested routes of COS hydrolysis to CO_2 and H_2S was evaluated. The absolute values of adsorption energy of H_2O-CeO_2 are higher than that of COS-CeO_2. Meanwhile, the adsorption energy and geometries show that H_2O is easier adsorbed on the surface of CeO_2 (110) than COS. H_2O plays a role as a bridge in the process of joint adsorption. H_2O forms more Ce−O−H groups on the CeO_2 (110) surface. CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. The migration of H from H_2O to COS is the key for the hydrolysis reaction. C−O channel is easier to occur than C−S channel. Experimental result shows that adding of CeO_2 can increase COS removal rate and prolong the 100% COS removal rate from 180 min to 210 min. The difference between Fe_2O_3 and CeO_2 for the hydrolysis of COS is characterized in the atomic charge transfer and the formation of H−O bond and H−S bond. The transfer effect of H in H_2O to S in COS over CeO_2 decreases the energy barriers of hydrolysis reaction, and enhances the reaction activity of COS hydrolysis.
Notes on radiation effects on materials
International Nuclear Information System (INIS)
Anno, J.N.
1984-01-01
The effects of radiation from nuclear reactions on various classes of materials are examined in an introductory textbook for students of nuclear engineering. Topics discussed include the units and general scale of radiation damage, fundamental interactions of neutrons and gamma rays with materials, transient radiation effects on electrical components, radiation effects on organic materials and on steels, nuclear fission effects, surface effects of nuclear radiations, radiation effects on biological material, and neutron and gamma-ray dosimetry. Graphs, diagrams, tables of numerical data, and problems for each chapter are provided. 122 references
DEFF Research Database (Denmark)
Zibar, Darko; Sambaraju, Rakesh; Caballero Jambrina, Antonio
2010-01-01
We report on the first demonstration of QPSK based Wireless-over-Fibre link in 75-110GHz band with a record capacity of up to 16Gb/s. Photonic wireless signal generation by heterodyne beating of free-running lasers and baud-rate digital coherent detection are employed....
On the instability effects in radiation-sensitive chalcogenide glasses
International Nuclear Information System (INIS)
Balitska, V.; Kovalskiy, A.; Shpotyuk, O.; Vakiv, M.
2007-01-01
The features of application of radiation-sensitive media based on chalcogenide glasses of As-Ge-S system for registration of high-energy γ-radiation are analysed. It is shown that compositional features of the observed time-instability effect should be taken into account in order to ensure a higher accuracy of the developed dosimeters
On the instability effects in radiation-sensitive chalcogenide glasses
Energy Technology Data Exchange (ETDEWEB)
Balitska, V. [Lviv State University for Vital Activity Safety, 35 Kleparivska str., Lviv, UA-79007 (Ukraine); Lviv Institute of Materials of SRC ' Carat' , 202 Stryjska str., Lviv, UA-79031 (Ukraine); Kovalskiy, A. [Lviv Institute of Materials of SRC ' Carat' , 202 Stryjska str., Lviv, UA-79031 (Ukraine); International Materials Institute for New Functionality in Glass, Lehigh University, 5 East Packer Avenue, Bethlehem, PA 18015-3195 (United States); Shpotyuk, O. [Lviv Institute of Materials of SRC ' Carat' , 202 Stryjska str., Lviv, UA-79031 (Ukraine); International Materials Institute for New Functionality in Glass, Lehigh University, 5 East Packer Avenue, Bethlehem, PA 18015-3195 (United States)], E-mail: shpotyuk@novas.lviv.ua; Vakiv, M. [Lviv Institute of Materials of SRC ' Carat' , 202 Stryjska str., Lviv, UA-79031 (Ukraine)
2007-04-15
The features of application of radiation-sensitive media based on chalcogenide glasses of As-Ge-S system for registration of high-energy {gamma}-radiation are analysed. It is shown that compositional features of the observed time-instability effect should be taken into account in order to ensure a higher accuracy of the developed dosimeters.
International Nuclear Information System (INIS)
Belyakov, Oleg V.; Kuopio Univ.
2008-01-01
effect induction. A single 2 μm location on tissue section was pre-irradiated with 1-10 3 He 2+ particles (5 MeV; LET 75 keV/μm) using microbeam system. Even although only a single region of the tissue section was targeted, thousands of additional cells were found to undergo bystander induced differentiation. This resulted in an overall increase in the fraction of differentiated cells for approximately 10-15 %, which are much greater than that observed for the induction of damage (not more than 1-2 % of apoptotic cells). Our theory is that the main functions of bystander effect are to decrease the risk of transformation in a multi cultural organism exposed to radiation by removing a group of potentially damaged cells via apoptosis and increased differentiation. (author)
Energy Technology Data Exchange (ETDEWEB)
Rapko, Brian M.; Vienna, John D.; Sinkov, Serguei I.; Kim, Jinseong; Cisar, Alan J.
2002-09-10
This study addressed three aspects in selected alkaline leaching: first, the use of oxidants persulfate, permanganate, and ferrate as selective chromium-leaching agents from washed Hanford Tank S-110 solids under varying conditions of hydroxide concentration, temperature, and time was investigated. Second, the selective dissolution of solids containing mercury(II) oxide under alkaline conditions was examined. Various compounds were studied for their effectiveness in dissolving mercury under varying conditions of time, temperature, and hydroxide concentration in the leachate. Three compounds were studied: cysteine, iodide, and diethyldithiophosphoric acid (DEDTPA). Finally, the possibility of whether an oxidant bound to an anion-exchange resin can be used to effectively oxidize chromium(III) in alkaline solutions was addressed. The experimental results remain ambiguous to date; further work is required to reach any definitive conclusions as to the effectiveness of this approach.
Promotion effect of monovalent metals (K and Cs) on the GaAs (110) surface oxidation
International Nuclear Information System (INIS)
Valeri, S.; Sberveglieri, P.; Angeli, E.
1987-01-01
The effect of thin (∼ 1 monolayer) overlayers of low electronegativity metals (Cs and K) on the RT oxidation behaviour of GaAs(110) cleavage surface is studied. This study was with Auger and Photoemission spectroscopies. Attention has been focused on the core-valence-valence and Auger lineshapes on the Ga and As 3d peaks. Presence of the alkali metal enhances the GaAs (110) oxidation rate several orders of magnitude above the clean surface value has been found. The range 0-100 Langmuir is investigated in detail. The oxidation process of the GaAs(110) surface in the presence of both K and Cs overlayer follows a multi-step kinetic and reaches a saturation at exposure lower than 100 Langmuir. Both Ga and As atoms are involved in the oxygen bonding. The metal enhanced semiconductor oxidation is generally reported to be a process involving predominantly the semiconductor surface atoms. However in the Cs - and K - GaAs case, an involvement of the alkali metal atoms too, reflected in the shape modification of their Auger line has been found. The promotion effect of K and Cs is discussed in terms of their low electronegativity and in comparison with the results recently reported in the literature for the other low electronegativity metals
International Nuclear Information System (INIS)
Li Shiqing; Yan Heping
1995-01-01
The authors briefly discusses the radiation environment in near-earth space and it's influences on material, and electronic devices using in space airship, also, the research developments in space radiation effects are introduced
Ecological effects of ionizing radiation and other toxic agents on the aquatic microcosm
International Nuclear Information System (INIS)
Fuma, Shoichi; Ishii, Nobuyoshi; Tanaka, Nobuyuki; Takeda, Hiroshi; Miyamoto, Kiriko; Yanagisawa, Kei; Kawabata, Zen'ichiro
2004-01-01
The purpose of this study was comparative evaluation of effects of ionizing radiation and other various toxic agents on aquatic microbial communities. For this purpose, the authors investigated effects of γ-rays, ultraviolet (UV) radiation, acidification, aluminum, manganese, nickel, copper and gadolinium on the microcosm, i.e., the experimental model ecosystem consisting of populations of the flagellate alga Euglena gracilis as a producer, the ciliate protozoan Tetrahymena thermophila as a consumer and the bacterium Eseherichia coli as a decomposer. Effects of toxic agents in the microcosm were not only direct effects but also community-level effects due to interactions among the constituting species or between organisms and toxic agents. In general, the degrees of effects observed in the microcosm could be categorized as follows: no effects; recognizable effects, i.e., decrease or increase in the cell densities of at least one species; severe effects, i.e., extinction of one or two species; and destructive effects, i.e., extinction of all species. These results were analyzed by the ecological effect index (EEI), in which differences in the cell densities between exposed and control microcosm were represented by the Euclidean distance function. A 50% effect doses for the microcosm (ED M50 ), at which the EEI became 50%, were evaluated to be 530 Gy for γ-rays, 2100 J m -2 for UV, 4100 μM for manganese, 45 μM for nickel, 110 μM for copper and 250 μM for gadolinium. (author)
Non-carcinogenic late effects of ionizing radiation; human data
International Nuclear Information System (INIS)
Beebe, G.W.
1979-01-01
The late effects of ionizing radiation may be somatic effect or potential effect, about which such informations as follows are required: teratogenesis the disturbances in growth and development, cataracts, infertility, cytogenetic aberration, and accelerated aging. Although much is known about the nature of the malformations produced by ionizing radiation, and about the vulnerability of human embryonal and fetal tissues during various stages of organogenesis, the quantitative information is uncertain and incomplete. The data on A-bomb survivors were flawed by confounding radiation dose with nutritional and other influences caused by the disasters created by war-time bombings. If the effects of radiation are real, they are quite small for the dose below 100 rad (kerma), are confined to the children of pre-pubertal age at the time of exposure, and are of much less consequence for low-LET radiation than for high. Radiation-induced lenticular changes are of graded severity, and as for cataracts, the threshold is in the range from 600 to 1,000 rad of low-LET radiation, and perhaps 75 to 100 rad for fast neutrons; the average latent period is 2 to 7 years. The estimate of the RBE for neutrons is in the range from 2 to 10, and dose-dependent. Ionizing radiation has important effects on fertility only at very high dose. The relationship of the quantitative aspects of the biologic significance of chromosomal aberration in somatic cells to dose may provide an interesting parallel to the carcinogenic effect. For neutrons, the dose-response curve appears to be linear, at least for stable aberration. (Yamashita, S.)
International Nuclear Information System (INIS)
Yonei, S.
1979-01-01
In this study, the effects of chlorpromazine, procaine and quinidine on the X-radiation effects on Escherichia coli B/r and its radiosensitive mutant Bsub(s-1) (which is genetically unable to repair radiation damage to DNA) were examined. At chlorpromazine concentrations > = 25 mM, there was loss of colony-forming ability in both strains. Chlorpromazine (0.1 mM) markedly sensitized E. coli B/r under hypoxic conditions of irradiation but not under oxic conditions. There was no significant radiosensitization by chlorpromazine (0.1-1.0mM) in E. coli Bsub(s-1) under either oxic or hypoxic conditions. Similar results were obtained when procaine and quinidine were used as 'membrane-binding radiosensitizers'. Thus these results suggested that radiosensitization by such drugs in E. coli B/r was the result of inhibition of post-irradiation DNA repair in cells. It was concluded that the inhibition of DNA repair could be a secondary consequence of cell membrane alterations or damage caused by the membrane-binding of these drugs. (UK)
Research on radiation effect and radiation protection at JAEA
International Nuclear Information System (INIS)
Saito, Kimiaki
2007-01-01
Researches on radiation effect and radiation protection at JAEA have been carried out in different sections. In recent years, the organizations were rearranged to attain better research circumstances, and new research programs started. At present, radiation effect studies focus on radiation effect mechanisms at atomic, molecular and cellular levels including simulation studies, and protection studies focus on dosimetry for conditions difficult to cover with currently used methods and data as well as the related basic studies. The outlines of the whole studies and also some descriptions on selected subjects will be given in this paper. (author)
A-bomb radiation effects digest
International Nuclear Information System (INIS)
Shigematsu, Itsuzo; Akiyama, Mitoshi; Sasaki, Hideo; Ito, Chikako; Kamada, Nanao.
1993-01-01
This publication is the digest of the book 'Genbaku Hoshasen no Jintai Eikyo (Effects of A-bomb Radiation on the Human Body)' (365p.), published in Japanese by Hiroshima International Council for Medical Care of the Radiation-Exposed. Following a brief description on the damage of the atomic bomb, the subjects of malignant tumors, endocrine and metabolic deseases, ocular lesions, dermatologic effects, prenatal exposure, chromosoal aberrations, mutations, sensitivity to radiation, immune function, genetic effects and other effects of radiation are summarized. (J.P.N.)
Biological effects of ionizing radiation
International Nuclear Information System (INIS)
Gisone, Pablo; Perez, Maria R.
2001-01-01
It has been emphasised the importance of DNA as the main target for ionizing radiation, that can induce damage by its direct action on this molecule or by an indirect effect mediated by free-radicals generated by water radiolysis. Biological effects of ionizing radiation are influenced not only by the dose but also by the dose-rate and the radiation quality. Radiation induced damage, mainly DNA single and double strand breaks, is detected by molecular sensors which in turn trigger signalling cascades leading to cell cycle arrest to allow DNA repair or programmed cell death (apoptosis). Those effects related with cell death, named deterministic, exhibits a dose-threshold below which they are not observed. Acute radiation syndrome and radiological burns are examples of this kind of effects. Other radiation induced effects, called stochastic, are the consequence of cell transformation and do not exhibit a dose-threshold. This is the case of cancer induction and hereditary effects. The aim of this presentation is briefly describe the main aspects of deterministic and stochastic effects from the point of view of radiobiology and radio pathology. (author)
Radiation and children's health
International Nuclear Information System (INIS)
Ichikawa, Yoko
2015-01-01
After the accident of TEPCO Fukushima Daiichi Nuclear Power Station, a variety of information has been complicatedly prevailing on the health effects of radiation exposure, which forces residents to spend uneasy days. Its cause is that the information on radiation cannot properly be understood by them. For the healthy growth of children, in particular, it is important to properly understand the situation, and raise children without losing to anxiety and rumors. Fukushima City has held lectures in order to eliminate the anxiety of parents in child-rearing, where some misunderstandings were seen judging from questions about radiation there. In the form of answering to the misconceptions of them, this paper explains the effect of low-dose exposure, provisional reference value of the radioactive cesium in foods, and thyroid cancer and health damage caused by radiation. In addition, it comparatively analyzed the health survey results in Fukushima prefecture with those of residents in other prefectures. (A.O.)
International Nuclear Information System (INIS)
Sanger, P.A.; Danby, G.T.
1975-01-01
Shielding, radiation damage, and radiation heating at the planned ISABELLE storage rings were considered. Radiation shielding studies were reviewed and were found to be adequate for present day dosage limits. Radiation damage could be encountered in some extreme cases, but is not expected to limit the performance of the superconducting magnets. Experiments to study the effect of radiation heating on actual magnets are recommended
Energy transfer in porous anodic alumina/rhodamine 110 nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Elhouichet, H., E-mail: habib.elhouichet@fst.rnu.tn [Laboratoire de Physico-Chimie des Materiaux Mineraux et leurs Applications, Centre National de Recherches en Sciences des Materiaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Departement de Physique, Faculte des Sciences de Tunis, University of Tunis Elmanar 2092 Tunis (Tunisia); Harima, N.; Koyama, H. [Hyogo University of Teacher Education, Kato, Hyogo 673-1494 (Japan); Gaponenko, N.V. [Belarusian State University of Informatics and Radioelectronics, P. Browki St. 6, 220013 Minsk (Belarus)
2012-09-15
We have used porous anodic alumina (PAA) films as templates for embedding rhodamine 110 (Rh110) molecules and examined their photoluminescence (PL) properties in detail. The analysis of the polarization memory (PM) of PL strongly suggests that there is a significant energy transfer from PAA to Rh110 molecules. The effect of annealing the PAA layer on the PL properties of the nanocomposite has been studied. The results show that the energy transfer becomes more efficient in annealed PAA. - Highlights: Black-Right-Pointing-Pointer Porous anodic alumina-rhodamine 110 nanocomposites are elaborated. Black-Right-Pointing-Pointer Efficient energy transfer from the host to Rh110 molecules is evidenced from measurements of photoluminescence and degree of polarization memory spectra. Black-Right-Pointing-Pointer Thermal annealing of porous anodic alumina can improve the process of excitation transfer.
Radiation-induced polymerization and radiation effect on polymers
International Nuclear Information System (INIS)
Seguchi, Tadao
1977-12-01
The processes of radiation-induced polymerization of monomers and also radiation effects on polymers have been studied by instrumental analyses of electron spin resonance (ESR), nuclear magnetic resonance (NMR) and electron microscopy. In radiation-induced polymerization, graft-copolymerization and absorbed state polymerization were taken up. For graft-copolymerization, monomers such as methylmethacrylate and butadiene were made to react with irradiated polyethylene, and behaviors of the initiating radicals and propagating radicals were followed under the reaction by ESR. For absorbed state polymerization, acrylonitrile/zeolite and methylmethacrylate/zeolite were chosen. Absorbed monomers were irradiated at 77 0 K and polymerized at room temperature. Active species and the concentrations were measured by ESR and the yields of polymer were observed by NMR. In radiation effect on polymers, polyvinylfluoride, polyvinylidenfluoride and polytetrafluoroethylene were taken up. Active species trapped in the polymer matrixes were identified and decay and reactivity of the species were also studied. On the basis of information from the electron microscopy and x-ray analysis, radiation effects on these polymers are described. In polytetrafluoroethylene produced by radiation polymerization, the relation between morphology and polymerization conditions and also the process of crystallization during polymerization were studied. (auth.)
Effects of total dose of ionizing radiation on integrated circuits
Energy Technology Data Exchange (ETDEWEB)
Silveira, Marcilei A.G.; Cirne, K.H.; Gimenez, S.; Santos, R.B.B. [Centro Universitario da FEI, Sao Bernardo do Campo, SP (Brazil); Added, N.; Barbosa, M.D.L.; Medina, N.H.; Tabacniks, M.H. [Universidade de Sao Paulo (IF/USP), SP (Brazil). Inst. de Fisica; Lima, J.A. de; Seixas Junior, L.E.; Melo, W. [Centro de Tecnologia da Informacao Paulo Archer, Sao Paulo, SP (Brazil)
2011-07-01
Full text: The study of ionizing radiation effects on materials used in electronic devices is of great relevance for the progress of global technological development and, particularly, it is a necessity in some strategic areas in Brazil. Electronic circuits are strongly influenced by radiation and the need for IC's featuring radiation hardness is largely growing to meet the stringent environment in space electronics. On the other hand, aerospace agencies are encouraging both scientific community and semiconductors industry to develop hardened-by-design components using standard manufacturing processes to achieve maximum performance, while significantly reducing costs. To understand the physical phenomena responsible for changes in devices exposed to ionizing radiation several kinds of radiation should then be considered, among them alpha particles, protons, gamma and X-rays. Radiation effects on the integrated circuits are usually divided into two categories: total ionizing dose (TID), a cumulative dose that shifts the threshold voltage and increases transistor's off-state current; single events effects (SEE), a transient effect which can deposit charge directly into the device and disturb the properties of electronic circuits. TID is one of the most common effects and may generate degradation in some parameters of the CMOS electronic devices, such as the threshold voltage oscillation, increase of the sub-threshold slope and increase of the off-state current. The effects of ionizing radiation are the creation of electron-hole pairs in the oxide layer changing operation mode parameters of the electronic device. Indirectly, there will be also changes in the device due to the formation of secondary electrons from the interaction of electromagnetic radiation with the material, since the charge carriers can be trapped both in the oxide layer and in the interface with the oxide. In this work we have investigated the behavior of MOSFET devices fabricated with
Improved treatment of radiation effects on the skin
International Nuclear Information System (INIS)
Wandl, E.O.; Kaercher, K.H.; Wandl-Hainberger, I.
1985-01-01
The treatment concept developed by K.H. Kaercher was extended by a therapy using Elasten S cream. In the course of a highvoltage therapy using fast electrons or cobalt-60, interesting aspects in the treatment and progression of the radiation reactions of the skin were established. The dermato-therapeutic principles layed down by K.H. Kaercher with the treatment palette used hitherto, have without doubt invariably proven their value. The exclusive powder treatment, however, may be made more practical by application of the new treatment cream in accordance with the intervals in radiation treatment or as a basic treatment towards the end of therapy. Furthermore it is ideally suited for the care and after-treatment of skin, strained by radiation. It reduces considerably the remaining visible radiation reactions. The treatment with powder and emulsion has for more than 10 years proven effective. After the excellent results of the new cream during radiation treatment, additional positive effects are expected in a long-term trial which will be reported on separately. (orig.) [de
Epigenetic effects of ionizing radiation
International Nuclear Information System (INIS)
EI-Naggar, A.M.
2007-01-01
Data generated during the last three decades provide evidence of Epigenetic Effects that ave-induced by ionizing radiation, particularly those of high LET values, and low level dose exposures. Epigenesist is defined as the stepwise process by which genetic information, as modified by environmental influences, is translated into the substance and behavior of cells, tissues, organism.The epigenetic effects cited in the literature are essentially classified into fine types depending on the type and nature of the effect induced.The most accepted postulation, for the occurrence of these epigenetic effects, is a radiation induced bio electric disturbances in the environment of the non-irradiated cellular volume. This will trigger signals that will induce effects in the unirradiated cells.The epigenetic effects referenced in the literature up to date are five types; namely, Genomic Instability, Bystander. Effects, Clastogenic Plasma Factors,, Abscopal Effects, and Tran generational Effects.The demonstration of Epigenetic Effects associated with exposure to ionizing radiation indicates the need to re- examine the concept of radiation dose and target size. Also an improved understanding of qualifiring and quantifying radiation risk estimates may be attained. Also, a more logical means to understand the underlying mechanisms of radiation induced carcinogenic transformation of cells
Radiation effect on implanted pacemakers
International Nuclear Information System (INIS)
Pourhamidi, A.H.
1983-01-01
It was previously thought that diagnostic or therapeutic ionizing radiation did not have an adverse effect on the function of cardiac pacemakers. Recently, however, some authors have reported damaging effect of therapeutic radiation on cardiac pulse generators. An analysis of a recently-extracted pacemaker documented the effect of radiation on the pacemaker pulse generator
The effects and control of radiation
International Nuclear Information System (INIS)
Saunders, P.A.H.
1982-12-01
The subject is discussed under the headings: introduction; ionising radiation (alpha and beta particles, gamma- and X-radiation, neutrons, half-life, sources of radiation); biological effects; risk estimates (somatic) (early effects, delayed effects); risk estimates (hereditary); control of radiation; risk estimates (accidents). (U.K.)
Mutagenic effect of gamma radiation on Arabidopsis thaliana. Effect of low temperature and cytokinin
International Nuclear Information System (INIS)
Pesina, K.
1975-01-01
The effect was studied of low temperature and cytokinin (6-benzyl aminopurine) on sterility and mutation frequency in A r a b i d o ps i s t h a l i a n a irradiatied with gamma radiation. Liquid nitrogen temperature was found to modify the radiation effect in that that it reduced sterility and mutation frequency. Cytokinin applied to seed prior to and after irradiation increased mutation frequency. (L.O.)
International Nuclear Information System (INIS)
Kaushik, M.P.; Singh, I.
1978-01-01
Investigations were carried out to study the combined effect of morphactin and gamma radiation on growth, sex expression and yield in Luffa cylindrica variety, 'Pusa Chikni'. Healthy seeds were subjected to gamma radiation dose of 1000 rad and grown in seed beds. Solutions of 1,10 and 1100 mg/1 of morphactin were sprayed on the plants at two to four true leaf stage. Plants grown from irradiated seeds, on which morphactin solutions were sprayed showed remarkable healthy growth. Application of morphactin at 1,10 and 100 mg/1 increased the position of node bearing first staminate flower, whereas a reduction was observed in the position of node bearing first pistillate flower. Days for anthesis to first staminate flower increased progressively while days for anthesis to first pistillate flower decreased gradually. Decrease in the production of staminate flowers was observed, while the production of pistillate flowers increased significantly in all the treatments. The ratio of staminate/ pistillate flowers decreased progressively with increasing morphactin concentration. One mg/1 morphactin application increased the length of vine whereas number of lateral branches increased in all the treatments. The number, length, diameter and weight of fruit increased at 1 and 10 mg/1 morphactin while at 100 mg/1 treatment these characters decreased significantly. (author)
Radiation Therapy Side Effects
Radiation therapy has side effects because it not only kills or slows the growth of cancer cells, it can also affect nearby healthy cells. Many people who get radiation therapy experience fatigue. Other side effects depend on the part of the body that is being treated. Learn more about possible side effects.
11 CFR 110.13 - Candidate debates.
2010-01-01
... debates include at least two candidates; and (2) The staging organization(s) does not structure the... PROHIBITIONS § 110.13 Candidate debates. (a) Staging organizations. (1) Nonprofit organizations described in 26..., subparts D and E. (b) Debate structure. The structure of debates staged in accordance with this section and...
International Nuclear Information System (INIS)
Gong Xiaomei; Zhou Daoan; Cao Jianping; Fan Saijun; Zhu Wei
2010-01-01
Objective: To investigate cytotoxic and radiosensitizing effect of Artemisinin on cervical carcinoma cell line HeLa. Methods: In order to measure the optimized effective time, cytotoxic effect of Artemisinin on HeLa cell line was investigated with MTT assay. The radiosensitization effect of different doses and different treatment duration of Artemisinin on HeLa cell line were evaluated by MTT test, the SER is 1.17 and radiosensitizing effect was measured with multi-target single hit model through SER of HeLa cell. Cell cycles in different groups were calculated by flow cytometry. Results: The 50% inhibition concentration of Artemisinin interacted with HeLa cells for 24 h is 600.19 nmol/ml, and for 48 h is 160.71 nmol/ml. The HeLa cells'surival ratio is 93.51%, 91.87%, and 87.28% after adding Atemisinin of 110.69 nmol/ml and 1 Gy radiation exposure. There are three groups: the chemotherapy only group, the radiotherapy only group and the combination group. The result of the cell cycles showed that cells in G 2 /M period decreased in the combination group. Conclusion: Artemisinin has radiosensitization effect on cervical carcinoma HeLa cells, whichshows dose and time dependent. Artemisinin can inhibit the G 2 /M block by ionizing radiation. (authors)
International Nuclear Information System (INIS)
Saunders, P.A.H.
1981-01-01
The available evidence on the effects of radiation on man and the predictions that have been made of possible low level effects are reviewed. Data from United Nations Scientific Committee of the Effects of Atomic Radiation (UNSCEAR) and the committee on the Biological Effects of Ionising Radiation (BEIR) is used to illustrate the acute, delayed and hereditary effects of high dose levels. The effects of low dose levels are discussed on the assumption that both somatic and hereditary effects can be predicted on the basis of linear extrapolation from high dose effects. (U.K.)
PROPER MOTIONS OF THE HH 110/270 SYSTEM
International Nuclear Information System (INIS)
Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.
2012-01-01
We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.
Incorporation of detailed eye model into polygon-mesh versions of ICRP-110 reference phantoms.
Nguyen, Thang Tat; Yeom, Yeon Soo; Kim, Han Sung; Wang, Zhao Jun; Han, Min Cheol; Kim, Chan Hyeong; Lee, Jai Ki; Zankl, Maria; Petoussi-Henss, Nina; Bolch, Wesley E; Lee, Choonsik; Chung, Beom Sun
2015-11-21
The dose coefficients for the eye lens reported in ICRP 2010 Publication 116 were calculated using both a stylized model and the ICRP-110 reference phantoms, according to the type of radiation, energy, and irradiation geometry. To maintain consistency of lens dose assessment, in the present study we incorporated the ICRP-116 detailed eye model into the converted polygon-mesh (PM) version of the ICRP-110 reference phantoms. After the incorporation, the dose coefficients for the eye lens were calculated and compared with those of the ICRP-116 data. The results showed generally a good agreement between the newly calculated lens dose coefficients and the values of ICRP 2010 Publication 116. Significant differences were found for some irradiation cases due mainly to the use of different types of phantoms. Considering that the PM version of the ICRP-110 reference phantoms preserve the original topology of the ICRP-110 reference phantoms, it is believed that the PM version phantoms, along with the detailed eye model, provide more reliable and consistent dose coefficients for the eye lens.
Energy Technology Data Exchange (ETDEWEB)
Savouyaud, J; Menoux, A [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1960-07-01
The authors show what general characteristics must have equipment designed for radiation control. This equipment must make possible the measurement of doses corresponding to 1/10 of the maximum permissible limit. It should be designed for a specific purpose, and finally it should be independent as far as possible. The authors review the different types of control which it is necessary to effect. (author) [French] Les auteurs indiquent quelles doivent etre les caracteristiques generales du materiel de controle des radiations. Ce materiel doit permettre l'appreciation de mesures correspondant au 1/10{sup e} des limites maximales admissibles. Il devrait etre concu pour une fonction determinee, enfin, il doit etre dans la mesure du possible, autonome. Les auteurs passent en revue les differents types de controle qu'il est necessaire de couvrir. (auteur)
Radiation Protection Act promulgated on May 19, 1988, SFS 1988: 220
International Nuclear Information System (INIS)
1988-01-01
This Act entered into force on 1 July 1988 and supersedes the previous Radiation Protection Act (SFS 1958: 110). The objective of the new Act is to protect humans, animals and the environment from the harmful effects of ionizing as well as non-ionizing radiation. As previously, the main responsibility for public radiation protection will rest with one central radiation protection authority. The general obligations with regard to radiation protection place a greater responsibility than in the past on persons carrying out activities involving radiation. The Act also contains rules governing decommissioning of technical equipment which could generate radiation. Basically, the same requirements still apply regarding licensing of activities involving ionizing radiation, with certain extensions covering, inter alia, also production and transportation of radioactive material. Under the Act, it is now possible to adjust the licensing and supervisory procedures to the level of danger of the radiation source and the need for adequate competence, etc., and finally, more effective supervision is provided for. (NEA) [fr
The biological effects of radiation
International Nuclear Information System (INIS)
Sykes, D.A.
1979-01-01
The hazards of radiations to man are briefly covered in this paper. The natural background sources of radiations are stated and their resulting doses are compared to those received voluntarily by man. The basis of how radiations cause biological damage is given and the resulting somatic effects are shown for varying magnitude of dose. Risk estimates are given for cancer induction and genetic effects are briefly discussed. Finally four case studies of radiation damage to humans are examined exemplifying the symptoms of large doses of radiations [af
Silencing p110β prevents rapid depletion of nuclear pAkt
International Nuclear Information System (INIS)
Ye, Zhi-wei; Ghalali, Aram; Högberg, Johan; Stenius, Ulla
2011-01-01
Highlights: ► p110β was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. ► p110β knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. ► Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110β subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110β in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110β knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110β is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110β knock out cells. We also found that p110β was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110β is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.
Silencing p110{beta} prevents rapid depletion of nuclear pAkt
Energy Technology Data Exchange (ETDEWEB)
Ye, Zhi-wei; Ghalali, Aram; Hoegberg, Johan [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden); Stenius, Ulla, E-mail: ulla.stenius@ki.se [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden)
2011-12-02
Highlights: Black-Right-Pointing-Pointer p110{beta} was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. Black-Right-Pointing-Pointer p110{beta} knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. Black-Right-Pointing-Pointer Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110{beta} subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110{beta} in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110{beta} knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110{beta} is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110{beta} knock out cells. We also found that p110{beta} was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110{beta} is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.
THE HEAT TREATMENT ANALYSIS OF E110 CASE HARDENING STEEL
Directory of Open Access Journals (Sweden)
MAJID TOLOUEI-RAD
2016-03-01
Full Text Available This paper investigates mechanical and microstructural behaviour of E110 case hardening steel when subjected to different heat treatment processes including quenching, normalizing and tempering. After heat treatment samples were subjected to mechanical and metallographic analysis and the properties obtained from applying different processes were analysed. The heat treatment process had certain effects on the resultant properties and microstructures obtained for E110 steel which are described in details. Quenching produced a martensitic microstructure characterized by significant increase in material’s hardness and a significant decreased in its impact energy. Annealed specimens produced a coarse pearlitic microstructure with minimal variation in hardness and impact energy. For normalized samples, fine pearlitic microstructure was identified with a moderate increase in hardness and significant reduction in impact energy. Tempering had a significant effect on quenched specimens, with a substantial rise in material ductility and reduction of hardness with increasing tempering temperature. Furthermore, Results provide additional substantiation of temper embrittlement theory for low-carbon alloys, and indicate potential occurrence of temper embrittlement for fine pearlitic microstructures.
Perception of low dose radiation risks among radiation researchers in Korea
Seo, Songwon; Lee, Dalnim; Park, Sunhoo; Jin, Young Woo; Lee, Seung-Sook
2017-01-01
Expert’s risk evaluation of radiation exposure strongly influences the public’s risk perception. Experts can inform laypersons of significant radiation information including health knowledge based on experimental data. However, some experts’ radiation risk perception is often based on non-conclusive scientific evidence (i.e., radiation levels below 100 millisievert), which is currently under debate. Examining perception levels among experts is important for communication with the public since these individual’s opinions have often exacerbated the public’s confusion. We conducted a survey of Korean radiation researchers to investigate their perceptions of the risks associated with radiation exposure below 100 millisievert. A linear regression analysis revealed that having ≥ 11 years’ research experience was a critical factor associated with radiation risk perception, which was inversely correlated with each other. Increased opportunities to understand radiation effects at risk perception of radiation exposure. In addition, radiation researchers conceived that more scientific evidence reducing the uncertainty for radiation effects risk perception of radiation exposure. PMID:28166286
Radiation effects on polyaniline
International Nuclear Information System (INIS)
Oki, Yuichi; Kondo, Kenjiro; Suzuki, Takenori; Numajiri, Masaharu; Miura, Taichi; Doi, Shuji; Ohnishi, Toshihiro.
1992-01-01
Effects of γ-irradiation on electrical conductivity of polyaniline were investigated. A drastic increase of the conductivity due to radiation-induced doping was observed in combined systems of polyaniline films and halogen-containing polymers. This effect can be applied to measure an integrated radiation dose. (author)
Untargeted effects of ionizing radiation: Implications for radiation pathology
International Nuclear Information System (INIS)
Wright, Eric G; Coates, Philip J
2006-01-01
The dogma that genetic alterations are restricted to directly irradiated cells has been challenged by observations in which effects of ionizing radiation, characteristically associated with the consequences of energy deposition in the cell nucleus, arise in non-irradiated cells. These, so called, untargeted effects are demonstrated in cells that have received damaging signals produced by irradiated cells (radiation-induced bystander effects) or that are the descendants of irradiated cells (radiation-induced genomic instability). Radiation-induced genomic instability is characterized by a number of delayed adverse responses including chromosomal abnormalities, gene mutations and cell death. Similar effects, as well as responses that may be regarded as protective, have been attributed to bystander mechanisms. Whilst the majority of studies to date have used in vitro systems, some adverse non-targeted effects have been demonstrated in vivo. However, at least for haemopoietic tissues, radiation-induced genomic instability in vivo may not necessarily be a reflection of genomically unstable cells. Rather the damage may reflect responses to ongoing production of damaging signals; i.e. bystander responses, but not in the sense used to describe the rapidly induced effects resulting from direct interaction of irradiated and non-irradiated cells. The findings are consistent with a delayed and long-lived tissue reaction to radiation injury characteristic of an inflammatory response with the potential for persisting bystander-mediated damage. An important implication of the findings is that contrary to conventional radiobiological dogma and interpretation of epidemiologically-based risk estimates, ionizing radiation may contribute to malignancy and particularly childhood leukaemia by promoting initiated cells rather than being the initiating agent. Untargeted mechanisms may also contribute to other pathological consequences
International Nuclear Information System (INIS)
Hussin, E.K.; Abdel-Megeed, M.I.; Wakid, A.M.; Fadel, A.M.
2010-01-01
An attempt was carried out to investigate the effect of gamma irradiation on sterility and male mating competitiveness of the medfly C. capitata (Wied.) under hypo and hyperthermia in order to minimize the deleterious effects of radiation on insects. Low, moderate and high temperature (5, 25 and 32 degree C) were applied to pupal and adult stages of C. capitata at different ages before and/or after irradiation with the doses (70, 90 and 110 Gy) of gamma radiation. Sterility of pupae or adults exposed to low temperature (5 degree C) before or after irradiation was increased compared with their controls. The rate of increase was more clear in pupae exposed after irradiation and in adults exposed before irradiation. When pupae or adults were treated with high temperature (32 degree C) for 24 h before or after irradiation, adult sterility was increased with increasing the radiation dose. The competitiveness values were greatly higher when pupae or adults were exposed to low temperature (5 degree C) than those exposed to moderate or high temperature before irradiation.
Topical Day on Biological Effects of Radiation
Energy Technology Data Exchange (ETDEWEB)
Baatout, S.; Jacquet, P.
1997-05-15
The topical day has been focussed on the potential effects of ionizing radiation on human health. A general overview on molecular and biophysical aspects of radiation, its effects on cells and organisms, and the contribution of radiobiology to radiation protection and risk assessment is given. The genetic effects of radiation and its effects on the developing organism, the effects of radiation on the cell cycle and the mechanisms of radiation induced apoptosis were also discussed.
Topical Day on Biological Effects of Radiation
International Nuclear Information System (INIS)
Baatout, S.; Jacquet, P.
1997-01-01
The topical day has been focussed on the potential effects of ionizing radiation on human health. A general overview on molecular and biophysical aspects of radiation, its effects on cells and organisms, and the contribution of radiobiology to radiation protection and risk assessment is given. The genetic effects of radiation and its effects on the developing organism, the effects of radiation on the cell cycle and the mechanisms of radiation induced apoptosis were also discussed
Time-resolved studies of direct effects of radiation on DNA
International Nuclear Information System (INIS)
Fielden, E.M.; O'Neill, P.; Al-Kazwini, A.
1987-01-01
The biological changes induced by ionising radiation are a consequence of radiation-induced chemical events taking place at times <1s. These events are strongly influenced by the presence of chemical modifiers. Since DNA is a principle target for radiation-induced cell killing, DNA-free radicals are generated by direct ionisation of DNA moieties (direct effect) and by reaction with hydroxyl radicals formed by radiolysis of the water which is in the vicinity of the DNA (indirect effect). In order to study the 'direct' effects of radiation on DNA the following model approaches are discussed:- 1) Use of the technique of pulse radiolysis to investigate in aqueous solution the interactions of deoxynucleosides with SO/sub 4//sup .-/ whereby one-electron oxidised species of the bases are generated; and 2) time resolved, radiation-induced changes to solid DNA and related macromolecules (e.g. radiation-induced luminescence) in order to obtain an understanding of charge/energy migration as a result of ionisation of DNA. The influence of chemical modifiers and of environment is discussed in terms of the properties of the radiation-induced species produced. Since the properties of base radicals produced by SO/sub 4//sup .-/ are similar to those of the base OH-adducts oxidising properties, potential similarities between the 'direct' and 'indirect' effects of radiation are presented
Data error effects on net radiation and evapotranspiration estimation
International Nuclear Information System (INIS)
Llasat, M.C.; Snyder, R.L.
1998-01-01
The objective of this paper is to evaluate the potential error in estimating the net radiation and reference evapotranspiration resulting from errors in the measurement or estimation of weather parameters. A methodology for estimating the net radiation using hourly weather variables measured at a typical agrometeorological station (e.g., solar radiation, temperature and relative humidity) is presented. Then the error propagation analysis is made for net radiation and for reference evapotranspiration. Data from the Raimat weather station, which is located in the Catalonia region of Spain, are used to illustrate the error relationships. The results show that temperature, relative humidity and cloud cover errors have little effect on the net radiation or reference evapotranspiration. A 5°C error in estimating surface temperature leads to errors as big as 30 W m −2 at high temperature. A 4% solar radiation (R s ) error can cause a net radiation error as big as 26 W m −2 when R s ≈ 1000 W m −2 . However, the error is less when cloud cover is calculated as a function of the solar radiation. The absolute error in reference evapotranspiration (ET o ) equals the product of the net radiation error and the radiation term weighting factor [W = Δ(Δ1+γ)] in the ET o equation. Therefore, the ET o error varies between 65 and 85% of the R n error as air temperature increases from about 20° to 40°C. (author)
Schroeder, P; Calles, C; Benesova, T; Macaluso, F; Krutmann, J
2010-01-01
Solar radiation is well known to damage human skin, for example by causing premature skin ageing (i.e. photoageing). We have recently learned that this damage does not result from ultraviolet (UV) radiation alone, but also from longer wavelengths, in particular near-infrared radiation (IRA radiation, 760-1,440 nm). IRA radiation accounts for more than one third of the solar energy that reaches human skin. While infrared radiation of longer wavelengths (IRB and IRC) does not penetrate deeply into the skin, more than 65% of the shorter wavelength (IRA) reaches the dermis. IRA radiation has been demonstrated to alter the collagen equilibrium of the dermal extracellular matrix in at least two ways: (a) by leading to an increased expression of the collagen-degrading enzyme matrix metalloproteinase 1, and (b) by decreasing the de novo synthesis of the collagen itself. IRA radiation exposure therefore induces similar biological effects to UV radiation, but the underlying mechanisms are substantially different, specifically, the cellular response to IRA irradiation involves the mitochondrial electron transport chain. Effective sun protection requires specific strategies to prevent IRA radiation-induced skin damage. 2010 S. Karger AG, Basel.
7 CFR 917.110 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 917.110 Section 917.110 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... CALIFORNIA Rules and Regulations General § 917.110 Communications. Unless otherwise prescribed in this...
Ionizing radiation: levels and effects. Volume I. Levels
International Nuclear Information System (INIS)
1972-01-01
This is the sixth substantive report of the United Nations Scientific Committee on the Effects of Atomic Radiation to the General Assembly. It reviews the levels of radiation received from all sources to which man is exposed and, among the effects of ionizing radiation, it considers the genetic effects, the effects on the immune response and the induction of malignancies in animals and man. These are not the only effects of ionizing radiation. The acute consequences of massive amounts of radiation that may be received accidentally or during nuclear warfare are not reviewed here (the short discussion of this subject in the 1962 report is still largely valid, at least as an introduction), nor are the effects on the nervous system and the induction of chromosome anomalies in somatic cells, which were both considered by the Committee in its 1969 report. Unlike previous reports of the Committee, the present report is submitted to the General Assembly without the technical annexes in which the evidence considered by the Committee is discussed in detail and in which the bases for the Committee's conclusions, which are stated in the report, are fully documented. However, the annexes are being made available at the same time as the report in a separate publication, issued in two volumes and the Committee wishes to draw the attention of the General Assembly to the fact that the separation of the report from the annexes is for convenience only and that major importance attaches to the scientific evidence given in the annexes.
Countermeasures for Space Radiation Induced Malignancies and Acute Biological Effects
Kennedy, Ann
, oral supplementation with antioxidants appears to be an effective approach for the radioprotection of hematopoietic cells against the cell killing effects of radiation, and for improving survival in irradiated animals. Preliminary data suggest similar antioxidant protective effects for animals exposed to potentially lethal doses of proton radiation. Studies were also performed to determine whether dietary antioxidants could affect the incidence rates of malignancies in CBA mice exposed to 300 cGy proton (1 GeV/n) radiation or 50 cGy iron ion (1 GeV/n) radiation [9]. Two antioxidant formulations were utilized in these studies; an AOX formulation containing the mixture of antioxidant agents developed from our previous studies and an antioxidant dietary formulation containing the soybean-derived protease inhibitor known as the Bowman-Birk inhibitor (BBI). BBI was evaluated in the form of BBI Concentrate (BBIC), which is the form of BBI utilized in human trials. BBIC has been utilized in human trials since 1992, as described [10]. The major finding in the long-term animal studies was that there was a reduced risk of malignant lymphoma in mice exposed to space radiations and maintained on diets containing the antioxidant formulations. In addition, the two different dietary countermeasures also reduced the yields of a variety of different rare tumor types, arising from both epithelial and connective tissue cells, observed in the animals exposed to space radiation. REFERENCES [1] Guan J. et al (2004) Radiation Research 162, 572-579. [2] Wan X.S. et al (2005) Radiation Research 163, 364-368. [3] Wan X.S. et al (2005) Radiation Research 163, 232-240. [4] Guan J. et al (2006) Radiation Research 165, 373-378. [5] Wan X.S. et al (2006) International Journal of Radiation Oncology, Biology, Physics 64, 1475-1481. [6] Kennedy A.R. et al (2006) Radiation Research 166, 327-332. [7] Kennedy A.R. et al (2007) Radiation & Environmental Biophysics 46(2), 201-3. [8]Wambi, C., Sanzari, J
Photoswitchable Faraday effect in EuS-Au nanosystems
Energy Technology Data Exchange (ETDEWEB)
Kawashima, Akira; Nakanishi, Takayuki; Kitagawa, Yuichi; Fushimi, Koji; Hasegawa, Yasuchika [Division of Applied Chemistry, Faculty of Engineering, Hokkaido University, North-13 West-8, Kita-ku, 060-8628, Sapporo (Japan)
2016-01-15
Effective photoswitchable europium sulfide nanocrystals with gold nanoparticles using dithiol (DDT: 1,10-decanedithiol) joint molecules, EuS-Au nanosystems, are demonstrated. The TEM image indicates the formation of EuS-Au nanosystems composed of cube-shaped EuS nanocrystals and spherical Au nanoparticles. Under visible-light irradiation, a drastic change of absorption band of EuS-Au nanosystems at around 600 nm was observed. The Faraday effects of EuS-Au nanosystems were estimated using magnetic circular dichroism (MCD) measurements. The effective change of the MCD spectra of EuS-Au nanosystems under visible-light irradiation was successfully observed at around 670 nm for the first time. The effective reversible changes in MCD spectra with the alternative irradiation cycles of visible light (>440 nm) and dark are also presented. The decrease rate of rotation angle at 670 nm of EuS-Au nanosystems is larger than that of absorbance. These results indicate that the effective change of MCD spectra of EuS-Au nanosystems would be dominated not only by a drastic change of absorption band related to enhanced LSPR of Au nanoparticles but also by specific interaction between EuS and Au in nanosystem under irradiation. Illustration of photoswitch and TEM image of EuS-Au nanosystems. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Ionizing radiation M.O.S. dosimeters: sensibility and stability
International Nuclear Information System (INIS)
Gessinn, F.
1993-12-01
This thesis is a contribution to the study of the ionizing radiation responsivity of P.O.M.S. dosimeters. Unlike the development of processing hardening techniques, our works goal were to increase, on the one hand, the M.O.S. dosimeters sensitivity in order to detect small radiation doses and on the other hand, the stability with time and temperature of the devices, to minimize the absorbed-dose estimation errors. With this aim in mind, an analysis of all processing parameters has been carried out: the M.O.S. dosimeter sensitivity is primarily controlled by the gate oxide thickness and the irradiation electric field. Thus, P.M.O.S. transistors with 1 and 2 μm thick silica layers have been fabricated for our experiments. The radiation response of our devices in the high-field mode satisfactorily fits a D ox 2 power law. The maximum sensitivity achieved (9,2 V/Gy for 2μm devices) is close to the ideal value obtained when considering only an unitary carrier-trapping level, and allows to measure about 10 -2 Gy radiation doses. Read-time stability has been evaluated under bias-temperature stress conditions: experiments underscore slow fading, corresponding to 10 -3 Gy/h. The temperature response has also been studied: the analytical model we have developed predicts M.O.S. transistors threshold voltage variations over the military specifications range [-50 deg. C, + 150 deg. C]. Finally, we have investigated the possibilities of irradiated dosimeters thermal annealing for reusing. It appears clearly that radiation-induced damage annealing is strongly gate bias dependent. Furthermore, dosimeters radiation sensitivity seems not to be affected by successive annealings. (author). 146 refs., 58 figs., 9 tabs
Biological effects of ionizing radiation
International Nuclear Information System (INIS)
Anon.
1991-01-01
Experiments with small animals, tissue cultures, and inanimate materials help with understanding the effects of ionizing radiation that occur at the molecular level and cause the gross effects observed in man. Topics covered in this chapter include the following: Radiolysis of Water; Radiolysis of Organic Compounds; Radiolysis in Cells; Radiation Exposure and Dose Units; Dose Response Curves; Radiation Effects in Animals; Factors Affecting Health Risks. 8 refs., 3 figs., 5 tabs
Effects of ionizing radiation on nitric oxide myoglobin
International Nuclear Information System (INIS)
Kamarei, A.R.; Karel, M.
1983-01-01
Bovine nitric oxide myoglobin (NOMb) was irradiated with 40-4000 krad of γ-radiation, and the effects on the haem studied using absorption spectroscopy and electron spin resonance (e.s.r.) spectroscopy. The results show the following behaviour: (a) The bright red colour of NOMb changes to brown upon irradiation. This is similar to changes observed in radiation sterilized, nitrite-containing meats. (b) NOMb becomes progressively denitrosylated, with met-myoglobin (metMb) as the immediate product. (c) Upon increasing doses of radiation (up to 800 krad) at O 0 C parallel to NOMb denitrosylation, metMb is gradually converted, by water radiolytic products, to other products, believed to be ferromyoglobin and ferrimyoglobin peroxide. A minor quantity of 'choleglobin-type' pigments may also be formed at the highest doses. (d) Freezing of NOMb has a substantial protective effect against radiation. (e) Native bovine NOMb behaves as a pentaco-ordinate (hfs of 3 peaks with equal intensity); the bond between iron and Nsub(epsilon) is thus dramatically stretched and weakened. (f) Using a thermal energy analyser, no NO could be detected over irradiated NOMb solution, indicating rapid reaction of NO liberated from NOMb by radiation, with radiolytic products of water. (author)
Plasma scattering measurement using a submillimeter wave gyrotron as a radiation source
International Nuclear Information System (INIS)
Ogawa, I.; Idehara, T.; Itakura, Y.; Myodo, M.; Hori, T.; Hatae, T.
2004-01-01
Plasma scattering measurement is an effective technique to observe low frequency density fluctuations excited in plasma. The spatial and wave number resolutions and the S/N ratio of measurement depend on the wavelength range, the size and the intensity of a probe beam. A well-collimated, submillimeter wave beam is suitable for improving the spatial and wave number resolutions. Application of high frequency gyrotron is effective in improving the S/N ratio of the measurement because of its capacity to deliver high power. Unlike the molecular vapor lasers, the gyrotrons generate diverging beam of radiation with TE mn mode structure. It is therefore necessary to convert the output radiation into a Gaussian beam. A quasi-optical antenna is a suitable element for the conversion system under consideration since it is applicable to several TE 0n and TE 1n modes. In order to apply the gyrotron to plasma scattering measurement, we have stabilized the output (P = 110 W, f = 354 GHz) of gyrotron up to the level (ΔP/P < 1 %, Δf< 10 kHz). The gyrotron output can be stabilized by decreasing the fluctuation of the cathode potential. (authors)
Radiation hazards and biological effects of ionising radiation on man
International Nuclear Information System (INIS)
Siti Najila Mohd Janib
2004-01-01
The contents of this chapter are follows - Mechanism of damage: direct action of radiation, indirect action of radiation. Classification of effects: somatic effect, induction of cancer, factors, affecting somatic effects, genetic effect, inherited abnormalities, induced effects, early effects, late effects, deterministic effect, stochastic effect. Effect of specific group: development abnormality, childhood Cancer, fertile women, risk and uncertainty, comparison of risk
Radiation resistance and molecular structure of poly(arylene ether sulphone)s
International Nuclear Information System (INIS)
Hill, D.J.T.; Lewis, D.A.; O'Donnell, J.H.; Pomery, P.J.; Hedrick, J.L.; McGrath, J.E.
1991-01-01
The radiation resistance of a series of aromatic polysulfones comprising alternating units of diphenyl sulfone and various aromatic diols has been investigated by measuring volatile products, soluble fractions and electron spin resonance (ESR) spectra. The yields of radicals at 77 K observed by ESR and of SO 2 at 423 K have indicated that biphenol gives enhanced resistance to γ radiation, and tetramethyl bisphenol-A decreased resistance, relative to bisphenol-A, bisphenol-S and hydroquinone. The protective effect of biphenol was confirmed by lower scission and crosslinking yields determined from the soluble fractions after high doses. (author)
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Evaluation. 6.110 Section 6.110 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.110 Evaluation. (a) Within one year of... persons, including handicapped persons and organizations representing handicapped persons, and evaluation...
Migration under the effect of an electric field of 110Ag and 124Sb in silver
International Nuclear Information System (INIS)
Nguyen Van, Doan; Brebec, G.
1968-04-01
The most recent theories relative to the influence of an electric field on the migration of point defects in metals are briefly recalled stressing their similarities and the different hypotheses on which they are based. In order to relate the various physical constants of the phenomenon, the flux of a solute is expressed in terms of diffusion coefficients and 'effective valences' defined in thermodynamics of irreversible processes. Experimental results on the electromigration of 124 Sb and 110 Ag in silver show that these atoms migrate towards the anode with effective valences of - 95 and - 16 respectively for 124 Sb and 110 Ag at temperatures in the region of 900 deg. C. Estimates were made on the resistivities that should be used in the different theories in order to compare their predictions with experimental results. (authors) [fr
Radiation effects on materials in high-radiation environments
International Nuclear Information System (INIS)
Weber, W.J.; Mansur, L.K.; Clinard, F.W. Jr.; Parkin, D.M.
1991-01-01
A workshop on Radiation Effects on Materials in High-Radiation Environments was held in Salt Lake City, Utah (USA) from August 13 to 15, 1990 under the auspices of the Division of Materials Sciences, Office of Basic Energy Sciences, US Department of Energy. The workshop focused on ceramics, alloys, and intermetallics and covered research needs and capabilities, recent experimental data, theory, and computer simulations. It was concluded that there is clearly a continuing scientific and technological need for fundamental knowledge on the underlying causes of radiation-induced property changes in materials. Furthermore, the success of many current and emerging nuclear-related technologies critically depend on renewed support for basic radiation-effects research, irradiation facilities, and training of scientists. The highlights of the workshop are reviewed and specific recommendations are made regarding research needs. (orig.)
Electron correlation effect on radiative decay processes of the core-excited states of Be-like ions
Energy Technology Data Exchange (ETDEWEB)
Sang, Cuicui, E-mail: sangcc@126.com [Department of Physics, Qinghai Normal University, Xining 810001 (China); Li, Kaikai [College of Forensic Science, People' s Public Security University of China, Beijing 100038 (China); Sun, Yan; Hu, Feng [School of Mathematic and Physical Science, Xuzhou Institute of Technology, Xuzhou 221400, Jiangsu (China)
2016-07-15
Highlights: • Radiative rates of the states 1s2s{sup 2}2p and 1s2p{sup 3} with Z = 8–54 are studied. • Electron correlation effect on the radiative transition rates is studied. • Forbidden transitions are explored. - Abstract: Energy levels and the radiative decay processes of the core-excited configurations 1s2s{sup 2}2p and 1s2p{sup 3} of Be-like ions with Z = 8–54 are studied. Electron correlation effect on the energy levels and the radiative transition rates are studied in detail. Except for E1 radiative transition rates, the E2, M1 and M2 forbidden transitions are also explored. Further relativistic corrections from the Breit interaction, quantum electrodynamics and the finite nuclear size are included in the calculations to make the results more precise. Good agreement is found between our results and other theoretical data.
International Nuclear Information System (INIS)
Yamamoto, Chika; Yoshikawa, Hiromasa; Fukumoto, Shunsuke; Higuchi, Takashi; Yoshida, Masanori; Yasumori, Koutarou; Horinouchi, Yasufumi; Uehara, Satoru
2011-01-01
Combination therapy with S-1, superselective intra-arterial infusion of carboplatin (CBDCA) and radiation therapy has been used to treat patients with oral cancer since 2005. In this study, the histopathological effects and toxicities following concurrent chemoradiotherapy were examined. The subjects consisted of 15 patients (10 men and 5 women) who were treated with S-1 (60-80 mg/day, 4 weeks), superselective intra-arterial infusion of CBDCA (300 mg/body) and radiation therapy (total dose 30-36 Gy) in our department from 2005 to 2009. Nine patients, showed T2 disease, 3 showed T3 disease, and another 3 showed T4 diseases. The primary cancer sites were the tongue (6 cases), buccal mucosa (4 cases), mandible gingival (3 cases), maxillary gingival (1 case), and the floor of the mouth (1 case). The histopathological effects were evaluated according to Oboshi-Shimosato classification. Grade IV was shown in 10 cases (66.7%), grade III in 1 case (6.7%), II bin 3 cases (20.0%), and II a in 1 case (6.7%). All patients completed the treatment. The pathological response of the resected tumor was grade IIb or higher in 14 cases (93.3%). While good histological effects were noted, there was one patient for whom viable tumor cells remained in the central part of the tumor. The present study indicates that further investigation is needed to determine the best dosing and dosing schedule. (author)
Non-targeted effects of ionising radiation - Implications for radiation protection
International Nuclear Information System (INIS)
Sisko Salomaa
2006-01-01
The universality of the target theory of radiation-induced effects is challenged by observations on non-targeted effects such as bystander effects, genomic instability and adaptive response. Essential features of non-targeted effects are that they do not require direct nuclear exposure by radiation and they are particularly significant at low doses. This new evidence suggests a need for a new paradigm in radiation biology. The new paradigm should cover both the classical (targeted) and the non-targeted effects. New aspects include the role of cellular communication and tissue-level responses. A better understanding of non-targeted effects may have important consequences for health risk assessment and, consequently, on radiation protection. Non-targeted effects may contribute to the estimation of cancer risk from occupational, medical and environmental exposures. In particular, they may have implications for the applicability of the Linear-No-Threshold (LNT) model in extrapolating radiation risk data into the low-dose region. This also means that the adequacy of the concept of dose to estimate risk is challenged by these findings. Moreover, these effects may provide new mechanistic explanations for the development of non-cancer diseases. Further research is required to determine if these effects, typically measured in cell cultures, are applicable in tissue level, whole animals, and ultimately in humans. (author)
Non-targeted effects of ionising radiation - Implications for radiation protection
Energy Technology Data Exchange (ETDEWEB)
Sisko Salomaa [STUK - Radiation and Nuclear Safety Authority, Helsinki (Finland)
2006-07-01
The universality of the target theory of radiation-induced effects is challenged by observations on non-targeted effects such as bystander effects, genomic instability and adaptive response. Essential features of non-targeted effects are that they do not require direct nuclear exposure by radiation and they are particularly significant at low doses. This new evidence suggests a need for a new paradigm in radiation biology. The new paradigm should cover both the classical (targeted) and the non-targeted effects. New aspects include the role of cellular communication and tissue-level responses. A better understanding of non-targeted effects may have important consequences for health risk assessment and, consequently, on radiation protection. Non-targeted effects may contribute to the estimation of cancer risk from occupational, medical and environmental exposures. In particular, they may have implications for the applicability of the Linear-No-Threshold (LNT) model in extrapolating radiation risk data into the low-dose region. This also means that the adequacy of the concept of dose to estimate risk is challenged by these findings. Moreover, these effects may provide new mechanistic explanations for the development of non-cancer diseases. Further research is required to determine if these effects, typically measured in cell cultures, are applicable in tissue level, whole animals, and ultimately in humans. (author)
Radiation effects for high-energy protons and X-ray in integrated circuits
Energy Technology Data Exchange (ETDEWEB)
Silveira, M.A.G.; Santos, R.B.B. [Centro Universitario da FEI, Sao Bernardo do Campo, SP (Brazil); Medina, N.H.; Added, N.; Tabacniks, M.H. [Universidade de Sao Paulo (IF/USP), SP (Brazil). Inst. de Fisica; Lima, J.A. de [Universidade Federal de Santa Catarina (UFSC), Florianopolis, SC (Brazil); Cirne, K.H. [Empresa Brasileira de Aeronautica S.A. (EMBRAER), Sao Jose dos Campos, SP (Brazil)
2012-07-01
Full text: Electronic circuits are strongly influenced by ionizing radiation. The necessity to develop integrated circuits (IC's) featuring radiation hardness is largely growing to meet the stringent environment in space electronics [1]. This work aims to development a test platform to qualify electronic devices under the influence of high radiation dose, for aerospace applications. To understand the physical phenomena responsible for changes in devices exposed to ionizing radiation several kinds of radiation should then be considered, among them heavy ions, alpha particles, protons, gamma and X-rays. Radiation effects on the ICs are usually divided into three categories: Total Ionizing Dose (TID), a cumulative dose that shifts the threshold voltage and increases transistor's off-state current; Single Events Effects (SEE), a transient effect which can deposit charge directly into the device and disturb the properties of electronic circuits and Displacement Damage (DD) which can change the arrangement of the atoms in the lattice [2]. In this study we are investigating the radiation effects in rectangular-gate and circular-gate MOSFETs, manufactured with standard CMOS fabrication process, using particle beams produced in electrostatic tandem accelerators and X-rays. Initial tests for TID effects were performed using the 1.7 MV 5SDH tandem Pelletron accelerator of the Instituto de Fisica da USP with a proton beam of 2.6 MeV. The devices were exposed to different doses, varying the beam current, and irradiation time with the accumulated dose reaching up to Grad. To study the effect of X-rays on the electronic devices, an XRD-7000 (Shimadzu) X-ray setup was used as a primary X-ray source. The devices were irradiated with a total dose from krad to Grad using different dose rates. The results indicate that changes of the I-V characteristic curve are strongly dependents on the geometry of the devices. [1] Duzellier, S., Aerospace Science and Technology 9, p. 93
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Pilots. 230.110 Section 230.110 Transportation... and Equalizing System § 230.110 Pilots. (a) General provisions. Pilots shall be securely attached... clearance. The minimum clearance of pilot above the rail shall be 3 inches and the maximum clearance shall...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk. 131.110 Section 131.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.110 Milk. (a...
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Mediation. 110.32 Section 110.32 Education Regulations..., Conciliation, and Enforcement Procedures § 110.32 Mediation. (a) ED promptly refers to the Federal Mediation and Conciliation Service or to the mediation agency designated by the Secretary of Health and Human...
2010-04-01
... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Roads. 1710.110 Section 1710.110... (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.110 Roads. (a) Access to the subdivision. (1) Is access to the subdivision provided by public or private roads? What...
Effects after prenatal radiation exposures
International Nuclear Information System (INIS)
Streffer, C.
2001-01-01
The mammalian organism is highly radiosensitive during all prenatal developmental periods. For most effects a dose relationship with a threshold is observed. These threshold doses are generally above the exposures from medical diagnostic procedures. The quality and extent of radiation effects are very much dependent on the developmental stage during which an exposure takes place and on the radiation dose. An exposure during the preimplantation period will cause lethality. Malformations are usually induced after exposures during the major organogenesis. Growth retardation is also possible during the late organogenesis and foetal periods. The lower limits of threshold doses for these effects are in the range of 100 mGy. A radiation exposure during the early foetal period can lead to severe mental retardation and impairment of intelligence. There are very serious effects with radiation doses above 0.3 Gy. Carcinogenesis can apparently occur after radiation exposures during the total prenatal development period. The radiation risk factor up to now has not been clear, but it seems that it is in the range of risk factors for cancer that are observed after exposures during childhood. For radiation doses that are used in radiological diagnostics the risk is zero or very low. A termination of pregnancy after doses below 100 mGy should not be considered. (author)
Ionising radiation - physical and biological effects
International Nuclear Information System (INIS)
Holter, Oe.; Ingebretsen, F.; Parr, H.
1979-01-01
The physics of ionising radiation is briefly presented. The effects of ionising radiation on biological cells, cell repair and radiosensitivity are briefly treated, where after the effects on man and mammals are discussed and related to radiation doses. Dose limits are briefly discussed. The genetic effects are discussed separately. Radioecology is also briefly treated and a table of radionuclides deriving from reactors, and their radiation is given. (JIW)
International Nuclear Information System (INIS)
Fry, R.J.M.
1986-01-01
The paper discusses the radiation environment in space that astronauts are likely to be exposed to. Emphasis is on proton and HZE particle effects. Recommendations for radiation protection guidelines are presented
Line radiation effects in laboratory and astrophysical plasmas
Czech Academy of Sciences Publication Activity Database
Kerr, F.M.; Gouveia, A.; Renner, Oldřich; Rose, S. J.; Scott, H.A.; Wark, J. S.
2006-01-01
Roč. 99, - (2006), s. 363-369 ISSN 0022-4073 R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z10100523 Keywords : radiation transport * plasmas * opacity effects Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.599, year: 2006
Radiation damage to DNA-protein complexes
Czech Academy of Sciences Publication Activity Database
Spotheim-Maurizot, M.; Davídková, Marie
2011-01-01
Roč. 261, zima (2011), s. 1-10 ISSN 1742-6588. [COST Chemistry CM0603-MELUSYN Joint Meeting Damages Induced in Biomolecules by Low and High Energy Radiations. Paříž, 09.03.2010-12.03.2010] R&D Projects: GA AV ČR IAA1048103; GA AV ČR KJB4048401; GA MŠk 1P05OC085; GA MŠk OC09012; GA AV ČR IAB1048901 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiolysis * molecular-dynamics simulation * hydroxyl radical attack * induced strand breakage Subject RIV: BO - Biophysics
Radiation effects on living systems
International Nuclear Information System (INIS)
Hawley, N.J.
1980-10-01
This bibliography includes papers and reports by Atomic Energy of Canada Limited scientists concerning radiation effects on living systems. It is divided into three sections: Radiobiology, Radiation Biochemistry and Radiation Chemistry. (auth)
Health effects of ionizing radiation
International Nuclear Information System (INIS)
Pathak, B.
1989-12-01
Ionizing radiation is energy that travels through space as electromagnetic waves or a stream of fast moving particles. In the workplace, the sources of ionizing radiation are radioactive substances, nuclear power plants, x-ray machines and nuclear devices used in medicine, research and industry. Commonly encountered types of radiation are alpha particles, beta particles and gamma rays. Alpha particles have very little penetrating power and pose a risk only when the radioactive substance is deposited inside the body. Beta particles are more penetrating than alpha particles and can penetrate the outer body tissues causing damage to the skin and the eyes. Gamma rays are highly penetrating and can cause radiation damage to the whole body. The probability of radiation-induced disease depends on the accumulated amount of radiation dose. The main health effects of ionizing radiation are cancers in exposed persons and genetic disorders in the children, grandchildren and subsequent generations of the exposed parents. The fetus is highly sensitive to radiation-induced abnormalities. At high doses, radiation can cause cataracts in the eyes. There is no firm evidence that ionizing radiation causes premature aging. Radiation-induced sterility is highly unlikely for occupational doses. The data on the combined effect of ionizing radiation and other cancer-causing physical and chemical agents are inconclusive
Oppezzo, Oscar J; Costa, Cristina S; Pizarro, Ramón A
2011-01-10
Salmonella enterica serovar Typhimurium is an important pathogen, and exhibits considerable resistance to the lethal effects of solar radiation. To evaluate the involvement of the RpoS transcription factor in the defense mechanisms of this organism, the sunlight response of a wild type strain (ATCC14028) was compared with that of an rpoS mutant, which exhibited increased sensitivity. Kinetics of cell death was complex in both strains, probably due to the presence of a variety of targets for the radiation. When ultraviolet radiation was excluded from the incident sunlight, lethal effects were abolished independently of the allelic state of rpoS. Reduction of oxygen concentration in the irradiation medium provided moderate protection to ATCC14028, but notably improved survival of the mutant. Similar assays were developed with another S. enterica strain (DA1468), which is a derivative of strain LT2 and produces low levels of RpoS. In this strain the loss of viability reveals the dependence on solar ultraviolet and oxygen concentration found for ATCC14028, but radiation resistance was slightly reduced. Increased sensitivity was observed in an rpoS mutant derived from DA1468, indicating that RpoS functions related to photoprotection are conserved in this strain. In addition, notable differences in the shape of the survival curves obtained for mutants derived from ATCC14028 and DA1468 were found, suggesting that genes beyond RpoS control are relevant in the sunlight response of these mutants. Copyright © 2010 Elsevier B.V. All rights reserved.
Aerosol effects in radiation transfer
International Nuclear Information System (INIS)
Binenko, V.I.; Harshvardhan, H.
1993-01-01
The radiative properties and effects of aerosols are assessed for the following aerosol sources: relatively clean background aerosol, dust storms and dust outbreaks, anthropogenic pollution, and polluted cloud layers. Studies show it is the submicron aerosol fraction that plays a dominant radiative role in the atmosphere. The radiative effect of the aerosol depends not only on its loading but also on the underlying surface albedo and on solar zenith angle. It is only with highly reflecting surfaces such as Arctic ice that aerosols have a warming effect. Radiometric, microphysical, mineral composition, and refractive index measurements are presented for dust and in particular for the Saharan aerosol layer (SAL). Short-wave radiative heating of the atmosphere is caused by the SAL and is due mainly to absorption. However, the SAL does not contribute significantly to the long-wave thermal radiation budget. Field program studies of the radiative effects of aerosols are described. Anthropogenic aerosols deplete the incoming solar radiation. A case field study for a regional Ukrainian center is discussed. The urban aerosol causes a cooling of metropolitan centers, compared with outlying areas, during the day, which is followed by a warming trend at night. In another study, an increase in turbidity by a factor of 3 due to increased industrialization for Mexico City is noted, together with a drop in atmospheric transmission by 10% over a 50-year period. Numerous studies are cited that demonstrate that anthropogenic aerosols affect both the microphysical and radiative properties of clouds, which in turn affect regional climate. Particles acting as cloud nuclei are considered to have the greatest indirect effect on cloud absorptivity of short-wave radiation. Satellite observations show that low-level stratus clouds contaminated by ship exhaust at sea lead to an increase in cloud albedo
Radiation effects on microelectronics in space
International Nuclear Information System (INIS)
Srour, J.R.; McGarrity, J.M.
1988-01-01
The basic mechanisms of space radiation effects on microelectronics are reviewed in this paper. Topics discussed include the effects of displacement damage and ionizing radiation on devices and circuits, single event phenomena, dose enhancement, radiation effects on optoelectronic devices and passive components, hardening approaches, and simulation of the space radiation environment. A summary is presented of damage mechanisms that can cause temporary or permanent failure of devices and circuits operating in space
Effects of Ionizing Radiation in Atopic Patients Exposed to Radiation
International Nuclear Information System (INIS)
Radwan, N.K.A.
2014-01-01
Atopic dermatitis is a chronic relapsing inflammatory skin disease that arises most commonly during early infancy, and is characterized by severe pruritus, age-dependant skin manifestations, and a fluctuating clinical course. Hereditary, environmental and immunological factors are involved in the aetiopathogenesis of AD. Also the differentiation of helper T- cells, local cytokine profile, IgE, infectious agents and superantigens are factors identified as being involved in the pathogenesis of AD. One hundred patients with AD were selected from the outpatient clinic of the National Center for Radiation Research and Technology in Cairo, Egypt. They were divided into 2 groups; group 1 included radiation workers in the Hall of gamma irradiation unit and group 2 included workers outside controlled area and not exposed to radiation with comparable age and sex. The severity of the disease was evaluated according to the grade of atopic dermatitis. Total and specific serum IgE was measured and Complete Blood Count was also carried out. Four Malassezia species were isolated from AD patients M. globosa, M. furfur, M. sympodialis and M. obtusa. The clinical isolates consisted of two bacterial strains, S. aureus and S. epidermidis. The significant increase of AD severity seems to be more closely related to the prevalence of S. aureus and Malassezia on the skin of radiation workers. This was proved by the presence of high IgE and eosinophils in radiation workers. So, the interactions of low gamma radiation and skin seems to further complicate the risk of assessments of atopic dermatitis
Catalytic hydrolysis of COS over CeO{sub 2} (110) surface: A density functional theory study
Energy Technology Data Exchange (ETDEWEB)
Song, Xin; Ning, Ping [Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming 650500 (China); Wang, Chi [Faculty of Chemical Engineering, Kunming University of Science and Technology, Kunming 650500 (China); Li, Kai, E-mail: likaikmust@163.com [Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming 650500 (China); Tang, Lihong; Sun, Xin [Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming 650500 (China)
2017-08-31
Graphical abstract: CeO{sub 2} decreases the maximum energy barrier by 76.15 kcal/mol. H{sub 2}O plays a role as a bridge in the process of joint adsorption. Catalytic effect of CeO{sub 2} in the hydrolysis of COS is mainly reflected on the C−O channel. - Highlights: • H{sub 2}O is easier adsorbed on the CeO{sub 2} (110) surface than COS. • When COS and H{sub 2}O jointly adsorb on the CeO{sub 2} (110) surface, the H{sub 2}O molecule plays a role as a bridge. • Ce−O−H bond can enhance the adsorption effect. • Catalytic effect of CeO{sub 2} in the hydrolysis of COS is mainly reflected on the C−O channel. - Abstract: Density functional theory (DFT) calculations were performed to investigate the reaction pathways for catalytic hydrolysis of COS over CeO{sub 2} (110) surface using Dmol{sup 3} model. The thermodynamic stability analysis for the suggested routes of COS hydrolysis to CO{sub 2} and H{sub 2}S was evaluated. The absolute values of adsorption energy of H{sub 2}O-CeO{sub 2} are higher than that of COS-CeO{sub 2}. Meanwhile, the adsorption energy and geometries show that H{sub 2}O is easier adsorbed on the surface of CeO{sub 2} (110) than COS. H{sub 2}O plays a role as a bridge in the process of joint adsorption. H{sub 2}O forms more Ce−O−H groups on the CeO{sub 2} (110) surface. CeO{sub 2} decreases the maximum energy barrier by 76.15 kcal/mol. The migration of H from H{sub 2}O to COS is the key for the hydrolysis reaction. C−O channel is easier to occur than C−S channel. Experimental result shows that adding of CeO{sub 2} can increase COS removal rate and prolong the 100% COS removal rate from 180 min to 210 min. The difference between Fe{sub 2}O{sub 3} and CeO{sub 2} for the hydrolysis of COS is characterized in the atomic charge transfer and the formation of H−O bond and H−S bond. The transfer effect of H in H{sub 2}O to S in COS over CeO{sub 2} decreases the energy barriers of hydrolysis reaction, and enhances the reaction
Ceiling art in a radiation therapy department: its effect on patient treatment experience
International Nuclear Information System (INIS)
Bonett, Jotham
2015-01-01
A new initiative has been implemented at the Sunshine Hospital Radiation Therapy Centre, to provide a calming and comforting environment for patients attending radiation therapy treatment. As part of this initiative, the department's computed tomography (CT) room and radiation therapy bunkers were designed to incorporate ceiling art that replicates a number of different visual scenes. The study was undertaken to determine if ceiling art in the radiation therapy treatment CT and treatment bunkers had an effect on a patient's experience during treatment at the department. Additionally, the study aimed to identify which of the visuals in the ceiling art were most preferred by patients. Patients were requested to complete a 12-question survey. The survey solicited a patient's opinion/perception on the unit's unique ceiling display with emphasis on aesthetic appeal, patient treatment experience and the patient's engagement due to the ceiling display. The responses were dichotomised to ‘positive’ or ‘negative’. Every sixth patient who completed the survey was invited to have a general face-to-face discussion to provide further information about their thoughts on the displays. The results demonstrate that the ceiling artwork solicited a positive reaction in 89.8% of patients surveyed. This score indicates that ceiling artwork contributed positively to patients’ experiences during radiation therapy treatment. The study suggests that ceiling artwork in the department has a positive effect on patient experience during their radiation therapy treatment at the department
Ceiling art in a radiation therapy department: its effect on patient treatment experience
Energy Technology Data Exchange (ETDEWEB)
Bonett, Jotham [Sunshine Hospital Radiation Therapy Centre, Melbourne, Vic. (Australia)
2015-09-15
A new initiative has been implemented at the Sunshine Hospital Radiation Therapy Centre, to provide a calming and comforting environment for patients attending radiation therapy treatment. As part of this initiative, the department's computed tomography (CT) room and radiation therapy bunkers were designed to incorporate ceiling art that replicates a number of different visual scenes. The study was undertaken to determine if ceiling art in the radiation therapy treatment CT and treatment bunkers had an effect on a patient's experience during treatment at the department. Additionally, the study aimed to identify which of the visuals in the ceiling art were most preferred by patients. Patients were requested to complete a 12-question survey. The survey solicited a patient's opinion/perception on the unit's unique ceiling display with emphasis on aesthetic appeal, patient treatment experience and the patient's engagement due to the ceiling display. The responses were dichotomised to ‘positive’ or ‘negative’. Every sixth patient who completed the survey was invited to have a general face-to-face discussion to provide further information about their thoughts on the displays. The results demonstrate that the ceiling artwork solicited a positive reaction in 89.8% of patients surveyed. This score indicates that ceiling artwork contributed positively to patients’ experiences during radiation therapy treatment. The study suggests that ceiling artwork in the department has a positive effect on patient experience during their radiation therapy treatment at the department.
Chaudhari, Aditi; Krumlinde, Daniel; Lundqvist, Annika; Akyürek, Levent M; Bandaru, Sashidhar; Skålén, Kristina; Ståhlman, Marcus; Borén, Jan; Wettergren, Yvonne; Ejeskär, Katarina; Rotter Sopasakis, Victoria
2015-10-01
The phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K) catalytic subunit p110α is the most frequently mutated kinase in human cancer, and the hot spot mutations E542K, E545K, and H1047R are the most common mutations in p110α. Very little is known about the metabolic consequences of the hot spot mutations of p110α in vivo. In this study, we used adenoviral gene transfer in mice to investigate the effects of the E545K and H1047R mutations on hepatic and whole-body glucose metabolism. We show that hepatic expression of these hot spot mutations results in rapid hepatic steatosis, paradoxically accompanied by increased glucose tolerance, and marked glycogen accumulation. In contrast, wild-type p110α expression does not lead to hepatic accumulation of lipids or glycogen despite similar degrees of upregulated glycolysis and expression of lipogenic genes. The reprogrammed metabolism of the E545K and H1047R p110α mutants was surprisingly not dependent on altered p110α lipid kinase activity. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Radiation effects in semiconductors
2011-01-01
There is a need to understand and combat potential radiation damage problems in semiconductor devices and circuits. Written by international experts, this book explains the effects of radiation on semiconductor devices, radiation detectors, and electronic devices and components. These contributors explore emerging applications, detector technologies, circuit design techniques, new materials, and innovative system approaches. The text focuses on how the technology is being used rather than the mathematical foundations behind it. It covers CMOS radiation-tolerant circuit implementations, CMOS pr
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Fraud. 235.110 Section 235.110 Public Welfare... PROGRAMS § 235.110 Fraud. State plan requirements: A State plan under title I, IV-A, X, XIV, or XVI of the Social Security Act must provide: (a) That the State agency will establish and maintain: (1) Methods and...
Diffusion effects in undulator radiation
Directory of Open Access Journals (Sweden)
Ilya Agapov
2014-11-01
Full Text Available Quantum diffusion effects in undulator radiation in semiclassical approximation are considered. Short-term effects on the electron beam motion are discussed and it is shown that approaches based on diffusion approximation with drift-diffusion coefficients derived from undulator or bending magnet radiation spectrum, and on Poisson statistics with radiation spectrum defined by the local beding field, all lead to similar results in terms of electron energy spread for cases of practical interest. An analytical estimate of the influence of quantum diffusion on the undulator radiation spectrum is derived.
Mathematical models for radiation effects on human health
International Nuclear Information System (INIS)
Negi, U.S.; Petwal, K.C.
2015-01-01
In this paper, we are proposing a theoretical approach of basic mathematical models for radiation effect on human health. The largest natural sources of radiation exposure to humans are radon gas. While radon gas has always been in the environment, awareness of its contribution to human radiation exposure has increased in recent years. Radon's primary pathway is through air space in soil and rock. Pressure differences between the soil and the inside of buildings may cause radon gas to move indoors. Radon decays to radon daughters, some of which emit alpha radiation. Alpha-emitting radon daughters are adsorbed on to dust particles which, when inhaled, are trapped in the lungs and may cause gene damage, mutations and finally cancer. Exposure to excess UV radiation increases risk of skin cancer but there is also a dark side. The incidence of all types of skin cancer is related to exposure to UV radiation. Non-melanoma skin cancer, eye melanoma, and lip cancer have also been related to natural UV light
International Nuclear Information System (INIS)
Fry, R.J.M.
1987-07-01
As more people spend more time in space, and the return to the moon and exploratory missions are considered, the risks require continuing examination. The effects of microgravity and radiation are two potential risks in space. These risks increase with increasing mission duration. This document considers the risk of radiation effects in space workers and explorers. 17 refs., 1 fig., 4 tabs
The radiation effects on lipid bilayers
International Nuclear Information System (INIS)
Ikigai, Hajime; Matsuura, Tomio; Narita, Noboru; Ozawa, Atsushi.
1980-01-01
The Radiation effects on lipid bilayers are studied by the electron spin resonance. Egg lecithin liposomes and human erythrocytes are labeled with spin probes (5 SAL, 12 SAL). Effects of membrane fluidity by X-Ray (or ultraviolet) irradiation are measured by change of the order parameter S. The results obtained are as follows: 1) A similar tendency is observed on the order parameter S between X-Ray irradiated egg lecithin liposomes and human erythrocytes. 2) The rapid changes of the membrane fluidity are observed below 1 krad. The fluctuation of membrane fluidity decreases above 1 krad, consequently the membrane has a tendency changing to a rigid state at low dose area. 3) It is suggested that the more effective radicals are hydroxyl radicals and superoxide radicals. 4) The effects of ultraviolet irradiation with hydrogen peroxide show that hydroxyl radicals lead to changes of membrane fluidity. (author)
Epidemiologic Study of One Million U.S. Radiation Workers and Veterans
Energy Technology Data Exchange (ETDEWEB)
Boice, John D. [National Council on Radiation Protection and Measurements, Bethesda, MD (United States)
2017-12-14
The single most important question in radiation epidemiology is determining the level of health risks associated with radiation exposures that occur gradually over time. The study of one million early U.S. radiation workers and veterans has been designed to provide information on risk following chronic exposures by focusing on occupational groups with differing radiation exposure patterns, including intakes of radionuclides. The cost-efficient study builds on the investments made and foundations laid by investigators and government agencies over the past 30-40 years, which have established early worker cohorts that can now provide answers to questions on the lifetime human health risks associated with low-level radiation exposures. Within the overall goal of the epidemiologic study of one million U.S. radiation workers and veterans, this project had a total of nine specific aims which included studies of six populations for multiple endpoints including cancer overall mortality, leukemia and non-cancer mortality. The six populations included: Mound, Ohio, workers exposed to polonium, tritium and plutonium; nuclear power plant workers within the Landauer dosimetry and Nuclear Regulatory Commission data files; industrial radiographers; Mallinckrodt uranium workers; uranium workers who linked with the US Renal Data System; and nuclear weapons test participants. Over 400,000 workers and atomic veterans are included in these populations, with vital status being determined and analyses of all causes of death undertaken. A critical, integral component of the studies has been comprehensive evaluations of dosimetry involving, in many cases, complex dose reconstructions, and assessments of uncertainties. The work has also involved development of state-of-the art statistical approaches and modeling. All nine aims were accomplished successfully, resulting in publication of two NCRP documents, 13 literature papers, numerous Boice Reports in Health Physics News and many
Biological effects of radiation and estimation of risk to radiation workers
International Nuclear Information System (INIS)
Murthy, M.S.S.
1987-01-01
The biological effects of radiation have three stages: physical, chemical and biological. A precise mathematical description of biological effects and of one-to-one correspondence between the initial energy absorption and final effect has not been possible, because several factors are involved in biological effects and their manifestation period varies from less than one second to several years. The mechanism of biological radiation effects is outlined. The two groups of these effects are (1) immediate and (2) delayed. The main aim of radiation protection programme is to eliminate the risk of non-stochastic effects to an acceptable level. The mean annual dose for 30,000 radiation workers in India is 2.7 m Sv. Estimated risk of fatal cancer from this dose is about 50 cases of cancer per year per million workers which is well below the ICRP standard for safe occupation stipulated at fatality rate less than or equal to 100 per year per milion workers. When compared with risk in other occupations, the risk to radiation workers is much less. (M.G.B.)
International Nuclear Information System (INIS)
Xu Jinyan; Li Wenhui; Liu Jianbo; Wang Shuguang
2008-01-01
Objective: To preliminarily explore the radioprotective effects of the aqueous extract of S. obval-lata DC. Edgew on mice from radiation injury. Methods: mice from radiation injury, as target of the research, are been intragastricly administrating and receive different doses of aqueous extract of S. obval-lata DC. Edgew in IR + medication groups, and corresponding amount of normal and saline for IR group. After 5 days, mice are been receive a total body irradiation at a does of 6Gy X -ray. Then repeated intragastric administrating was given for 5 days and observed. On the 18th day, measure the body weights, RBC, WBC, PLT, Hb of venous blood, the bone DNA contents (A value) and marrow nucleated cell population, the spleen weights. Results: In IR + medication groups the body weights, WBC, PLT, the bone marrow DNA contents (A value) and nucleated cell population of mice rise obviously comparing with IR group, there were significant statistical differences among them, P 0.05. Conclusions: The active components of the aqueous extract of S. obval-lata DC. Edgew express out the obvious radioprotective effects for hemopoietic system of mice and can stimulate proliferation of the spleen cell, improve immune function of mice. No obvious difference to the contents of RBC, Hb of peripheral blood in all irradiation groups is possibly related with the long metabolism cycle of RBC, Hb and the delay of hematopoietic tissue delivery RBC and Hb synthesis. (authors)
Dose response on the 110 °C thermoluminescence peak of un-heated, synthetic Merck quartz
Energy Technology Data Exchange (ETDEWEB)
Kaya Keleş, Şule, E-mail: sule.kaya@ankara.edu.tr; Meriç, Niyazi; Polymeris, George S.
2016-07-15
Studies on 110 °C TL peak have been carried out using natural quartz from different origins and synthetic quartz produced by different suppliers. The interest in quartz is due to its usage in dating and retrospective dosimetry as a main material; both synthetic and natural types of quartz yield the 110 °C TL peak in their glow curve. In most studies to understand the physical mechanism behind the TL system, synthetic quartz samples are used and there are many investigations about dose response, in both low and high radiation dose region. In these studies generally synthetic quartz samples produced by Sawyer Research Products are used and the studies showed that both heated and un-heated synthetic quartz samples have intense supra-linear responses. Supra-linearity was enhanced by applying a pre-irradiation while several models have been developed towards an explanation to these supra-linearity effects. In this study commercially available synthetic Merck quartz was used. Different combinations of optical filters were used to obtain dose response curves upto 266 Gy and the effect of pre-dose to these dose response curves was studied. Un-pre-dosed Merck quartz samples dose supra-linearity index is below 1 independently on the optical filters; so Merck quartz showed linear or sub-linear dose response.
Transition radiation spectra of electrons from 1 to 10 GeV/c in regular and irregular radiators
International Nuclear Information System (INIS)
Andronic, A.; Appelshaeuser, H.; Bailhache, R.; Baumann, C.; Braun-Munzinger, P.; Bucher, D.; Busch, O.; Catanescu, V.; Chernenko, S.; Christakoglou, P.; Fateev, O.; Freuen, S.; Garabatos, C.; Gottschlag, H.; Gunji, T.; Hamagaki, H.; Herrmann, N.; Hoppe, M.; Lindenstruth, V.; Lippmann, C.; Morino, Y.; Panebratsev, Yu.; Petridis, A.; Petrovici, M.; Rusanov, I.; Sandoval, A.; Saito, S.; Schicker, R.; Soltveit, H.K.; Stachel, J.; Stelzer, H.; Vassiliou, M.; Vulpescu, B.; Wessels, J.P.; Wilk, A.; Yurevich, V.; Zanevsky, Yu.
2006-01-01
We present measurements of the spectral distribution of transition radiation generated by electrons of momentum 1-10 GeV/c in different radiator types. We investigate periodic foil radiators and irregular foam and fiber materials. The transition radiation photons are detected by prototypes of the drift chambers to be used in the Transition Radiation Detector (TRD) of the ALICE experiment at CERN, which are filled with a Xe, CO 2 (15%) mixture. The measurements are compared to simulations in order to enhance the quantitative understanding of transition radiation production, in particular the momentum dependence of the transition radiation yield
Simulation of radiation effects on three-dimensional computer optical memories
International Nuclear Information System (INIS)
Moscovitch, M.; Emfietzoglou, D.
1997-01-01
A model was developed to simulate the effects of heavy charged-particle (HCP) radiation on the information stored in three-dimensional computer optical memories. The model is based on (i) the HCP track radial dose distribution, (ii) the spatial and temporal distribution of temperature in the track, (iii) the matrix-specific radiation-induced changes that will affect the response, and (iv) the kinetics of transition of photochromic molecules from the colored to the colorless isomeric form (bit flip). It is shown that information stored in a volume of several nanometers radius around the particle close-quote s track axis may be lost. The magnitude of the effect is dependent on the particle close-quote s track structure. copyright 1997 American Institute of Physics
Exposure to Mobile Phone Radiation Opens New Horizons in Alzheimer’s Disease Treatment
Mortazavi SAR; Shojaei-Fard MB; Haghani M; Shokrpour N; Mortazavi SMJ
2013-01-01
Alzheimer’s disease, the most common type of dementia and a progressive neurodegenerative disease, occurs when the nerve cells in the brain die. Although there are medications that can help delay the development of Alzheimer’s disease, there is currently no cure for this disease. Exposure to ionizing and non-ionizing radiation may cause adverse health effects such as cancer. Looking at the other side of the coin, there are reports indicating stimulatory or beneficial effects after exposure t...
International Nuclear Information System (INIS)
Christofidou-Solomidou, Melpo; Cengel, Keith A; Tyagi, Sonia; Tan, Kay-See; Hagan, Sarah; Pietrofesa, Ralph; Dukes, Floyd; Arguiri, Evguenia; Heitjan, Daniel F; Solomides, Charalambos C
2011-01-01
Flaxseed (FS) is a dietary supplement known for its antioxidant and anti-inflammatory properties. Radiation exposure of lung tissues occurs either when given therapeutically to treat intrathoracic malignancies or incidentally, such as in the case of exposure from inhaled radioisotopes released after the detonation of a radiological dispersion devise (RDD). Such exposure is associated with pulmonary inflammation, oxidative tissue damage and irreversible lung fibrosis. We previously reported that dietary FS prevents pneumonopathy in a rodent model of thoracic X-ray radiation therapy (XRT). However, flaxseed's therapeutic usefulness in mitigating radiation effects post-exposure has never been evaluated. We evaluated the effects of a 10%FS or isocaloric control diet given to mice (C57/BL6) in 2 separate experiments (n = 15-25 mice/group) on 0, 2, 4, 6 weeks post a single dose 13.5 Gy thoracic XRT and compared it to an established radiation-protective diet given preventively, starting at 3 weeks prior to XRT. Lungs were evaluated four months post-XRT for blood oxygenation levels, inflammation and fibrosis. Irradiated mice fed a 0%FS diet had a 4-month survival rate of 40% as compared to 70-88% survival in irradiated FS-fed mouse groups. Additionally, all irradiated FS-fed mice had decreased fibrosis compared to those fed 0%FS. Lung OH-Proline content ranged from 96.5 ± 7.1 to 110.2 ± 7.7 μg/ml (Mean ± SEM) in all irradiated FS-fed mouse groups, as compared to 138 ± 10.8 μg/ml for mice on 0%FS. Concomitantly, bronchoalveolar lavage (BAL) protein and weight loss associated with radiation cachexia was significantly decreased in all FS-fed groups. Inflammatory cell influx to lungs also decreased significantly except when FS diet was delayed by 4 and 6 weeks post XRT. All FS-fed mice (irradiated or not), maintained a higher blood oxygenation level as compared to mice on 0%FS. Similarly, multiplex cytokine analysis in the BAL fluid revealed a significant decrease
Radiation effects on living systems
International Nuclear Information System (INIS)
Hawley, N.J.
1984-04-01
This bibliography includes papers and reports by Atomic Energy of Canada Limited scientists concerning radiation effects on living systems. It is divided into three sections: Radiobiology, Radiation Biochemistry and Radiation Chemistry. It is intended that the bibliography will be updated regularly
Effects of radiation upon gastrointestinal motility
Institute of Scientific and Technical Information of China (English)
Mary F Otterson
2007-01-01
Whether due to therapeutic or belligerent exposure, the gastrointestinal effects of irradiation produce symptoms dreaded by a majority of the population. Nausea, vomiting, diarrhea and abdominal cramping are hallmarks of the prodromal phase of radiation sickness, occurring hours to days following radiation exposure. The prodromal phase is distinct from acute radiation sickness in that the absorptive, secretory and anatomic changes associated with radiation damage are not easily identifiable. It is during this phase of radiation sickness that gastrointestinal motility significantly changes. In addition, there is evidence that motor activity of the gut contributes to some of the acute and chronic effects of radiation.
Non controlled effect of ionizing radiations : involvement for radiation protection
International Nuclear Information System (INIS)
Little, J. B.
2005-01-01
It is widely accepted that damage to DNA is the critical event on irradiated cells, and that double strand breaks are the primary DNA lesions responsible for the biological effects of ionizing radiation. This has lead to the long standing paradigm that these effects, be they cytotoxicity, mutagenesis or malignant transformation, occur in irradiated cells as a consequences of the DNA damage they incur. Evidence has been accumulating over the past decade, however, to indicate that radiation may induce effects that ar not targeted to the irradiated cells itself. Two non-targeted effects will be described in this review. The first, radiation-induced genomic instability, is a phenomenon whereby signals are transmitted to the progeny of the irradiated cell over many generations, leading to the occurrence of genetic effects such as mutations and chromosomal aberrations arising in the distant descendants of the irradiated cell. Second, the bystander effect, is a phenomenon whereby irradiated cells transmit damage signals to non-irradiated cells in a mixed population, leading to genetic effects arising in these bystander cells that received no radiation exposure. the model system described in this review involves dense monolayer cultures exposed to very low fluences of alpha particles. The potential implications of these two phenomena for the analysis of the risk to the human population of exposure to low levels of ionising radiation is discussed. (Author) 111 refs
Visible laser and UV-A radiation impact on a PNP degrading Moraxella strain and its rpoS mutant.
Nandakumar, Kanavillil; Keeler, Werden; Schraft, Heidi; Leung, Kam T
2006-07-05
The role of stationary phase sigma factor gene (rpoS) in the stress response of Moraxella strain when exposed to radiation was determined by comparing the stress responses of the wild-type (WT) and its rpoS knockout (KO) mutant. The rpoS was turned on by starving the WT cultures for 24 h in minimal salt medium. Under non-starved condition, both WT and KO planktonic Moraxella cells showed an increase in mortality with the increase in duration of irradiation. In the planktonic non-starved Moraxella, for the power intensity tested, UV radiation caused a substantially higher mortality rate than did by the visible laser light (the mortality rate observed for 15-min laser radiation was 53.4 +/- 10.5 and 48.7 +/- 8.9 for WT and KO, respectively, and 97.6 +/- 0 and 98.5 +/- 0 for 25 s of UV irradiation in WT and KO, respectively). However, the mortality rate decreased significantly in the starved WT when exposed to these two radiations. In comparison, rpoS protected the WT against the visible laser light more effectively than it did for the UV radiation. The WT and KO strains of Moraxella formed distinctly different types of biofilms on stainless steel coupons. The KO strain formed a denser biofilm than did the WT. Visible laser light removed biofilms from the surfaces more effectively than did the UV. This was true when comparing the mortality of bacteria in the biofilms as well. The inability of UV radiation to penetrate biofilms due to greater rates of surface absorption is considered to be the major reason for the weaker removal of biofilms in comparison to that of the visible laser light. This result suggests that high power visible laser light might be an effective tool for the removal of biofilms. (c) 2006 Wiley Periodicals, Inc.
Biological Effects of Radiation
International Nuclear Information System (INIS)
Jatau, B.D.; Garba, N.N.; Yusuf, A.M.; Yamusa, Y. A.; Musa, Y.
2013-01-01
In earlier studies, researchers aimed a single particle at the nucleus of the cell where DNA is located. Eighty percent of the cells shot through the nucleus survived. This contradicts the belief that if radiation slams through the nucleus, the cell will die. But the bad news is that the surviving cells contained mutations. Cells have a great capacity to repair DNA, but they cannot do it perfectly. The damage left behind in these studies from a single particle of alpha radiation doubled the damage that is already there. This proved, beyond a shadow of doubt, those there biological effects occur as a result of exposure to radiation, Radiation is harmful to living tissue because of its ionizing power in matter. This ionization can damage living cells directly, by breaking the chemical bonds of important biological molecules (particularly DNA), or indirectly, by creating chemical radicals from water molecules in the cells, which can then attack the biological molecules chemically. At some extent these molecules are repaired by natural biological processes, however, the effectiveness of this repair depends on the extent of the damage. The interaction of ionizing with the human body, arising either from external sources outside the body or from internal contamination of the body by radioactive materials, leads to the biological effects which may later show up as a clinical symptoms. Basically, this formed the baseline of this research to serve as a yardstick for creating awareness about radiation and its resulting effects.
Radiation effects and radiation risks. 2. ed.
International Nuclear Information System (INIS)
Lengfelder, E.; Forst, D.; Feist, H.; Pratzel, H.G.
1990-01-01
The book presents the facts and the principles of assessment and evaluation of biological radiation effects in general and also with particular reference to the reactor accident of Chernobyl, reviewing the consequences and the environmental situation on the basis of current national and international literature, including research work by the authors. The material compiled in this book is intended especially for physicians, but will also prove useful for persons working in the public health services, in administration, or other services taking care of people. The authors tried to find an easily comprehensible way of presenting and explaining the very complex processes and mechanisms of biological radiation effects and carcinogenesis, displaying the physical primary processes and the mechanisms of the molecular radiation effects up to the effects of low-level radiation, and present results of comparative epidemiologic studies. This section has been given considerable space, in proportion to its significance. It also contains literature references for further reading, offering more insight and knowledge of aspects of special subject fields. The authors also present less known results and data and discuss them against the background of well-known research results and approaches. Apart from the purpose of presenting comprehensive information, the authors intend to give an impact for further thinking about the problems, and helpful tools for independent decisions and action on the basis of improved insight and assessment, and in this context particularly point to the problems induced by the Chernobyl reactor accident. (orig.) With 10 maps in appendix [de
A study on behaviour of 110mAg in marine environment
International Nuclear Information System (INIS)
Xie Yunmian; Tang Wenqiao; Meng Jianyi
2000-01-01
The author describes a study on the behaviour of 110m Ag in marine environment. It includes the chemical species of 110m Ag in seawater, the absorption factor K d in/on sea sediment and biological concentration factor B f of marine biome for 110m Ag. The experiment and theoretical calculation indicate that 110 Ag exists as 110m AgCl 2 - : 110m Ag + ≅10 5 in seawater and AgCl precipitation is formed when [Ag + ][Cl - ]≥1.56 x 10 -10 . K d in/on sediment decreases with increasing of temperature and/or liquid/solid ratio. The effect of water nature on K d is very considerable. And the K d on sediment is in the order of 10 2 mL/g under the seawater atmosphere, which is two orders lower than under the freshwater atom sphere, 110m Ag is concentrated by marine biome strongly. B f is in the range of 10 2 -10 4 depending on different kind of marine biome
Effects of radiation on erythropoiesis
Energy Technology Data Exchange (ETDEWEB)
Harriss, E B
1971-04-01
Since the pioneer work of Heineke (1903; 1905) many workers have studied the effect of radiation on haemopoiesis. Their work has been reviewed by Bloom (1948), by Jacobson (1954) and more recently by Bond et al. (1965). The subject continues to stimulate much interest but is now more concerned with the effects of radiation on the multipotential stem cell pool than on radiation damage to the erythropoietic cells themselves. Death from haemopoietic failure following an LD{sub 50/30} dose of radiation is probably not attributable to failure of erythropoiesis; while damage to the erythropoietic system certainly plays a part in the syndrome, it is not a major factor contributing to the death of the animal. Although the severity and time course of the response vary with the species studied, the general effects of radiation on erythropoiesis are similar in all mammalian bone marrow studied to date. Likewise, though the severity of the reaction varies somewhat with the energy of the radiation and has been used to compare the relative biological effectiveness of different types of radiation (Sinclair et al., 1962; Sztanyik, 1967), the response is different only in degree and not in its fundamental pattern. The initial syndrome of depression and recovery will therefore be described largely by reference to work performed on the response of the rat to single acute exposures of either whole-body or partial-body irradiation with conventional X-rays.
Sizes of X-ray radiation coherent domains in thin SmS films and their visualization
Sharenkova, N. V.; Kaminskii, V. V.; Petrov, S. N.
2011-09-01
The size of X-ray radiation coherent domains (250 ± 20 Å) is determined in a thin polycrystalline SmS film using X-ray diffraction patterns (θ-2θ scanning, DRON-2 diffractometer, Cu K α radiation) and the Selyakov-Scherrer formula with allowance for the effect of microstrains. An image of this film is taken with a transmission electron microscope, and regions with a characteristic size of 240 Å are clearly visible in it. It is concluded that X-ray radiation coherent domains are visualized.
Photoelectron emission as a tool to assess dose of electron radiation received by ZrO2:PbS films
International Nuclear Information System (INIS)
Krumpane, Diana; Dekhtyar, Yury; Surkova, Indra; Romanova, Marina
2013-01-01
PbS nano dots embedded in ZrO 2 thin film matrix (ZrO 2 :PbS films) were studied for application in nanodosimetry of electron radiation used in radiation therapy. ZrO 2 :PbS films were irradiated with 9 MeV electron radiation with doses 3, 7 and 10 Gy using medical linear accelerator. Detection of the dosimetric signal was made by measuring and comparing photoelectron emission current from ZrO 2 :PbS films before and after irradiation. It was found that electron radiation decreased intensity of photoemission current from the films. Derivatives of the photoemission spectra were calculated and maximums at photon energies 5.65 and 5.75 eV were observed. Amplitude of these maximums decreased after irradiation with electrons. Good linear correlation was found between the relative decrease of the intensity of these maximums and dose of electron radiation. Observed changes in photoemission spectra from ZrO 2 :PbS films under influence of electron radiation suggested that the films may be considered to be effective material for electron radiation dosimetry. Photoelectron emission is a tool that allows to read the signal from such dosimeter. (authors)
Radiation stability of methionine-35S and selenomethionine-75Se
International Nuclear Information System (INIS)
Galateanu, I.; Lungu, V.V.; Viorel, D.
1976-01-01
The radiation stability of methionine- 35 S and selenomethionine 75 Se was investigated using the methods of thin-layer chromatography, gas chromatography and ESR. Radiation decomposition of methionine- 35 S mainly consists in an oxidation process and in the release of volatile products. The ESR-spectra of irradiated DL-methionine indicated a strong localization of the unpaired electrons on sulfur atoms. Radiation damage to selenomethionine- 75 Se as a function of radiation dose proved an increased stability of this compound and its radiation decomposition consists in the formation of oxidized products and by direct rupture of the selenium bounds accompanied by the formation of volatile compounds like CH 3 SEH and SeH 2 . The self-radiolysis of the aqueous solution of selenomethionine- 75 Se during its storage in air leads, however, to a lower decomposition rate which consists in the release of inorganic selenium and in an oxidation process. (author)
International Nuclear Information System (INIS)
Rausch, L.
1982-01-01
The book describes the effects of ionizing radiation on man in a simple, popular, detailed and generally valid manner and gives a comprehensive picture of the concepts, elements, principles of function, and perspectives of medical radiobiology. Radiobiology in general is explained, and its application in research on the causes of radiolesions and radiation diseases as well as a radiotherapy and radiation protection is discussed in popular form. (orig./MG) [de
International Nuclear Information System (INIS)
Campbell, C.T.
1984-01-01
The selective oxidation of ethylene to ethylene epoxide (C 2 H 4 +1/2O 2 →C 2 H 4 O) over Ag is the simplest example of kinetically controlled, selective heterogeneous catalysis. We have studied the steady-state kinetics and selectivity of this reaction for the first time on a clean, well-characterized Ag(110) surface by using a special apparatus which allows rapid (approx.20 s) transfer between a high-pressure catalytic microreactor and an ultrahigh vacuum surface analysis (AES, XPS, LEED, TDS) chamber. The effects of temperature and reactant pressures upon the rate and selectivity are virtually identical on Ag(110) and supported, high surface area Ag catalysts. The absolute specific rate (per Ag surface atom) is, however, some 100-fold higher for Ag(110) than for high surface area catalysts. This is related to the well-known structural sensitivity of this reaction. It is postulated that a small percentage of (110) planes (or [110]-like sites) are responsible for most of the catalytic activity of high surface area catalysts. The high activity of the (110) plane is attributed to its high sticking probability for dissociative oxygen adsorption, since the rate of ethylene epoxidation is shown in a related work [Ref. 1: C. T. Campbell and M. T. Paffett, Surf. Sci. (in press)] to be proportional to the coverage of atomically adsorbed oxygen at constant temperature and ethylene pressure
Radiation Effects in the Space Telecommunications Environment
Energy Technology Data Exchange (ETDEWEB)
Fleetwood, Daniel M.; Winokur, Peter S.
1999-05-17
Trapped protons and electrons in the Earth's radiation belts and cosmic rays present significant challenges for electronics that must operate reliably in the natural space environment. Single event effects (SEE) can lead to sudden device or system failure, and total dose effects can reduce the lifetime of a telecommmiications system with significant space assets. One of the greatest sources of uncertainty in developing radiation requirements for a space system is accounting for the small but finite probability that the system will be exposed to a massive solar particle event. Once specifications are decided, standard laboratory tests are available to predict the total dose response of MOS and bipolar components in space, but SEE testing of components can be more challenging. Prospects are discussed for device modeling and for the use of standard commercial electronics in space.
Radiation research contracts: Biological effects of small radiation doses
Energy Technology Data Exchange (ETDEWEB)
Hug, O [International Atomic Energy Agency, Division of Health, Safety and Waste Disposal, Vienna (Austria)
1959-04-15
To establish the maximum permissible radiation doses for occupational and other kinds of radiation exposure, it is necessary to know those biological effects which can be produced by very small radiation doses. This particular field of radiation biology has not yet been sufficiently explored. This holds true for possible delayed damage after occupational radiation exposure over a period of many years as well as for acute reactions of the organism to single low level exposures. We know that irradiation of less than 25 Roentgen units (r) is unlikely to produce symptoms of radiation sickness. We have, however, found indications that even smaller doses may produce certain instantaneous reactions which must not be neglected
32 CFR 865.110 - Decision process.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Decision process. 865.110 Section 865.110...-GENERAL PERSONNEL REVIEW BOARDS Air Force Discharge Review Board § 865.110 Decision process. (a) The DRB... decision making process. ...
5 CFR 950.110 - Prohibited discrimination.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Prohibited discrimination. 950.110 Section 950.110 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.110 Prohibited discrimination. Discrimination for...
Bench-scale crossflow filtration of Hanford tank C-106, C-107, B-110, and U-110 sludge slurries
International Nuclear Information System (INIS)
Geeting, J.G.H.; Reynolds, B.A.
1997-09-01
Pacific Northwest National Laboratory has a bench-scale crossflow filter installed in a shielded hot cell for testing radioactive feeds. During FY97 experiments were conducted on slurries from radioactive Hanford waste from tanks C-106, C-107, B-110, and U-110. Each tank was tested at three slurry concentrations (8, 1.5, and 0.05 wt% solids). A two-parameter central composite design which tested transmembrane pressure from 5 to 40 psig and axial velocity from 3 to 9 ft/s was used for all feeds. Crossflow filtration was found to remove solids effectively, as judged by filtrate clarity and radiochemical analysis. If the filtrates from these tests were immobilized in a glass matrix, the resulting transuranic and ( 90 Sr) activity would not breach low activity waste glass limits of 100nCi/g (TRU) and 20 μCi/ml ( 90 Sr). Two exceptions were the transuranic activity in filtrates from processing 1.5 and 8 wt% C-106 tank waste. Subsequent analyses indicated that the source of the TRU activity in the filtrate was most likely due to soluble activity, but obviously proved ineffective at removing the soluble plutonium species. Re-testing of the C-106 supported this hypothesis. These data suggest the need to control carbonate and pH when processing tank wastes for immobilization
Energy Technology Data Exchange (ETDEWEB)
Ramuz, O.; Mornex, F. [Centre Hospitalier Universitaire Lyon-Sud, 69 - Pierre-Benite (France); Bourhis, J. [Institut Gustave Roussy, 94 - Villejuif (France)
1997-12-01
The physiopathology of radiation-induced bone damage is no completely elucidated. Ionizing radiation may induce an inhibition or an impairment of growing bone. This fact is of particular importance in children, and represents one of the most important dose-limiting factors in the radiotherapeutic management of children with malignant diseases. Scoliosis, epiphyseal slippage, avascular necrosis, abnormalities of craniofacial growth may be observed after radiation. Child`s age at the time of treatment, location of irradiated bone and irradiation characteristics may influence the radiation related observed effects. In adults, pathological analysis of mature bone after ionizing radiation exposure are rare, suggesting that it is difficult to draw a clear feature of the action of radiation on the bone. Osteoporosis, medullary fibrosis and cytotoxicity on bone cells lead to fracture or necrosis. Various factors can influence bone tolerance to radiation such as bone involvement by tumor cells or infection, which is frequent is mandibulary osteoradionecrosis. Technical improvements in radiation techniques have also decreased radio-induced bone complications : the volume, fractionation and total dose are essential to consider. The absence of a consistent radiation-induced late effects evaluation scale has hampered efforts to analyze the influence of various therapeutic maneuvers and the comparison of results from different reported series. The currently proposed evaluation scale may help harmonizing the classification of radiation-induced bone late effects. (author)
Gomes, Janaina F; Busson, Bertrand; Tadjeddine, Abderrahmane
2006-03-23
Ethanol in an acidic solution-Pt(110) interface was studied by SFG spectroscopy (between 1820 and 2325 cm(-1)) to explore primarily the effects of the alcohol concentration. Stretching bands of H-Pt (ca. 1970 or 2050 cm(-1)) and CO (ca. 1980 and 2040 cm(-1)) species, produced by the ethanol oxidation, were detected during the adsorption and oxidation of 0-1 mol L(-1) ethanol in a 0.1 mol L(-1) HClO(4) solution on the electrode surface. Hydrogen and CO coadsorb stably on Pt(110) between 0.05 and 0.15 V in ethanol-containing solutions. In this potential range, the blue shift of the hydrogen resonance (ca. 80 cm(-1)) reveals a weakening of the hydrogen bonding between adsorbed hydrogen and water molecules in the double layer. After the hydrogen desorption (0.15 V), the formation of compact CO islands, depending on the ethanol concentration, lifts the Pt(110) surface reconstruction. In ethanol-free solution, the surface remains reconstructed. The lower-frequency CO band is assigned to the CO species adsorbed on (1 x 2) reconstructed Pt(110) domains, having smaller local coverages, while the higher-frequency CO band is attributed to the close-packed CO species adsorbed on (1 x 1) patches. The reaction pathway forming CO(2) is less favored with increasing ethanol concentration.
Genetic and somatic effects of ionizing radiation
International Nuclear Information System (INIS)
1986-01-01
This is the ninth substantive report of the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR) to the General Assembly. This report contains reviews on three special topics in the field of biological effects of ionizing radiation that are among those presently under consideration by the Committee: genetic effects of radiation, dose-response relationships for radiation-induced cancer and biological effects of pre-natal irradiation
Bystander effects of radiation
International Nuclear Information System (INIS)
Umar, Neethu Fathima; Daniel, Nittu
2013-01-01
The Radiation-Induced Bystander Effect is the phenomenon in which unirradiated cells show irradiated effects due to the signals received from nearby irradiated cells. Evidence suggests that targeted cytoplasmic irradiation results in mutation in the nucleus of the hit cells. Cells that are not directly hit by an alpha particle, but are in the vicinity of one that is hit, also contribute to the genotoxic response of the cell population. When cells are irradiated, and the medium is transferred to unirradiated cells, these unirradiated cells show bystander responses when assayed for clonogenic survival and oncogenic transformation. The demonstration of a bystander effect in human tissues and, more recently, in whole organisms have clear implication of the potential relevance of the non-targeted response to human health. This effect may also contribute to the final biological consequences of exposure to low doses of radiation. The radiation-induced bystander effect represents a paradigm shift in our understanding of the radiobiological effects of ionizing radiation, in that extranuclear and extracellular events may also contribute to the final biological consequences of exposure to low doses of radiation. Multiple pathways are involved in the bystander phenomenon, and different cell types respond differently to bystander signalling. Using cDNA microarrays, a number of cellular signalling genes, including cyclooxygenase-2 (CQX-2), have been shown to be casually linked to the bystander phenomenon. The observation that inhibition of the phosphorylation of extracellular signal-related kinase (ERK) suppressed the bystander response further confirmed the important role of the mitogen-activated protein kinase (MAPK) signalling cascade in the bystander process. The cells deficient in mitochondrial DNA showed a significantly reduced response to bystander signalling, suggesting a functional role of mitochondria in the signalling process. (author)
Energy Technology Data Exchange (ETDEWEB)
Methfessel, Torsten
2010-12-09
This thesis provides an introduction into the technique of spin-polarized scanning tunnelling microscopy and spectroscopy as an experimental method for the investigation of magnetic nanostructures. Experimental results for the spin polarized electronic structure depending on the crystal structure of ultrathin Co layers, and depending on the direction of the magnetization for ultrathin Fe layers are presented. High-resolution measurements show the position-dependent spin polarization on a single copper-phthalocyanine molecule deposited on a ferromagnetic surface. Co was deposited by molecular beam epitaxy on the (110) surface of the bodycentered cubic metals Cr and Fe. In contrast to previous reports in the literature only two layers of Co can be stabilized in the body-centered cubic (bcc) structure. The bcc-Co films on the Fe(110) surface show no signs of epitaxial distortions. Thicker layers reconstruct into a closed-packed structure (hcp / fcc). The bcc structure increases the spin-polarization of Co to P=62 % in comparison to hcp-Co (P=45 %). The temperature-dependent spin-reorientation of ultrathin Fe/Mo(110) films was investigated by spin-polarized spectroscopy. A reorientation of the magnetic easy axis from the [110] direction along the surface normal to the in-plane [001] axis is observed at T (13.2{+-}0.5) K. This process can be identified as a discontinuous reorientation transition, revealing two simultaneous minima of the free energy in a certain temperature range. The electronic structure of mono- and double-layer Fe/Mo(110) shows a variation with the reorientation of the magnetic easy axis and with the direction of the magnetization. The investigation of the spin-polarized charge transport through a copper-phthalocyanine molecule on the Fe/Mo(110) surface provides an essential contribution to the understanding of spin-transport at the interface between metal and organic molecule. Due to the interaction with the surface of the metal the HOMO-LUMO energy
Radiation Effects in III-V Nanowire Devices
2016-09-01
fabrication of an in-plane nanowire (NW) GaAs metal-oxide-semiconductor field- effect transistor (MOSFET) by focused -ion beam (FIB) etching and chemical...8725 John J. Kingman Road, MS 6201 Fort Belvoir, VA 22060-6201 T E C H N IC A L R E P O R T DTRA-TR-16-94 Radiation Effects in III-V...5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING / MONITORING AGENCY
45 CFR 1706.110 - Self-evaluation.
2010-10-01
... Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the effects thereof...
Biological effects of low-dose ionizing radiation exposure
International Nuclear Information System (INIS)
Reinoehl-Kompa, Sabine; Baldauf, Daniela; Heller, Horst
2009-01-01
The report on the meeting of the Strahlenschutzkommission 2007 concerning biological effects of low-dose ionizing radiation exposure includes the following contributions: Adaptive response. The importance of DNA damage mechanisms for the biological efficiency of low-energy photons. Radiation effects in mammography: the relative biological radiation effects of low-energy photons. Radiation-induced cataracts. Carcinomas following prenatal radiation exposure. Intercellular apoptosis induction and low-dose irradiation: possible consequences for the oncogenesis control. Mechanistic models for the carcinogenesis with radiation-induced cell inactivation: application to all solid tumors in the Japanese atomic bomb survivors. Microarrays at low radiation doses. Mouse models for the analysis of biological effects of low-dose ionizing radiation. The bystander effect: observations, mechanisms and implications. Lung carcinoma risk of Majak workers - modeling of carcinogenesis and the bystander effect. Microbeam studies in radiation biology - an overview. Carcinogenesis models with radiation-induced genomic instability. Application to two epidemiological cohorts.
Nuclear power and low level radiation hazards
International Nuclear Information System (INIS)
Myers, D.K.; Newcombe, H.B.
1979-03-01
Even in the future, nuclear power is expected to contribute less than 1/10th of the present total population exposure to man-made radiation. By the best estimates available, the current health risks of nuclear power generation appear to be much less than those associated with the major alternative sources of energy, with the exception of natural gas which is about equally safe. Uncertainties concerning the radiation risks from nuclear power, from medical x-rays and from the effects of reduced ventillation to conserve heat appear to be less than those associated with estimates of risks from the use of coal and various other sources of energy. This is in part because of the large amount of effort devoted to studies of radiation effects. The benefits in terms of current life expectancy associated with any of the conventional or unconventional methods of power production appear to greatly outweigh the associated current health hazards. (author)
Morgan, William F.
2003-01-01
A long-standing dogma in the radiation sciences is that energy from radiation must be deposited in the cell nucleus to elicit a biological effect. A number of non-targeted, delayed effects of ionizing radiation have been described that challenge this dogma and pose new challenges to evaluating potential hazards associated with radiation exposure. These effects include induced genomic instability and non-targeted bystander effects. The in vitro evidence for non-targeted effects in radiation biology will be reviewed, but the question as to how one extrapolates from these in vitro observations to the risk of radiation-induced adverse health effects such as cancer remains open.
Novel and simple synthesis of brominated 1,10-phenanthrolines
Czech Academy of Sciences Publication Activity Database
Výprachtický, Drahomír; Kaňková, Dana; Pokorná, Veronika; Kmínek, Ivan; Dzhabarov, Vagif; Cimrová, Věra
2014-01-01
Roč. 67, č. 6 (2014), s. 915-921 ISSN 0004-9425 R&D Projects: GA ČR GAP106/12/0827; GA ČR(CZ) GA13-26542S Institutional support: RVO:61389013 Keywords : 1,10-phenanthroline * electrophilic aromatic substitution * bromination Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.558, year: 2014
Atmospheric ions and probable indirect biological effect of low-level radiation
International Nuclear Information System (INIS)
Spurny, Z.
1984-01-01
The problem is discussed of the health consequences of low radiation doses (of less than 0.01 Gy). Owing to natural radioactivity and cosmic radiation, ions are formed in the atmosphere which may thus indirectly mediate the effects of ionizing radiation on the organism. The rate of ion formation is approximately 6.1 ion pairs/cm 3 .s and their number will not exceed 10 3 ions/cm 3 . In an environment where artificial radioactive sources are used, the ion concentration may reach up to 10 5 ions/cm 3 . The effect of ions on man may be divided into several types: 1. effect on mental state (behaviour, fatigue, headaches); 2. effect on the cardiovascular system; 3. effect on the bronchial system;and 4. effect on physiological processes, e.g., secretion by endocrine glands. It is not yet known whether the biological effect of small (fast) ions is a function of their electric charge only or of their kinetic energy as well. The view is discussed that low radiation doses through indirect effects have favourable and beneficial influence on the human organism. (M.D.)
Biological effects of low doses of ionizing radiation
International Nuclear Information System (INIS)
Gonzalez, A.J.
1994-01-01
Few weeks ago, when the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR) submitted to the U.N. General Assembly the UNSCEAR 1994 report, the international community had at its disposal a broad view of the biological effects of low doses of ionizing radiation. The 1994 report (272 pages) specifically addressed the epidemiological studies of radiation carcinogenesis and the adaptive responses to radiation in cells and organisms. The report was aimed to supplement the UNSCEAR 1993 report to the U.N. General Assembly- an extensive document of 928 pages-which addressed the global levels of radiation exposing the world population, as well as some issues on the effects of ionizing radiation, including: mechanisms of radiation oncogenesis due to radiation exposure, influence of the level of dose and dose rate on stochastic effects of radiation, hereditary effects of radiation effects on the developing human brain, and the late deterministic effects in children. Those two UNSCEAR reports taken together provide an impressive overview of current knowledge on the biological effects of ionizing radiation. This article summarizes the essential issues of both reports, although it cannot cover all available information. (Author)
Effects of ionizing radiation on vitamins
International Nuclear Information System (INIS)
Thayer, D.W.; Fox, J.B. Jr.; Lakritz, L.
1991-01-01
Vitamins are known to be sensitive to the effects of ionizing radiation. Since most foods contain a large proportion of water, the most probable reaction of the ionizing radiation would be with water; and as vitamins are present in very small amounts compared with other substances in the food they will be affected indirectly by the radiation. This chapter discusses the effect of ionizing radiation on water soluble vitamins and fat soluble vitamins. (author)
U.S. Department of Energy Workers' mental models of radiation and chemical hazards in the workplace
International Nuclear Information System (INIS)
Quadrel, M.J.; Blanchard, K.A.; Lundgren, R.E.; McMakin, A.H.; Mosley, M.T.; Strom, D.J.
1994-05-01
A pilot study was performed to test the mental models methodology regarding knowledge and perceptions of U.S. Department of Energy contractor radiation workers about ionizing radiation and hazardous chemicals. The mental models methodology establishes a target population's beliefs about risks and compares them with current scientific knowledge. The ultimate intent is to develop risk communication guidelines that address information gaps or misperceptions that could affect decisions and behavior. In this study, 15 radiation workers from the Hanford Site in Washington State were interviewed about radiation exposure processes and effects. Their beliefs were mapped onto a science model of the same topics to see where differences occurred. In general, workers' mental models covered many of the high-level parts of the science model but did not have the same level of detail. The following concepts appeared to be well understood by most interviewees: types, form, and properties of workplace radiation; administrative and physical controls to reduce radiation exposure risk; and the relationship of dose and effects. However, several concepts were rarely mentioned by most interviewees, indicating potential gaps in worker understanding. Most workers did not discuss the wide range of measures for neutralizing or decontaminating individuals following internal contamination. Few noted specific ways of measuring dose or factors that affect dose. Few mentioned the range of possible effects, including genetic effects, birth defects, or high dose effects. Variables that influence potential effects were rarely discussed. Workers rarely mentioned how basic radiation principles influenced the source, type, or mitigation of radiation risk in the workplace
Ionizing radiation: levels and effects. Volume II. Effects
International Nuclear Information System (INIS)
1972-01-01
The genetic effects of ionizing radiation were last reviewed comprehensively by the Committee in its 1966 report (575), whereas the particular problem of the induction of chromosome aberrations by irradiation of human somatic cells was reviewed in the Committee's 1969 report (576). The present review will consider the further experimental data that have been obtained since these reports. Of the recent advances in human genetics, those concerning the occurrence and transmission of translocations have particular relevance to the problem of estimating risks, and will be discussed in the last section of this review.
Radiative transitions from Υ(5S) to molecular bottomonium
International Nuclear Information System (INIS)
Voloshin, M. B.
2011-01-01
The heavy quark spin symmetry implies that in addition to the recently observed Z(10610) and Z(10650) molecular resonances with I G =1 + , there should exist two or four molecular bottomonium-like states with I G =1 - . Properties of these G-odd states are considered, including their production in the radiative transitions from Υ(5S), by applying the same symmetry to the Υ(5S) resonance and the transition amplitudes. The considered radiative processes can provide a realistic option for observing the yet hypothetical states.
International Nuclear Information System (INIS)
1990-01-01
The conference was organized to evaluate the application directions of radiation technology in Vietnam and to utilize the Irradiation Centre in Hanoi with the Co-60 source of 110 kCi. The investigation and study of technico-economic feasibility for technology development to various items of food and non-food objects was reported. (N.H.A)
[Biological effects of non-ionizing electromagnetic radiation].
Fedorowski, A; Steciwko, A
1998-01-01
Since the mid 1970's, when Adey discovered that extremely-low-frequency electromagnetic field (ELF EMF) may affect the calcium ions efflux from various cells, bioeffects of non-ionizing radiation (NIR) have become the subject of growing interest and numerous research projects. At present, the fact that NIR exerts both stimulatory and inhibitory effects on different physiological cellular parameters is rather unquestionable. At the same time, some epidemiological studies suggest that exposure to EMF is potentially harmful even if its intensity is very low. It has been proved that thermal factors are not responsible for these effects, therefore nowadays, they are called 'non-thermal effects'. Our paper deals with three different aspects of biological effects of non-ionizing radiation, bioelectromagnetism, electromagnetobiology and electromagnetic bioinformation. Firstly, we describe how EMF and photons can be produced within a living cell, how biological cycles are controlled, and what are the features of endogenous electromagnetic radiation. Secondly, we discuss various facets of external EMF interactions with living matter, focusing on extremely-low-frequencies, radio- and microwaves. Possible mechanisms of these interactions are also mentioned. Finally, we present a short overview of current theories which explain how electromagnetic couplings may control an open and dissipative structure, namely the living organism. The theory of electromagnetic bioinformation seems to explain how different physiological processes are triggered and controlled, as well as how long-range interactions may possibly occur within the complex biological system. The review points out that the presented research data must be assessed very carefully since its evaluation is crucial to set the proper limits of EMF exposure, both occupational and environmental. The study of biological effects of non-ioinizing radiation may also contribute to the development of new diagnostic and therapeutic
International Nuclear Information System (INIS)
Rudie, N.J.
1976-01-01
The three-volume book is intended to serve as a review of the effects of thermonuclear explosion induced radiation (x-rays, gamma rays, and beta particles) and the resulting electromagnetic pulse (EMP). Volume 2 deals with the following topics: radiation effects on quartz crystals, tantalum capacitors, bipolar semiconductor devices and integrated circuits, field effect transistors, and miscellaneous electronic devices; hardening electronic systems to photon and neutron radiation; nuclear radiation source and/or effects simulation techniques; and radiation dosimetry
International Nuclear Information System (INIS)
Gonzales, M.A.; Tapic, R.T.; Aurigue, F.B.
2008-01-01
A radiosensitivity study coupled with tissue culture technique was conducted as preliminary to mutation breeding of the three species of ground orchids (Spathoglottis plicata, S.kimballiana var. angustifolia, and S.tomentosa). It aimed to compare the effect of dose levels of gamma radiation applied to the germinated embryos (protocorms) of the three species. Also, it sought to determine the lethal dose and optimum dose of gamma radiation on the three species. The protocorms of the three species were irradiated at 10 Gy, 20 Gy, 30 Gy, 40 Gy, and 50 Gy dose level of gamma radiation. The three species have varied radiosensitivity as affected by their individual phenotype. Results showed that as the dose level and ministered increases, percent mortality of seedlings also increases whereas, the seedlings height, number of roots and root length decreased. However, there was an increase in the number of leaves at 10 and 20 Gy dose levels due to the emergence of furcations, but further increase in the dose levels of radiation decreased the number of leaves. Furthermore, some qualitative characters such as albinism, pigmentation, forked leaves, furcations, and multiple branching came out as responses to gamma irradiation
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv
Energy Technology Data Exchange (ETDEWEB)
Kole, A. K.; Kumbhakar, P. [Nanoscience Laboratory, Department of Physics, National Institute of Technology, Durgapur 713209, West Bengal (India); Tiwary, C. S. [Department of Materials Engineering, Indian Institute of Science (IISc.), Bangalore 560012 (India)
2013-03-21
Mn{sup 2+} doped (0-50.0 molar %) ZnS d-dots have been synthesized in water medium by using an environment friendly low cost chemical technique. Tunable dual emission in UV and yellow-orange regions is achieved by tailoring the Mn{sup 2+} doping concentration in the host ZnS nanocrystal. The optimum doping concentration for achieving efficient photoluminescence (PL) emission is determined to be {approx}1.10 (at. %) corresponding to 40.0 (molar %) of Mn{sup 2+} doping concentration used during synthesis. The mechanism of charge transfer from the host to the dopant leading to the intensity modulated tunable (594-610 nm) yellow-orange PL emission is straightforwardly understood as no capping agent is used. The temperature dependent PL emission measurements are carried out, viz., in 1.10 at. % Mn{sup 2+} doped sample and the experimental results are explained by using a theoretical PL emission model. It is found that the ratio of non-radiative to radiative recombination rates is temperature dependent and this phenomenon has not been reported, so far, in Mn{sup 2+} doped ZnS system. The colour tuning of the emitted light from the samples are evident from the calculated chromaticity coordinates. UV light irradiation for 150 min in 40.0 (molar %) Mn{sup 2+} doped sample shows an enhancement of 33% in PL emission intensity.
46 CFR 403.110 - Accounting entities.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting entities. 403.110 Section 403.110 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.110 Accounting entities. Each Association shall be a separate accounting...
41 CFR 115-1.110 - Deviations.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...
1 CFR 500.110 - Self-evaluation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 500.110 Section 500.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL COMMISSION FOR EMPLOYMENT POLICY § 500.110 Self-evaluation... or organizations representing handicapped persons, to participate in the self-evaluation process by...
1 CFR 457.110 - Self-evaluation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 457.110 Section 457.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.110 Self-evaluation. (a... organizations representing handicapped persons, to participate in the self-evaluation process by submitting...
49 CFR 28.110 - Self-evaluation.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Self-evaluation. 28.110 Section 28.110 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.110 Self-evaluation...
Combined effects of hyperthermia and radiation in cultured mammalian cells
International Nuclear Information System (INIS)
Ben-Hur, E.; Elkind, M.M.; Riklis, E.
1977-01-01
Hyperthermia (temperatures of 39 0 C or higher) enhances the killing of mammalian cells by ionizing radiation (fission-spectrum neutrons and x-rays). The nature and the magnitude of the enhanced radiation killing varies with temperature and for a fixed temperature during irradiation, the enhanced lethality varies inversely with dose rate. For temperatures up to 41 0 C, dose fractionation measurements indicate that hyperthermia inhibits the repair of sublethal damage. At higher temperatures, the expression of potentially lethal damage is enhanced. Since the effect of heat is greatest in cells irradiated during DNA synthesis, the radiation age-response pattern is flattened by hyperthermia. In addition to the enhanced cell killing described above, three other features of the effect of hyperthermia are important in connection with the radiation treatment of cancer. The first is that heat selectively sensitizes S-phase cells to radiation. The second is that it takes radiation survivors 10 to 20 hrs after a modest heat treatment to recover their ability to repair sublethal damage. And the third is that hyperthermia reduces the magnitude of the oxygen enhancement ratio. Thus, heat if applied selectively, could significantly increase the margin of damage between tumors and normal tissues
French population's exposure to ionizing radiations
International Nuclear Information System (INIS)
2016-01-01
This report deals with the exposure of the French population to ionizing radiation. The exposures taken into account are related to cosmic and telluric radiations, to radon, to ingestion of natural radionuclides, to medical imaging and to industrial and military sources. Additionally to the mean effective dose, considered as the macroscopic indicator of the population exposure, the variations of the effective dose for each source of exposure are also presented. Then, the variation of the total effective dose is presented. (authors)
Energy Technology Data Exchange (ETDEWEB)
Don, Higson; Ches, Mason; Andrew, McEwan; Peter, Burns; Riaz, Akber; Ron, Cameron; Pamela, Sykes; Joe, Young [Australasian Radiation Protection Society (Australia)
2006-07-01
At its Annual General Meeting in 2004, the Australasian Radiation Protection Society (A.R.P.S.) set up a working group to draft a statement of the Society's position on risks from low levels of exposure to ionizing radiation. The resulting position statement was adopted by the Society at its Annual General Meeting in 2005. Its salient features are as follows: First, there is insufficient evidence to establish a dose-effect relationship for doses that are less than a few tens of milli sieverts in a year. A linear extrapolation from higher dose levels should be assumed only for the purpose of applying regulatory controls. Secondly, estimates of collective dose arising from individual doses that are less than some tens of milli sieverts in a year should not be used to predict numbers of fatal cancers. Thirdly, the risk to an individual of doses significantly less than 100 micro sieverts in a year is so small, if it exists at all, that regulatory requirements to control exposure at this level are not warranted. (authors)
34 CFR 300.110 - Program options.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Program options. 300.110 Section 300.110 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Other Fape Requirements § 300.110 Program options. The State must ensure that...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviation. 105-1.110 Section 105-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.110 Deviation. (a...
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Deviation. 101-1.110 Section 101-1.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.110 Deviation...
42 CFR 136.110 - Facilities construction.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Facilities construction. 136.110 Section 136.110..., DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH Grants for Development, Construction, and Operation of Facilities and Services § 136.110 Facilities construction. In addition to other requirements of this subpart...
International Nuclear Information System (INIS)
Sen, M.
2006-01-01
Better understanding of chemistry of radiation-induced degradation is becoming of increasing importance on account of the utilization of polymeric materials in a variety of radiation environments as well as beneficial uses of degraded polymers. It is very well known that polysaccharides in dry form or in solution degrade when exposed to ionizing radiation. In this study degrading effect of radiation has been considered from the point of view of controlling the molecular weights of kappa- and iota-carrageenans and sodium alginate irradiated under varying environmental conditions. The humidity equilibrated polymer samples kept over saturated aqueous salt solutions of NaCl, NaNO 3 and MgCl 2 were irradiated in a Gammacell 220 at room temperature. The degradation was investigated in detail by a careful Gel Permeation Chromatographic analysis of their respective molecular weights before and after irradiation Alexander-Charlesby-Ross equation was used in determining their radiation-chemical yields. Degradation yield is the highest for dry irradiated kappa- (G(S) = 0.73) and iota-carrageenans (G(S) = 2.43) and with small amount of water taken up from surrounding humidity degradation becomes less pronounced and G(S) values show a decrease down to G(S) = 0.16 and 0.87 at 75 % relative humidity, respectively. At very high water contents degradation effect again becomes more effective. Sodium alginate has fount to be less sensitive to the effect of humidity. When there is small amount of water in the polysaccharide structure, it is unlikely to expect an indirect effect of radiation. The water located in between the polymer chains however can give enough mobility to kappa and iota karrageenans chains, plastifying effect, which may enhance the radical-radical combinations thus lowering the rate of degradation hence reducing G(S) values
Alsuhaim, Hamad S.; Vojisavljevic, Vuk; Pirogova, E.
2013-12-01
Recently, microwave radiation, a type/subset of non-ionizing electromagnetic radiation (EMR) has been widely used in industry, medicine, as well as food technology and mobile communication. Use of mobile phones is rapidly growing. Four years from now, 5.1 billion people will be mobile phone users around the globe - almost 1 billion more mobile users than the 4.3 billion people worldwide using them now. Consequently, exposure to weak radiofrequency/microwave radiation generated by these devices is markedly increasing. Accordingly, public concern about potential hazards on human health is mounting [1]. Thermal effects of radiofrequency/microwave radiation are very well-known and extensively studied. Of particular interest are non-thermal effects of microwave exposures on biological systems. Nonthermal effects are described as changes in cellular metabolism caused by both resonance absorption and induced EMR and are often accompanied by a specific biological response. Non-thermal biological effects are measurable changes in biological systems that may or may not be associated with adverse health effects. In this study we studied non-thermal effects of low power microwave exposures on kinetics of L-lactate dehydrogenase enzyme and growth rate of yeast Saccharomyces Cerevisiae strains type II. The selected model systems were continuously exposed to microwave radiation at the frequency of 968MHz and power of 10dBm using the designed and constructed (custom made) Transverse Electro-Magnetic (TEM) cell [2]. The findings reveal that microwave radiation at 968MHz and power of 10dBm inhibits L-lactate dehydrogenase enzyme activity by 26% and increases significantly (15%) the proliferation rate of yeast cells.
Effect of 60 Co gamma radiation on crystalline proteins
International Nuclear Information System (INIS)
Bernardes, D.M.L.
1991-01-01
In order to study the effects of 6 0 Co gamma radiation on crystalline proteins an in vitro system was set up. For that, aqueous solutions from bovine crystalline were used irradiated with 0, 5.000, 10.000, 15.000, 20.000 and 25.000 Gy. The treatment led to protein alterations determined by different methods. By turbidimetry the formation of aggregates that increased with the radiation dose was revealed. The same observation was done from viscosity data and from the UV spectrum of the samples. From amino acid analysis and fluorimetry determinations, tryptophan appeared as the most sensitive amino acid. An increase in the free-S H-groups was also observed. After the standardization of the method, the radio modifier capability of glutathione, amino ethyl thiourea, mercapto ethyl alanine and dimethyl sulfoxide was tested. The results showed that in the presence of those substances the radiation effect was diminished. (author)
Multiparametric assessment of radiation effects for the individual radiation sensitivity estimation
International Nuclear Information System (INIS)
2006-01-01
The effects of low dose irradiation are highly relevant for radiation protection in the public. The sensitivity to clastogenic and tumorigenic effects of ionizing radiation (IR) varies considerably amongst individuals. Examples for genetically determined enhanced sensitivity are well known in some hereditary diseases: patients with chromosomal instability syndromes, Ataxia telangiectasia (A-T), Nijmegen Breakage Syndrome (NBS) and Bloom Syndrome (BS) show strongly enhanced sensitivity towards IR, severe immunodeficiencies, and a high incidence for developing leukemias and lymphomas. This obvious coincidence of enhanced radiosensitivity and tumor risk, and the frequently observed enhanced radiosensitivity of genetically non-defined tumor patients indicate that tumor patients may constitute a subpopulation with enriched genetical predisposition for enhanced radiosensitivity. Furthermore, a subpopulation of radiosensitive individuals may be part of the probably inconspicuous total population. For example, individuals heterozygous for the above mentioned genes (and possibly some other genes) show enhanced radiosensitivity if compared with the normal population. In general, heterozygous carriers of those hereditary deficiencies are clinically inconspicuous, but due an haploinsufficiency their tumour risk may be enhanced. This has been shown for mice carrying an heterozygous Nbs1 mutation (J.-Q. Wang, Lyon, pers. Communication). Our findings concerning enhanced radiation-induced chromosomal aberrations in heterozygous Nbs1 cell lines support this notion. The identification of high risk groups with enhanced radiosensitivity is therefore an important task for radioprotection. This project aimed at establishing a procedure which allows to test various cellular parameters as indicators for effects of radiation. A standard protocol for the isolation and cryoconservation of primary blood cells was developed. DNA repair analysis (Comet Assay) and radiation-induced apoptosis
Effects of annealing on evaporated SnS thin films
International Nuclear Information System (INIS)
Samsudi Sakrani; Bakar Ismail
1994-01-01
The effects of annealing of evaporated tin sulphide thin films (SnS) are described. The films were initially deposited onto glass substrate, followed by annealing in an encapsulated carbon block under the running argon gas at 310 degree Celsius. Short time annealing of the films results in a slight change of the compositions to a mix SnS/SnS sub 2 compound, and the tendency of increasing SnS sub 2 formation was observed on the films annealed for longer periods up to 20 hours. X-ray results showed the transformation of SnS peaks (040) and (080) to predominantly SnS sub 2 peaks - (001), (100), (101), and (110). The associated absorption coefficients measured on the films were found to be greater than 10 sup 5 cm sup -1, with indication of higher photon energy leading to the formation of SnS sub 2 compound
Effects of annealing on evaporated SnS thin films
Energy Technology Data Exchange (ETDEWEB)
Sakrani, Samsudi; Ismail, Bakar [Universiti Teknologi Malaysia, Skudai, Johor Bahru (Malaysia). Dept. of Physics
1994-12-31
The effects of annealing of evaporated tin sulphide thin films (SnS) are described. The films were initially deposited onto glass substrate, followed by annealing in an encapsulated carbon block under the running argon gas at 310 degree Celsius. Short time annealing of the films results in a slight change of the compositions to a mix SnS/SnS sub 2 compound, and the tendency of increasing SnS sub 2 formation was observed on the films annealed for longer periods up to 20 hours. X-ray results showed the transformation of SnS peaks (040) and (080) to predominantly SnS sub 2 peaks - (001), (100), (101), and (110). The associated absorption coefficients measured on the films were found to be greater than 10 sup 5 cm sup -1, with indication of higher photon energy leading to the formation of SnS sub 2 compound.
Atomic and molecular adsorption on Fe(110)
Xu, Lang; Kirvassilis, Demetrios; Bai, Yunhai; Mavrikakis, Manos
2018-01-01
Iron is the principal catalyst for the ammonia synthesis process and the Fischer-Tropsch process, as well as many other heterogeneously catalyzed reactions. It is thus of fundamental importance to understand the interactions between the iron surface and various reaction intermediates. Here, we present a systematic study of atomic and molecular adsorption behavior over Fe(110) using periodic, self-consistent density functional theory (DFT-GGA) calculations. The preferred binding sites, binding energies, and the corresponding surface deformation energies of five atomic species (H, C, N, O, and S), six molecular species (NH3, CH4, N2, CO, HCN, and NO), and eleven molecular fragments (CH, CH2, CH3, NH, NH2, OH, CN, COH, HCO, NOH, and HNO) were determined on the Fe(110) surface at a coverage of 0.25 monolayer. The binding strengths calculated using the PW91 functional decreased in the following order: C > CH >N > O > S > NH > COH > CN > CH2 > NOH > OH > HNO > HCO > NH2 > H > NO > HCN > CH3 > CO > N2 > NH3. No stable binding structures were observed for CH4. The estimated diffusion barriers and pathways, as well as the adsorbate-surface and intramolecular vibrational modes of all the adsorbates at their preferred binding sites, were identified. Using the calculated adsorption energetics, we constructed the potential energy surfaces for a few surface reactions including the decomposition of methane, ammonia, dinitrogen, carbon monoxide, and nitric oxide. These potential energy surfaces provide valuable insight into the ability of Fe(110) to catalyze common elementary steps.
Energy Technology Data Exchange (ETDEWEB)
Hwang, SooJin; Jeong, Hae Min; Nam, Seon Young [Low-dose Radiation Research Team, Radiation Health Institute, Korea Hydro & Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)
2017-04-15
Alzheimer's disease (AD) is the most common neurodegenerative disease that is characterized by amyloid plaques, progressive neuronal loss, and gradual deterioration of memory. Amyloid imaging using positron emission tomography (PET) radiotracers have been developed and approved for clinical use in the evaluation of suspected neurodegenerative disease, including AD. Particularly, previous studies involving low-dose ionizing radiation on Aβ 42-treated mouse hippocampal neurons have suggested a potential role for low-dose ionizing radiation in the treatment of AD. However, associated in vivo studies involving the therapy effects of low-dose ionizing radiation on AD are still insufficient. As a powerful cell biological system, Drosophila AD models have been generated and established a useful model organism for study on the etiology of human AD. In this study, we investigated the hormesis effects of low-dose ionizing radiation on Drosophila AD models. Our results suggest that low-dose ionizing radiation have the beneficial effects on not only the Aβ42-induced developmental defective phenotypes but also motor defects in Drosophila AD models. These results might be due to a regulation of apoptosis, and provide insight into the hormesis effects of low-dose ionizing radiation. Our results suggest that low-dose ionizing radiation have the beneficial effects on not only the Aβ42-induced developmental defective phenotypes but also motor defects in Drosophila AD models. These results might be due to a regulation of apoptosis, and provide insight into the hormesis effects of low-dose ionizing radiation.
11 CFR 110.17 - Price index increase.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Price index increase. 110.17 Section 110.17... PROHIBITIONS § 110.17 Price index increase. (a) Price index increases for party committee expenditure... 11 CFR 109.32 and 110.8 shall be increased by the percent difference between the price index, as...
Stimulatory effects of low ionizing radiation on plant
Energy Technology Data Exchange (ETDEWEB)
Yoshida, S.; Kurisu, Y.; Murata, I.; Takahashi, A. [Department of Nuclear Engineering, Osaka Univ., Suita, Osaka (Japan); Masui, H.; Iida, T. [Department of Electronic, Information Systems and Energy Engineering, Osaka Univ., Suita, Osaka (Japan); Yamamoto, T. [Radioisotope Research Center, Osaka Univ., Suita, Osaka (Japan)
2000-05-01
Recently, the study for radiation hormesis was strongly carried out for animals and plants; subharmful dose of radiation may stimulate any organism. The concept of radiation hormesis effect consists of 1) biopositive effects of low dose radiation; influence caused by low dose radiation is totally different from one caused by high dose radiation, low dose radiation produces physiological useful effects against high dose radiation, and 2) radio-adaptive response; radiation also acts the organism as stress. Irradiated with small dose radiation previously, it raises its own defense response against the stress (radiation), resulting in the phenomenon that radiation influence decreases in appearance. In this paper we have investigated the phenomenon of radiation hormesis effects for plants through irradiation experiments with neutrons and gamma-rays to find out the mechanism. In the present experiment, dry seeds of Raphanus sativus were irradiated with D-T neutrons (10 {mu}Gy {approx} 100 kGy), D-D neutrons (1 mGy {approx} 100 mGy), thermal and fast neutrons (irradiation in a nuclear reactor: 100 {mu}Gy {approx} 10 Gy), 60Co gamma-rays (10 {mu}Gy {approx} 10 Gy). To confirm existence of the radiation hormesis effects, germination percentage, length of hypocotyl, length of root and total weight of seed leaf were measured at 7th day after starting cultivation. We estimated relative effectiveness as the hormesis effect, that is the ratio of mean values of measured subjects for the irradiated and control groups. For Raphanus sativus, the hormesis effect on seed leaf growth has been observed in the seed group irradiated by D-T neutrons and D-D neutrons. The observed hormesis effect is from 5 to 25 percents. (author)
Yahweh’s ‘lord’ and Unrestrained Evil: An Exegesis of Psalm 110
Directory of Open Access Journals (Sweden)
Aran J.E. Persaud
2015-08-01
Full Text Available This article consists of an exegetical investigation of Psalm 110 and assumes that the psalms function in one sense as prayers, which can be prayed authentically by modern worshippers. Consequently, the specific images of hostile acts of war present a challenge as prayer. The methodology involves the investigation of the text from a grammatico-historical perspective by using selected sources from the 19th century to the present. The meaning of the violent images of enmity and the defining characteristics of the enemy are determined through understanding the perceived suffering of the psalmist. Special attention is given to the role of the phrase םֻאְנָּהוהְי, the identification of יִֹנדַאל and defining the enemy. The conclusions of the exegesis support a more traditional interpretation of יִֹנדַאל and characterise the recalcitrant enemies in an eschatological framework. Jahwe se ‘heer’ en onbeteuelde boosheid: ’n Eksegese van Psalm 110. Hierdie artikel is ’n eksegetiese ondersoek van Psalm 110 en gaan van die veronderstelling uit dat die psalms in ’n sekere sin gebede is wat deur moderne gelowiges gebid kan word. Die spesifieke uitbeeldings van vyandige oorlogsdade stel egter ’n uitdaging aan dié gebed. Die metodologie behels die ondersoek van die teks vanuit ’n grammaties-historiese perspektief deur uitgesoekte bronne vanaf die negentiende eeu tot tans te gebruik. Die betekenis van die geweldadige uitbeelding van vyandigheid en die omskrywende karaktertrekke van die vyand word bepaal deur die verstaan van die waarneembare lyding van die psalmskrywer. Daar word besondere aandag gegee aan die rol van die frase ָהוְהיּםֻאְנ, die eiening van יִֹנדַאל en die omskrywing van die vyand. Die slotsom van die eksegesis ondersteun ’n meer tradisionele interpretasie van יִֹנדַאל en tipeer die onversetlike vyand in ’n eskatalogiese raamwerk.
International Nuclear Information System (INIS)
Wang Qiong; Zhao Wei; Li Guiling; Zhang Sheng; Wu Gang
2008-01-01
Objective: To investigate the effect of valsartan, an angiotensin II type 1 receptor (AT1 R) blocker, on radiosensitivity, invasive potential and proliferation activity of nasopharyngeal carcinoma cells(CNE-2) in vitro. Methods: Radiosensitization of valsartan on CNE-2 cells in vitro was investigated by colony forming assay. Effect of AT1R blocker combined with radiation on invasive potential of CNE-2 cells was evaluated using 24-well Matrigel invasion chambers (Transwell). Apoptosis-inducing effect of valsartan combined with radiation on apoptosis of CNE-2 was identified by flow cytometry (FCM). Results: When valsartan was given at 10 -9 , 10 -8 and 10 -7 mol/L combined with radiation, sensitivity enhancement ratios (SER) were 1.10, 1.20 and 1.36, and the invasive inhibition rates were 8.11%, 16.49% and 16.77%, respectively. The SER of valsartan on CNE-2 distinctly increased when the exposure time was increased. After 24 h exposure to 10 -8 mol/L valsartan combined with radiation, the apoptosis rate was 1.89% ± 0.09%, which was higher than 1.62% ± 0.06% in radiation alone group (t=4.79, P<0.05). Conclusions: AT1R blocker valsartan combined with radiation can significantly inhibit the proliferation activity of nasopharyngeal carcinoma cells in vitro in a dose- and time-dependent manner. Valsartan combined with radiation can potently inhibit the invasive potential of CNE-2, which may be involved in the mechanism of valsartan treatment in vivo. (authors)
34 CFR 1200.110 - Self-evaluation.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Self-evaluation. 1200.110 Section 1200.110 Education Regulations of the Offices of the Department of Education (Continued) NATIONAL COUNCIL ON DISABILITY... COUNCIL ON DISABILITY § 1200.110 Self-evaluation. (a) The agency shall, by November 28, 1994, evaluate its...
49 CFR 807.110 - Self-evaluation.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Self-evaluation. 807.110 Section 807.110... TRANSPORTATION SAFETY BOARD § 807.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...
22 CFR 530.110 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 530.110 Section 530.110 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.110 Self-evaluation. (a) The... representing handicapped persons, to participate in the self-evaluation process by submitting comments (both...
21 CFR 225.110 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records and Reports § 225.110 Distribution records. (a) Distribution records permit the manufacturer to relate complaints to specific batches and/or... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 225.110 Section 225.110 Food...
9 CFR 3.110 - Veterinary care.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Veterinary care. 3.110 Section 3.110 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Mammals Animal Health and Husbandry Standards § 3.110 Veterinary care. (a) Newly acquired marine mammals...
7 CFR 4290.110 - Qualified management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Qualified management. 4290.110 Section 4290.110... Qualifications for the RBIC Program Organizing A Rbic § 4290.110 Qualified management. An Applicant must show, to the satisfaction of the Secretary, that its current or proposed management team is qualified and has...
Non-targeted effects of ionising radiation
International Nuclear Information System (INIS)
Belyakov, O.V.
2008-01-01
The universality of the target theory of radiation-induced effects is challenged by observations on non-targeted effects such as bystander effects and genomic instability. Essential features of non-targeted effects are that they do not require direct nuclear exposure by radiation and they are particularly significant at low doses. This new evidence suggests a need for a new paradigm in radiation biology. The new paradigm would cover both the classical (targeted) and the non-targeted effects. New aspects include the role of cellular communication and tissue-level responses. A better understanding of non-targeted effects may have important consequences for health risk assessment and, consequently, on radiation protection. Non-targeted effects may contribute to the estimation of cancer risk from occupational, medical and environmental exposures. In particular, they may have implications for the applicability of the Linear-No-Threshold (LNT) model in extrapolating radiation risk data into the low-dose region. This also means that the adequacy of the concept of dose to estimate risk is challenged by these findings. Moreover, these effects may provide new mechanistic explanations for the development of non-cancer diseases. Further research is required to determine if these effects, typically measured in cell cultures, are applicable in tissue level, whole animals, and ultimately in humans. (orig.)
International Nuclear Information System (INIS)
Maimum Tahir; Azhar Mohamad; Rozeita Laboh; Umikalsum Mohd Bahari
2014-01-01
Musa acuminata var. Berangan, is a popular variety of our local banana known as Pisang Berangan. The variety is a triploid banana, use mainly for dessert and has a great value for commodity fruit crops. However, production of PisangBerangan has been threatened by diseases such as Fusarium wilt, black sigatoka, Fusarium wilt, burrowing nematodes and viral diseases like Banana streak virus, Banana bunch top virus and Banana bract mosaic virus. The scenario becoming worst as Musa has a narrow genetic background for breeding and/or selection program. The banana breeding program of edible bananas is hampered by high sterility, and very limited amounts of seeds. Mutation induction via chronic gamma radiation is an alternative ways in creating more variants for selections towards a better quality and disease tolerance. A total number of 75 samples at nursery stage (1 month) were exposed to chronic gamma radiation in Gamma Greenhouse at Malaysian Nuclear Agency for 28 weeks. The samples were accordingly arranged with distance ranging from 1 m to 15 m from gamma source (Cesium-137). Plant height and new buds were used as measurement parameters in evaluating the direct effects of the chronic gamma radiation. Results showed effective dose of chronic gamma radiation in Pisang Berangan was 20 Gy. Number of new emerging sucker was ranging from 1-3 pieces with the highest at ring-4 and ring-5. Plant height was observed ranging from 22.1 to 110.5 cm. Effects of chronic radiation were observed after 3-4 months in the GGH. The samples revealed as striking leaves, short inter node and new emergence of suckers. The objective of this work is to get a dose response for chronic gamma radiation in Pisang Berangan. As for selection of potential mutant variants, new emerging suckers were tissue cultured in segregating chimeras and to get required numbers of samples for further field evaluation. (author)
Biology of ionizing radiation effects
International Nuclear Information System (INIS)
Ferradini, C.; Pucheault, J.
1983-01-01
The present trends in biology of ionizing radiation are reviewed. The following topics are investigated: interaction of ionizing radiations with matter; the radiolysis of water and aqueous solutions; properties of the free radicals intervening in the couples O 2 /H 2 O and H 2 O/H 2 ; radiation chemistry of biological compounds; biological effects of ionizing radiations; biochemical mechanisms involving free radicals as intermediates; applications (biotechnological applications, origins of life) [fr
Effects of ionizing radiations
International Nuclear Information System (INIS)
Gaussens, G.
1984-08-01
After recalling radiation-matter interaction, influence on radiation effects of chemical composition, structure, irradiation atmosphere, dose rate, temperature of organic materials and evolution of electrical, mechanical and physical properties are reviewed. Then behaviour under irradiation of main organic materials: elastomers, thermoplastics, thermosetting plastics, oils and paints are examined. 68 refs [fr
Effect of radiation environment on radiation use efficiency and growth of sunflower
International Nuclear Information System (INIS)
Bange, M.P.; Hammer, G.L.; Rickert, K.G.
1997-01-01
The level of incident radiation and the proportion of radiation that is diffuse affects radiation use efficiency (RUE) in crops. However, the degree of this effect, and its importance to growth and yield of sunflower (Helianthus annuus L.) have not been established. A field experiment was conducted to investigate the effects of radiation environment on RUE, growth, and yield of sunflower. A fully irrigated crop was sown on an alluvial-prairie soil (Fluventic Haplustoll) and was exposed to three distinct radiation environments. In two treatments, the level of incident radiation was reduced by 14 and 20% by suspending two different types of polyethylene plastic films well above the crop. In addition to the reductions in incident radiation, the proportion of radiation that was diffuse was increased by about 14% in these treatments. Lower incident radiation and increased proportion of diffuse radiation had no effect on total biomass, phenology, leaf area, and the canopy light extinction coefficient (k = 0.89). However, yield was reduced in shaded treatments due to smaller grain size and lower harvest index. Although crop RUE measured over the entire crop cycle (1.25 g/MJ) did not differ significantly among treatments, there was a trend where RUE compensated for less intercepted incident radiation. Theoretical derivations of the response of RUE to different levels of incident radiation supported this finding. Shaded sunflower crops have the ability to produce biomass similar to unshaded crops by increasing RUE, but have lower harvest indices
Low level radiation: biological effects
International Nuclear Information System (INIS)
Loken, M.K.
1983-01-01
It is imperative that physicians and scientists using radiations in health care delivery continue to assess the benefits derived, vs. potential risk, to patients and radiation workers being exposed to radiation in its various forms as part of our health delivery system. Insofar as possible we should assure our patients and ourselves that the benefits outweigh the potential hazards involved. Inferences as to the possible biological effects of low level radiation are generally based on extrapolations from those effects observed and measured following acute exposures to considerably higher doses of radiation. Thus, in order to shed light on the question of the possible biological effects of low level radiation, a wide variety of studies have been carried out using cells in culture and various species of plant and animal life. This manuscript makes reference to some of those studies with indications as to how and why the studies were done and the conclusions that might be drawn there from. In addition reference is made to the handling of this information by scientists, by environmentalists, and by the news media. Unfortunately, in many instances the public has been misled by what has been said and/or written. It is hoped that this presentation will provide an understandable and reasonable perspective on the various appropriate uses of radiation in our lives and how such uses do provide significant improvement in our health and in our quality of life
International Nuclear Information System (INIS)
2010-09-01
The third African IRPA 2010 conference on Strengthening Radiation Protection Infrastructures in Africa: Towards Establishing Effective and Sustainable Co-operations and Networks. IAEA's role in radiation protection with focus in Africa. The controlling of exposure to indoor Radon. And Measure of activities and calculation of effective dose of indoor 222 Rn in some dwelling and enclosed areas in Africa - capacity building for radiation protection. It had also address Patient Radiation Protection in Radiotherapy, challenges for advancing medical physic globally, Heath effects and medical applications of non-ionizing radiation, nuclear safety and radiation protection consideration in the design of research and development. The International radiation protection association (IRPA) 2010-2011 strategic plan that address among other issues educations and training activities (2000-2020) and the current UNSCLEAR activities
22 CFR 711.110 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 711.110 Section 711.110 Foreign... CORPORATION § 711.110 Self-evaluation. (a) The agency shall, by September 6, 1989, evaluate its current... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...
20 CFR 365.110 - Self-evaluation.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Self-evaluation. 365.110 Section 365.110... § 365.110 Self-evaluation. (a) The agency shall, by December 27, 1989, evaluate its current policies and... self-evaluation process by submitting comments (both oral and written). (c) The agency shall, until at...
19 CFR 201.110 - Self-evaluation.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...
21 CFR 165.110 - Bottled water.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...
Radiobiologic effects at low radiation levels
International Nuclear Information System (INIS)
Casarett, G.W.
1975-01-01
Data are reviewed on the effects of low radiation doses on mammals. Data from the 1972 report on the Biological Effects of Ionizing Radiation issued by the Advisory Committee of the National Academy of Sciences and National Research Council are discussed. It was concluded that there are certain radiosensitive systems in which low doses of radiation may cause degenerative effects, including gametogenic epithelium, lens of the eye, and developing embryos. Despite extensive investigation of genetic effects, including chromosomal effects, neither the amount of change that will be caused by very low levels of irradiation nor the degree of associated detriment is known
Physics of intense, high energy radiation effects
International Nuclear Information System (INIS)
Hjalmarson, Harold Paul; Hartman, E. Frederick; Magyar, Rudolph J.; Crozier, Paul Stewart
2011-01-01
This document summarizes the work done in our three-year LDRD project titled 'Physics of Intense, High Energy Radiation Effects.' This LDRD is focused on electrical effects of ionizing radiation at high dose-rates. One major thrust throughout the project has been the radiation-induced conductivity (RIC) produced by the ionizing radiation. Another important consideration has been the electrical effect of dose-enhanced radiation. This transient effect can produce an electromagnetic pulse (EMP). The unifying theme of the project has been the dielectric function. This quantity contains much of the physics covered in this project. For example, the work on transient electrical effects in radiation-induced conductivity (RIC) has been a key focus for the work on the EMP effects. This physics in contained in the dielectric function, which can also be expressed as a conductivity. The transient defects created during a radiation event are also contained, in principle. The energy loss lead the hot electrons and holes is given by the stopping power of ionizing radiation. This information is given by the inverse dielectric function. Finally, the short time atomistic phenomena caused by ionizing radiation can also be considered to be contained within the dielectric function. During the LDRD, meetings about the work were held every week. These discussions involved theorists, experimentalists and engineers. These discussions branched out into the work done in other projects. For example, the work on EMP effects had influence on another project focused on such phenomena in gases. Furthermore, the physics of radiation detectors and radiation dosimeters was often discussed, and these discussions had impact on related projects. Some LDRD-related documents are now stored on a sharepoint site (https://sharepoint.sandia.gov/sites/LDRD-REMS/default.aspx). In the remainder of this document the work is described in catergories but there is much overlap between the atomistic calculations, the
Radiation hormesis. Stimulatory effects of low level ionizing radiation on plant
Energy Technology Data Exchange (ETDEWEB)
Kinoshita, Shigenobu; Masui, Hisashi; Yoshida, Shigeo; Murata, Isao [Osaka Univ., Suita (Japan). Faculty of Engineering
1999-04-01
Recently, the study for radiation hormesis has been executed against animals and plants; subharmful doses of radiation may evoke a stimulatory response in any organism. We executed irradiating experiments of dry seeds with fusion (D-T) neutron, fission neutron, cobalt-60 gamma-ray and investigated existence of the radiation hormesis effects by measuring germination, the length of a stalk and the total weight of a seed leaf on the 7th day after starting cultivation. And we estimated radiation hormesis effects by relative effectiveness, the ratio of the mean value of measurement subjects for the irradiated group to that of non-irradiated group. In relation to Raphanus sativus, the hormesis effects on seed leaf growth from irradiated seeds have only turned up in seed groups irradiated by the fusion (D-T) neutron. We have confirmed that absorbed dose range which revealed the effects is from 1 cGy to 10 Gy and the increasing rate is from 5 percent to 25 percent against a control group. (author)
12 CFR 410.110 - Self-evaluation.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Self-evaluation. 410.110 Section 410.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.110 Self...
Radiation. Doses, effect, risk
International Nuclear Information System (INIS)
Vapirev, E.; Todorov, P.
1994-12-01
This book outlines in a popular form the topic of ionizing radiation impacts on living organisms. It contains data gathered by ICRP for a period of 35 years. The essential dosimetry terms and units are presented. Natural and artificial sources of ionizing radiation are described. Possible biological radiation effects and diseases as a consequence of external and internal irradiation at normal and accidental conditions are considered. An assessment of genetic risk for human populations is presented and the concept of 'acceptable risk' is discussed
Effect of radiation on microbiologic characteristics of M. tuberculosis
International Nuclear Information System (INIS)
Zack, M.B.; Stottmeier, K.; Berg, G.; Kazemi, H.
1974-01-01
The effect of irradiation on mutation (expressing itself as drug resistance) and on viability of Mycobacterium tuberculosis was studied in vitro. Forty-two identical cultures of H37-Rv (M. tuberculosis) were exposed to different levels of cobalt radiation (10, 100, 1,000, 2,500, 5,000, 10,000, and 20,000 rads) with six samples used for each of the seven radiation levels. Equivalent samples exposed to zero rads and samples handled and stored identically formed the controls. Coded cultures were read in a double-blind fashion to determine the number of surviving organisms and sensitivities to nine different antituberculosis drugs. Organism viability began to decrease at radiation levels of 1,000 rads and decreased linearly with higher levels of radiation. Three of the 42 radiated cultures developed drug-resistant organisms (one to INH, one to PAS, a third to SM). This drug resistance occurred at levels of clinical significance (greater than 1 percent control) as well as in amounts exceeding probability values for chance resistance mutation. High radiation levels such as occur in radiotherapeutic doses decrease the viability of M. tuberculosis. Radiation may also induce genetic mutation expressed as primary drug resistance. (U.S.)
Radiation effects in optoelectronic devices
International Nuclear Information System (INIS)
Barnes, C.E.
1977-03-01
A summary is given of studies on radiation effects in light-emitting diodes, laser diodes, detectors, optical isolators and optical fibers. It is shown that the study of radiation damage in these devices can provide valuable information concerning the nature of the devices themselves, as well as methods of hardening these devices for applications in radiation environments
Genetic effects of ionising radiation
International Nuclear Information System (INIS)
Saunders, P.A.H.
1991-12-01
Ionizing radiation effects on the gem cells, which can result in genetic abnormalities, are described. The basic mechanisms of radiation interactions with chromosomes, or specifically DNA, which can result in radiation induced mutation are discussed. Methods of estimating genetic risks, and some values for quantitative risk estimates are given. (U.K.). 13 refs., 2 figs., 1 tab
Radiation effects on ion exchange materials
Energy Technology Data Exchange (ETDEWEB)
Gangwer, T.E.; Goldstein, M.; Pillay, K.K.S.
1977-11-01
An extensive literature review and data compilation has been completed on the radiation-damage of ion exchange resins. The primary goal of the study has been to review the available literature on ion exchange materials used in, as well as those with potential for use in, the nuclear fuel and waste reprocessing areas. The physical and chemical properties of ion exchangers are reviewed. Experimental parameters useful in characterizing the effects of radiation on synthetic ion exchange resins are identified or defined. In compiling the diverse types of data, an effort was made to present the experimental data or experimentally based parameters in a format that would be useful for inter-comparing radiation effects on resins. When subject to radiation there are various general trends or qualitative effects displayed by the different types of resins. These radiation-trends and effects have been formulated into qualitative statements. The present day level of understanding of the behavior of resins under ionizing radiation is too limited to justify quantitative predictive modeling. The limitations and deficiencies of the literature are discussed and the experimentation needed to achieve quantitative modeling are outlined. 14 figs., 108 references.
Radiation effects on ion exchange materials
International Nuclear Information System (INIS)
Gangwer, T.E.; Goldstein, M.; Pillay, K.K.S.
1977-11-01
An extensive literature review and data compilation has been completed on the radiation-damage of ion exchange resins. The primary goal of the study has been to review the available literature on ion exchange materials used in, as well as those with potential for use in, the nuclear fuel and waste reprocessing areas. The physical and chemical properties of ion exchangers are reviewed. Experimental parameters useful in characterizing the effects of radiation on synthetic ion exchange resins are identified or defined. In compiling the diverse types of data, an effort was made to present the experimental data or experimentally based parameters in a format that would be useful for inter-comparing radiation effects on resins. When subject to radiation there are various general trends or qualitative effects displayed by the different types of resins. These radiation-trends and effects have been formulated into qualitative statements. The present day level of understanding of the behavior of resins under ionizing radiation is too limited to justify quantitative predictive modeling. The limitations and deficiencies of the literature are discussed and the experimentation needed to achieve quantitative modeling are outlined. 14 figs., 108 references
10 CFR 110.64 - Civil penalty.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Civil penalty. 110.64 Section 110.64 Energy NUCLEAR... Enforcement § 110.64 Civil penalty. (a) In response to a violation, the Commission may institute a proceeding to impose a civil penalty under section 234 of the Atomic Energy Act by issuing a notice to the...
49 CFR 174.110 - Car magazine.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Car magazine. 174.110 Section 174.110...) Materials § 174.110 Car magazine. When specially authorized by the carrier, Division 1.1 or 1.2 (explosive... packages of Class 1 (explosive) materials are placed in a “magazine” box made of sound lumber not less than...
14 CFR 1250.110 - Judicial review.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1250.110 Section 1250.110... PROGRAMS OF NASA-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 1250.110 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603...
21 CFR 168.110 - Dextrose anhydrous.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose anhydrous. 168.110 Section 168.110 Food... Table Sirups § 168.110 Dextrose anhydrous. (a) Dextrose anhydrous is purified and crystallized D-glucose... solids content is not less than 98.0 percent m/m. (b) The name of the food is “Dextrose anhydrous” or...
International Nuclear Information System (INIS)
Liu Yan; Yan Jing; Wang Hongjuan; Han Genquan
2014-01-01
We fabricated n-type Si-based TFETs with a Ge source on Si(110) substrate. The temperature dependent I DS –V GS characteristics of a TFET formed on Si(110) are investigated in the temperature range of 210 to 300 K. A study of the temperature dependence of I Leakage indicates that I Leakage is mainly dominated by the Shockley-Read-Hall (SRH) generation—recombination current of the n + drain—Si substrate junction. I ON increases monotonically with temperature, which is attributed to a reduction of the bandgap at the tunneling junction and an enhancement of band-to-band tunneling rate. The subthreshold swing S for trap assisted tunneling (TAT) current and band-to-band tunneling (BTBT) current shows the different temperature dependence. The subthreshold swing S for the TAT current degrades with temperature, while the S for BTBT current is temperature independent. (semiconductor devices)
International Nuclear Information System (INIS)
Leonhardt, J.W.
1985-01-01
Problems in the studies of radiation effects in gases are discussed. By means of ionization- excitation- and electron-capture yields various applications are characterized: ionization detectors, X-ray detectors, radionuclide battery, and radiation-induced chemical gas-phase reactions. Some new results of basic research in respect to the SO 2 oxidation are discussed. (author)
Energy Technology Data Exchange (ETDEWEB)
Gilchriese, M.G.D. [ed.] [Superconducting Super Collider Lab., Dallas, TX (United States)
1988-06-01
This report contains a preliminary study of the effects of the radiation levels expected at the SSC on potential detector components and a subset of materials to be used in the SSC accelerators. The report does not contain a discussion of radiation damage to electronics components that may be used at the SSC. We have investigated many of the effects of radiation on silicon detectors, on wire chambers, on scintillating materials and the associated readout, on optical fibers for data transmission and on structural or other materials to be used in detector or accelerator components. In the SSC accelerator complex, in particular the storage rings, radiation damage will not present significant problems different than those now faced by existing high energy accelerators. We find that the effects of radiation damage on SSC detector components will be significant at the design luminosity of the ssc and will limit, or determine, many of the options for different detector components. In this regard the reader should keep in mind that, in the absence of a specific detector design, it is not possible to form definitive conclusions regarding the viability of the detector components. Since the radiation levels in experiments at the SSC will depend on the geometry and composition of the apparatus, simple yes /no generalizations about the feasibility of a detector component are not possible.
The effects of ionizing radiation on man
International Nuclear Information System (INIS)
Watson, G.M.
1975-08-01
This paper describes the major effects of ionizing radiation on man and the relationship between such effects and radiation dose, with the conclusion that standards of radiological safety must be based on the carcinogenetic and mutagenic properties of ionizing radiation. Man is exposed to radiation from natural sources and from man-made sources. Exposure from the latter should be regulated but, since there is little observational or experimental evidence for predicting the effects of the very small doses likely to be required for adequate standards of safety, it is necessary to infer them from what is seen at high doses. Because the formal relationship between dose and effect is not fully understood, simplifying assumptions are necessary to estimate the effects of low doses. Two such assumptions are conventionally used; that there is a linear relationship between dose and effect at all levels of dose, and that the rate at which a dose of radiation is given does not alter the magnitude of the effect. These assumptions are thought to be conservative, that is they will not lead to an underestimation of the effects of small radiation doses although they may give an over-estimate. (author)
Effects of low level radiation upon the hematopoietic stem cell: Implications for leukemogenesis
International Nuclear Information System (INIS)
Cronkite, E.P.; Bond, V.P.; Carsten, A.L.; Miller, M.E.; Bullis, J.E.; Inoue, T.; Yokohama City Univ.
1987-01-01
These studies have addressed firstly the effect of single small doses of X-rays upon murine hematopoietic stem cells to obtain a better estimate of the D q . It is small, of the order of 20 rad. Secondly, a dose fractionation schedule that does not kill or perturb the kinetcs of hemopoietic cell proliferation was sought in order to investigate the leukemogenic potential of low level radiation upon an unperturbed hemopoietic system. Doses used by others in past radiation leukemogenesis studies clearly perturb hemopoiesis and kill a detectable fraction of stem cells. The studies reported herein show that 1.25 rad every day decrease the CFU-S content of bone marrow by the time 80 rads are accumulated. Higher daily doses as used in published studies on radiation leukemogenesis produce greater effects. Studies on the effect of 0.5, 1.0, 2.0, and 3.0 rad 3 times per week are under way. Two rad 3 times per week produced a modest decrease in CFU-S content of bone marrow after an accumulation of 68 rad. With 3.0 rad 3 times per week an accumulation of 102 rad produced a significant decrease in CFU-S content of bone marrow. Dose fractionation at 0.5 and 1.0 rad 3 times per week has not produced a CFU-S depression after accumulation of 17 and 34 rad. Radiation leukemogenesis studies published to date have utilized single doses and chronic exposure schedules that probably have significantly perturbed the kinetcs of hematopoietic stem cells. Whether radiation will produce leukemia in animal models with dose schedules that do not perturb kinetics of hematopoietic stem cells remains to be seen. (orig.)
Effects of low-level radiation upon the haematopoietic stem cell. Implications for leukaemogenesis
International Nuclear Information System (INIS)
Cronkite, E.P.; Bond, V.P.; Carsten, A.L.; Miller, M.E.; Bullis, J.E.
1983-01-01
These studies address first the effect of single small doses of X-rays upon murine haematopoietic stem cells to obtain a better estimate of the Dsub(q). It is small, of the order of 20 rad. Second, a dose fractionation schedule that does not kill or perturb the kinetics of haematopoietic cell proliferation was sought to investigate the leukaemogenic potential of low-level radiation upon an unperturbed haematopoietic system. Doses used by others in past radiation leukaemogenesis studies clearly perturb haematopoiesis and kill a detectable fraction of stem cells. The studies reported in the paper show that 1.25 rad every day decreases the CFU-S content of bone marrow by the time 80 rad are accumulated. Higher daily doses as used in published studies on radiation leukaemogenesis produce greater effects. Studies of the effect of 0.5, 1.0, 2.0 and 3.0 rad three times per week are under way. Two rad three times per week produce a modest decrease in CFU-S content of bone marrow after an accumulation of 68 rad. With 3.0 rad three times per week, an accumulation of 102 rad produces a significant decrease in CFU-S content of bone marrow. Dose fractionation at 0.5 and 1.0 rad three times per week has not produced a CFU-S depression after accumulation of 17 and 34 rad. Radiation leukaemogenesis studies published to date have used single doses and chronic exposure schedules that probably have significantly perturbed the kinetics of haematopoietic stem cells. Whether radiation will produce leukaemia in animal models with dose schedules that do not perturb the kinetics of haematopoietic stem cells remains to be seen. (author)
International Nuclear Information System (INIS)
Holmes-Siedle, A.; Adams, L.
1993-01-01
This handbook is intended to serve as a tool for designers of equipment and scientific instruments in cases where they are required to ensure the survival of the equipment in radiation environments. High-technology materials, especially semiconductors and optics, tend to degrade on exposure to radiation in many different ways. Intense high-energy radiation environments are found in nuclear reactors and accelerators, machines for radiation therapy, industrial sterilization, and space. Some engineers have to build equipment which will survive a nuclear explosion from a hostile source. Proper handling of a disaster with radioactive materials requires equipment which depends utterly on semiconductor microelectronics and imaging devices. Thus the technology of radiation-tolerant electronics is an instrument for good social spheres as diverse as disaster planning and the exploration of Mars. In order to design equipment for intense environments like those described above, then degradation from high-energy irradiation must be seen as a basic design parameter. The aim of this handbook is to assist the engineer or student in that thought; to make it possible to write intelligent specifications; to offer some understanding of the complex variety of effects which occur when high-technology components encounter high-energy radiation; and to go thoroughly into the balance of choices of how to alleviate the effects and hence achieve the design aims of the project. Separate abstracts were prepared for 15 chapters of this book
Kim, Kyung-Ju; Lee, Tae Hun; Kim, Jung Ho; Cho, Nam-Yun; Kim, Woo Ho; Kang, Gyeong Hoon
2017-09-01
Deletion of the HSP110 T 17 mononucleotide repeat has recently been identified as a prognostic marker that is correlated with wild-type HSP110 (HSP110wt) expression in microsatellite instability-high (MSI-H) colorectal cancers. The aim of this study was to assess the correlation between deletion of the HSP110 T 17 repeat and expression of HSP110wt using DNA testing and immunohistochemistry and to determine the prognostic implications of HSP110 T 17 deletion in MSI-H advanced gastric cancers (GCs). The status of HSP110wt expression was evaluated by immunohistochemistry using an HSP110wt-specific antibody in 142 MSI-H advanced GCs. The size of the HSP110 T 17 repeat deletion was analyzed in 96 MSI-H advanced GCs; deletions were divided into small (0-2base pairs) and large deletions (3-5base pairs). Low and high expressions of HSP110wt were detected in 38 (26.8%) and 104 (73.2%) of the 142 cases, respectively. The HSP110 T 17 deletion was observed in 45 (46.9%) of the 96 MSI-H GC samples. Tumors with high expression of HSP110wt showed a tendency to have small or no deletion of HSP110 T 17 . In Kaplan-Meier survival analysis, tumors with a large HSP110 T 17 deletion were associated with favorable overall survival and disease-free survival compared with those with small/no deletion of HSP110 T 17 . However, HSP110 T 17 deletion size was not an independent prognostic factor in multivariate analysis. In summary, deletion of the HSP110 T 17 repeat was frequently observed in MSI-H GCs, and HSP110 T 17 deletion size was inversely correlated with HSP110wt expression status. Large HSP110 T 17 was not a prognostic indicator in MSI-H GCs. Copyright © 2017 Elsevier Inc. All rights reserved.
Effect of nuclear radiation on the electrical properties of chemical double layer capacitors
International Nuclear Information System (INIS)
Laghari, J.R.; Hammoud, A.N.
1990-01-01
The effects of nuclear radiation on the electrical properties of chemical double layer capacitors are determined. The capacitors were irradiated in a 2-MW nuclear reactor to different fluence levels. The exposure rate was 2.2 x 10 10 n/cm 2 · s of thermal neutrons, 9.52 x 10 8 n/cm 2 · s of fast neutrons (> 2 MeV), and 1.47 x 10 6 rad/h of gamma radiation. The properties measured during and after irradiation included the capacitance, equivalent series resistance, and open-circuit voltage. The post-irradiation effect on the leakage current was also determined. It was found that while the capacitance increased during irradiation, the equivalent series resistance and the open-circuit voltage decreased slightly during irradiation. Changes in these properties were not permanent s was evident from post-irradiation measurements. The leakage current did not show any significant change with radiation. The results indicate that chemical double layer capacitors can be suitably used as backup power source in electronic equipment operating in a radiation environment with total fluences up to 4.05 x 10 14 n/cm 2
International Nuclear Information System (INIS)
Lauterbach, U.; Pessara, W.; Woehler-Figgen, S.
1997-12-01
Measuring instruments for radiation dose measurement in the range of natural ambient radiation are not subject to legal obligations for calibration and the PTB received numerous requests in the past, asking for measures to be taken in order to ensure reliability of measuring results in this range of radiation. This has induced PTB to organise the seminar, intended to present the current status of measuring technology in this field, reveal problems encountered in practical applications, and discuss suitable ction for quality assurance. The papers of the seminar report the measuring performance and capabilities of the available instruments, results of comparative analyses of measurements, and resulting proposed action for quality assurance. Discussions concluding the sessions are also presented in the processdings volume. (orig./CB) [de
Late health effects of radiation. Knowledge gained through 60 years experience in Japan
International Nuclear Information System (INIS)
Yamashita, Shunichi
2005-01-01
The proceedings begin with Preface by World Health Organization (WHO) and Message from Nagasaki University, and contain the topics of Health studies on atomic bomb survivors, WHO programs on radiation and health, Round-table discussion, and Special articles. The first topic involves the Radiation effects studies of RERF (Radiation Effects Research Foundation, the Japanese-US research organization focused on the study of health effects of radiation in survivors of the atomic bombings in Hiroshima and Nagasaki), Activities at the atomic bomb survivors health care commission, Late health effects of atomic bomb survivors, Late medical effects of atomic bombs still persisting after over sixty years, Solid cancer incidence among atomic bomb survivors/ preliminary data from a second follow-up, and Multiple primary cancers in Nagasaki atomic bomb survivors. The second; Key radiation projects at the WHO, The role of the WHO in strengthening capacity of the member states for preparedness and response to radiation emergencies, and Diagnostic imaging in a global perspective. A moderator and 8 discussants concerned with topics above give their issues in the third topic. Special articles describe about Historical role of L. S. Taylor in American radiation safety and protection, and Responsibility beyond 60 years. (T.I.)
Attenuation characteristics of materials used in radiation protection as radiation shielding
International Nuclear Information System (INIS)
Almeida Junior, Airton T.; Araujo, F.G.S.; Nogueira, M.S.; Santos, M.A.P.
2013-01-01
Crystal glass has been widely used as shielding material in gamma radiation sources as well as x-ray generating equipment to replace the plumbiferous glass, in order to minimize exposure to individuals. In this work, ten plates of crystal glass, with dimensions of 20cm x 20cm and range of thicknesses from 0.5 to 2.0 cm, and barite concrete were irradiated with potential constants of 60kV, 80kV, 110kV, 150kV and gamma radiation of 60 Co. The curves of attenuation and of transmission were obtained for crystal glass, barite plaster and barite concrete (mGy/mA.min) at 1 meter as a function of thickness.Crystal glass has been widely used as shielding material in gamma radiation sources as well as x-ray generating equipment to replace the plumbiferous glass, in order to minimize exposure to individuals. In this work, ten plates of crystal glass, with dimensions of 20cm x 20cm and range of thicknesses from 0.5 to 2.0 cm, and barite concrete were irradiated with potential constants of 60kV, 80kV, 110kV, 150kV and gamma radiation of 60 Co. The curves of attenuation and of transmission were obtained for crystal glass, barite plaster and barite concrete (mGy/mA.min) at 1 meter as a function of thickness. (author)
International Nuclear Information System (INIS)
Nakajima, Toshiyuki; Kamiyama, Takayoshi; Fujii, Yoshiyuki; Motoyama, Hideaki; Esumi, Shuuichi
1995-01-01
Both ice-based altitude distributions of natural ionizing radiation exposure and the quasi-effective energy of natural radiation over Antarctica over the latitude range 69 o S-77 o S during approx. 500 days were measured using thermoluminescent dosimeters. The results shows that dependence on altitude above sea level of the exposure rate increases by almost three-fold with each increase of 2000 m of altitude, thus deviating from the general rule stating that the exposure rate should double with each 2000 m. Although the exposure rate shows a dependence on altitude, altitude dependence of the quasi-effective energy of natural radiation over Antarctica is not observed. In the present study it is observed that natural radiation occurring over the ice base of Antarctica consists mainly of cosmic rays. (Author)
Nakajima, T; Kamiyama, T; Fujii, Y; Motoyama, H; Esumi, S
1995-12-01
Both ice-based altitude distributions of natural ionizing radiation exposure and the quasi-effective energy of natural radiation over Antartica over the latitude range 69 degrees S - 77 degrees S during approx. 500 days were measured using thermoluminescent dosimeters. The results shows that dependence on altitude above sea level of the exposure rate increases by almost three-fold with each increase of 2000 m of altitude, thus deviating from the general rule stating that the exposure rate should double with each 2000 m. Although the exposure rate shows a dependence on altitude, altitude dependence of the quasi-effective energy of natural radiation over Antartica is not observed. In the present study it is observed that natural radiation occurring over the ice base of Antartica consists mainly of cosmic rays.
Dictionnary for radiation safety terminology
International Nuclear Information System (INIS)
1980-01-01
The dictionnary of radiation protection terms has been compiled by CMEA member-country specialists under the auspisious of Scientific-Technical Council for Radiation Protection of the Permanent Commision for Peaceful Atomic Energy Applications as a means for better mutual understanding in collaborative activities. The dictionnary incorporates, along with Russian terms, the corresponding ones in the official languages of CMEA member-countries who participated in its compiling: Bulgarian, Hungarian, German, Spanish, Polish, Roumanian, Czech as well as English. The dictionnary consists of three sections: 1) Ionizing radiation; 2) Ionizing radiation interaction with materials. Ionizing radiation dosimetry; 3) Radiation protection. The first section contains 16 terms, the second - 25, the third - 110. The terms within the section are arranged in sense sequences
The Effects of Ionizing Radiation on Mammalian Cells.
Biaglow, John E.
1981-01-01
Discusses the effects of radiation on dividing cells and factors influencing these effects; also briefly reviews the radical mechanism for radiation damage. Emphasizes the importance of oxygen in radiation effects. (CS)
Modifiers of radiation effects in the eye
Kleiman, Norman J.; Stewart, Fiona A.; Hall, Eric J.
2017-11-01
World events, including the threat of radiological terrorism and the fear of nuclear accidents, have highlighted an urgent need to develop medical countermeasures to prevent or reduce radiation injury. Similarly, plans for manned spaceflight to a near-Earth asteroid or journey to Mars raise serious concerns about long-term effects of space radiation on human health and the availability of suitable therapeutic interventions. At the same time, the need to protect normal tissue from the deleterious effects of radiotherapy has driven considerable research into the design of effective radioprotectors. For more than 70 years, animal models of radiation cataract have been utilized to test the short and long-term efficacy of various radiation countermeasures. While some compounds, most notably the Walter Reed (WR) class of radioprotectors, have reported limited effectiveness when given before exposure to low-LET radiation, the human toxicity of these molecules at effective doses limits their usefulness. Furthermore, while there has been considerable testing of eye responses to X- and gamma irradiation, there is limited information about using such models to limit the injurious effects of heavy ions and neutrons on eye tissue. A new class of radioprotector molecules, including the sulfhydryl compound PrC-210, are reported to be effective at much lower doses and with far less side effects. Their ability to modify ocular radiation damage has not yet been examined. The ability to non-invasively measure sensitive, radiation-induced ocular changes over long periods of time makes eye models an attractive option to test the radioprotective and radiation mitigating abilities of new novel compounds.
International Nuclear Information System (INIS)
Priyadarshi, Shekhar; Leidinger, Markus; Pierz, Klaus; Racu, Ana M.; Siegner, Uwe; Bieler, Mark; Dawson, Philip
2009-01-01
We report the observation and the study of an additional shift current tensor element in (110)-oriented GaAs quantum wells, which arises from an out-of-plane asymmetry of the quantum well structure. The current resulting from this tensor element is optically induced with 150 fs laser pulses and detected by measuring the simultaneously emitted terahertz radiation. This terahertz spectroscopy of shift currents is a powerful technique for symmetry investigations, which shows, for example, that our nominally symmetric (110)-oriented GaAs/AlGaAs quantum wells grown by molecular beam epitaxy are in reality asymmetric structures with different right and left interfaces.
International Nuclear Information System (INIS)
Upton, Arthur C.
2002-01-01
In recent decades, it has been customary, for radiation protection purposes, to assume that the overall risk of radiation- included cancer increases as a linear-nonthreshold function of the dose. The existing data do not exclude the existence of a threshold, however, and the dose-response relationship is known to vary depending on the type of cancer in question, the dose, dose rate and LET of the radiation, the age, sex and physiological state of the exposed individuals, and other variables, including the potential influence of adaptive responses and bystander effects at low doses. In light of advancing knowledge, therefore, the dose-response relationship for carcinogenic effects of low-level radiation has been reevaluated periodically by the National Council on Radiation Protection and Measurements, the International Commission of Radiological Protection, the United Nations Scientific Committee on the Effects of Atomic Radiation, the U.S. National Academy of Sciences Committee on the Effects of Atomic Radiation, the U.S. National Academy of Sciences, and other organizations. The most recent such reviews have generally found the weight of evidence to suggest that lesions which are precursors to cancer (i.e., mutations and chromosome aberrations), and certain types of cancer as well, may increase in frequency linearly aberrations), and certain types of cancer as well, may increase in frequency linearly with the dose in the low-dose domain. On this basis, it is concluded that no alternative dose-response model for the carcinogenic effects of low-level radiation is ore plausible than the linear-nonthreshold model, although other dose-response relationships cannot be excluded. (author)
Some characteristics and effects of natural radiation
International Nuclear Information System (INIS)
Mc Laughlin, J.P.
2015-01-01
Since life first appeared on the Earth, it has, in all its subsequent evolved forms including human, been exposed to natural radiation in the environment both from terrestrial and extra-terrestrial sources. Being an environmental mutagen, ionising natural radiation may have played a role of some significance in the evolution of early life forms on Earth. It has been estimated by United Nations Scientific Committee on the Effects of Atomic Radiation that at the present time, exposure to natural radiation globally results in an annual average individual effective dose of about 2.4 mSv. This represents about 80 % of the total dose from all sources. The three most important components of natural radiation exposure are cosmic radiation, terrestrial radioactivity and indoor radon. Each of these components exhibits both geographical and temporal variabilities with indoor radon exposure being the most variable and also the largest contributor to dose for most people. In this account, an overview is given of the characteristics of the main components of the natural radiation environment and some of their effects on humans. In the case of cosmic radiation, these range from radiation doses to aircrew and astronauts to the controversial topic of its possible effect on climate change. In the case of terrestrial natural radiation, accounts are given of a number of human exposure scenarios. (author)
Radiative budget and cloud radiative effect over the Atlantic from ship-based observations
Directory of Open Access Journals (Sweden)
J. Kalisch
2012-10-01
Full Text Available The aim of this study is to determine cloud-type resolved cloud radiative budgets and cloud radiative effects from surface measurements of broadband radiative fluxes over the Atlantic Ocean. Furthermore, based on simultaneous observations of the state of the cloudy atmosphere, a radiative closure study has been performed by means of the ECHAM5 single column model in order to identify the model's ability to realistically reproduce the effects of clouds on the climate system.
An extensive database of radiative and atmospheric measurements has been established along five meridional cruises of the German research icebreaker Polarstern. Besides pyranometer and pyrgeometer for downward broadband solar and thermal radiative fluxes, a sky imager and a microwave radiometer have been utilized to determine cloud fraction and cloud type on the one hand and temperature and humidity profiles as well as liquid water path for warm non-precipitating clouds on the other hand.
Averaged over all cruise tracks, we obtain a total net (solar + thermal radiative flux of 144 W m−2 that is dominated by the solar component. In general, the solar contribution is large for cirrus clouds and small for stratus clouds. No significant meridional dependencies were found for the surface radiation budgets and cloud effects. The strongest surface longwave cloud effects were shown in the presence of low level clouds. Clouds with a high optical density induce strong negative solar radiative effects under high solar altitudes. The mean surface net cloud radiative effect is −33 W m−2.
For the purpose of quickly estimating the mean surface longwave, shortwave and net cloud effects in moderate, subtropical and tropical climate regimes, a new parameterisation was created, considering the total cloud amount and the solar zenith angle.
The ECHAM5 single column model provides a surface net cloud effect that is more
15 CFR 2011.110 - Suspension of certificate system.
2010-01-01
..., SYRUPS AND MOLASSES Certificate of Quota Eligibility § 2011.110 Suspension of certificate system. (a... of such suspension and the effective date thereof shall be published in the Federal Register. (b... such reinstatement and the effective date thereof shall be published in the Federal Register. (c...
6. national congress of radiation protection S.F.R.P. 2007
International Nuclear Information System (INIS)
2007-01-01
This congress tackles the following subjects: individual dosimetry for external irradiation, update of arrangements in the public health code relative to the radiation protection, implementation of zoning decree, regulation, radiation protection in professional area, radiation protection in ITER, non ionizing radiation, radiation protection in accident situation, biological radiation effects, radiation protection for patients, dosimetry, environmental exposure, radiation protection and radioactive waste management. (N.C.)
Directory of Open Access Journals (Sweden)
Rafael Alves de Aguiar
2013-03-01
Full Text Available O presente estudo comparou o tempo mantido acima de 90% (t90VO2max e de 95% VO2max (t95VO2max em três diferentes intensidades de exercício. Após a realização de um teste incremental para determinar o VO2max, oito estudantes de educação física ativos (23 ± 3 anos executaram três sessões de exercícios intermitentes (100, 110 e 120% da velocidade do VO2max (vVO2max com razão esforço:recuperação de 30s:15s. O t95VO2max foi significantemente maior em 110%vVO2max (EI110% (218,1 ± 81,6 s quando comparado a 100%vVO2max (EI100% (91,9 ± 75,2s e a 120%vVO2max (EI120% (126,3 ± 29,4 s, porém sem diferença entre EI100% e EI120%. O t90VO2max somente apresentou diferença significante entre EI110% e EI120%. Portanto, conclui-se que durante exercício intermitente com razão 30s:15s, a intensidade de 110%vVO2max apresenta-se mais adequada para manter o VO2 próximo ou no VO2max por um tempo maior.The present study compared the time maintained above 90% (t90VO2max or 95% VO2max (t95VO2max in three different exercise intensities. After performing an incremental test to determine VO2max, eight physical education active students (23 ± 3 years performed three intermittent exercise sessions (100, 110 e 120% velocity of VO2max (vVO2max with ratio effort:recovery of 30s:15s. The t95%VO2max was significantly higher at 110%vVO2max (EI110% (218.1 ± 81.6s compared to 100% vVO2max (EI100% (91.9 ± 75.2s and 120%vVO2max (EI120% (126.3 ± 29.4s, but without differences between EI100% and EI120%. The t90%vVO2max was significantly different only between EI110% and 120%. Therefore, we conclude that during intermittent exercise with ratio 30s:15s, the intensity of 110%vVO2max appears more appropriate to maintain VO2max for a longer time.
Harmful effects of ultraviolet radiation
International Nuclear Information System (INIS)
Anon.
1989-01-01
Tanning for cosmetic purposes by sunbathing or by using artificial tanning devices is widespread. The hazards associated with exposure to ultraviolet radiation are of concern to the medical profession. Depending on the amount and form of the radiation, as well as on the skin type of the individual exposed, ultraviolet radiation causes erythema, sunburn, photodamage (photoaging), photocarcinogenesis, damage to the eyes, alteration of the immune system of the skin, and chemical hypersensitivity. Skin cancers most commonly produced by ultraviolet radiation are basal and squamous cell carcinomas. There also is much circumstantial evidence that the increase in the incidence of cutaneous malignant melanoma during the past half century is related to increased sun exposure, but this has not been proved. Effective and cosmetically acceptable sunscreen preparations have been developed that can do much to prevent or reduce most harmful effects to ultraviolet radiation if they are applied properly and consistently. Other safety measures include (1) minimizing exposure to ultraviolet radiation, (2) being aware of reflective surfaces while in the sun, (3) wearing protective clothing, (4) avoiding use of artificial tanning devices, and (5) protecting infants and children
Physics of intense, high energy radiation effects.
Energy Technology Data Exchange (ETDEWEB)
Hjalmarson, Harold Paul; Hartman, E. Frederick; Magyar, Rudolph J.; Crozier, Paul Stewart
2011-02-01
This document summarizes the work done in our three-year LDRD project titled 'Physics of Intense, High Energy Radiation Effects.' This LDRD is focused on electrical effects of ionizing radiation at high dose-rates. One major thrust throughout the project has been the radiation-induced conductivity (RIC) produced by the ionizing radiation. Another important consideration has been the electrical effect of dose-enhanced radiation. This transient effect can produce an electromagnetic pulse (EMP). The unifying theme of the project has been the dielectric function. This quantity contains much of the physics covered in this project. For example, the work on transient electrical effects in radiation-induced conductivity (RIC) has been a key focus for the work on the EMP effects. This physics in contained in the dielectric function, which can also be expressed as a conductivity. The transient defects created during a radiation event are also contained, in principle. The energy loss lead the hot electrons and holes is given by the stopping power of ionizing radiation. This information is given by the inverse dielectric function. Finally, the short time atomistic phenomena caused by ionizing radiation can also be considered to be contained within the dielectric function. During the LDRD, meetings about the work were held every week. These discussions involved theorists, experimentalists and engineers. These discussions branched out into the work done in other projects. For example, the work on EMP effects had influence on another project focused on such phenomena in gases. Furthermore, the physics of radiation detectors and radiation dosimeters was often discussed, and these discussions had impact on related projects. Some LDRD-related documents are now stored on a sharepoint site (https://sharepoint.sandia.gov/sites/LDRD-REMS/default.aspx). In the remainder of this document the work is described in catergories but there is much overlap between the atomistic
Gleńska-Olender, J; Durlik, K; Konieczna, I; Kowalska, P; Gawęda, J; Kaca, W
2017-11-01
Bacteria of the genus Proteus of the family Enterobacteriaceae are facultative human pathogens responsible mainly for urinary tract and wound infections, bacteremia and the development of rheumatoid arthritis (RA). We have analyzed and compared by ELISA the titer of antibodies in plasmas of healthy individuals and in sera of rheumatoid arthritis patients recognizing a potential host cross-reactive epitope (lysine-galacturonic acid epitopes) present in Proteus lipopolysaccharide (LPS). In our experiments LPSs isolated from two mutants of smooth Proteus mirabilis 1959 (O3), i.e. strains R110 and R45, were used. R110 (Ra type mutant) is lacking the O-specific polysaccharide, but possesses a complete core oligosaccharide, while R45 (Re type) has a reduced core oligosaccharide and contains two 3-deoxy-D-manno-oct-2-ulosonic acid residues and one of 4-amino-4-deoxy-L-arabinopyranose residues. Titer of P. mirabilis S1959 LPS-specific-antibodies increased with the age of blood donors. RA and blood donors' sera contained antibodies against S and Ra and Re type of P. mirabilis O3 LPSs. Antibodies recognizing lysine-galacturonic acid epitopes of O3 LPS were detected by ELISA in some plasmas of healthy individuals and sera of rheumatoid arthritis patients. RA patients antibodies reacting with P. mirabilis S1959 S and R LPSs may indicate a potential role of anti-LPS antibodies in molecular mimicry in RA diseases.
Physics of radiation effects in crystals
Johnson, RA
1986-01-01
``Physics of Radiation Effects in Crystals'' is presented in two parts. The first part covers the general background and theory of radiation effects in crystals, including the theory describing the generation of crystal lattice defects by radiation, the kinetic approach to the study of the disposition of these defects and the effects of the diffusion of these defects on alloy compositions and phases. Specific problems of current interest are treated in the second part and include anisotropic dimensional changes in x-uranium, zirconium and graphite, acceleration of thermal creep in reactor ma
Effects of radiation pressure on the equipotential surfaces in X-ray binaries
Kondo, Y.; Mccluskey, G. E., Jr.; Gulden, S. L.
1976-01-01
Equipotential surfaces incorporating the effect of radiation pressure were computed for the X-ray binaries Cen X-3, Cyg X-1 = HDE 226868, Vela XR-1 = 3U 0900-40 = HD 77581, and 3U 1700-37 = HD 153919. The topology of the equipotential surfaces is significantly affected by radiation pressure. In particular, the so-called critical Roche (Jacobian) lobes, the traditional figure 8's, do not exist. The effects of these results on modeling X-ray binaries are discussed.
Effects of radiation pressure on the equipotential surfaces in x-ray binaries
International Nuclear Information System (INIS)
Kondo, Y.; McCluskey, G.E. Jr.; Gulden, S.L.
1976-01-01
Equipotential surfaces incorporating the effect of radiation pressure were computed for the x-ray binaries Cen X-3, Cyg X-1 = HDE 226868, Vela XR-1 = 3U 0900-40 = HD 77581, and 3U 1700-37 = HD 153919. The topology of the equipotential surfaces is significantly affected by radiation pressure. In particular, the so-called critical Roche (Jacobian) lobes, the traditional figure 8's, do not exist. The effects of these results on modeling x-ray binaries are discussed
Poopal, Ashwini C; Schroeder, Lindsay M; Horn, Paul S; Bassell, Gary J; Gross, Christina
2016-01-01
Dysfunctions in the PI3K/mTOR pathway have gained a lot of attention in autism research. This was initially based on the discovery of several monogenic autism spectrum disorders with mutations or defects in PI3K/mTOR signaling components. Recent genetic studies corroborate that defective PI3K/mTOR signaling might be a shared pathomechanism in autism disorders of so far unknown etiology, but functional molecular analyses in human cells are rare. The goals of this study were to perform a functional screen of cell lines from patients with idiopathic autism for defects in PI3K/mTOR signaling, to test if further functional analyses are suitable to detect underlying molecular mechanisms, and to evaluate this approach as a biomarker tool to identify therapeutic targets. We performed phospho-S6- and S6-specific ELISA experiments on 21 lymphoblastoid cell lines from the AGRE collection and on 37 lymphoblastoid cell lines from the Simons Simplex Collection and their healthy siblings. Cell lines from one individual with increased S6 phosphorylation and his multiplex family were analyzed in further detail to identify upstream defects in PI3K signaling associated with autism diagnosis. We detected significantly increased S6 phosphorylation in 3 of the 21 lymphoblastoid cell lines from AGRE compared to a healthy control and in 1 of the 37 lymphoblastoid cell lines from the Simons Simplex Collection compared to the healthy sibling. Further analysis of cells from one individual with elevated S6 phosphorylation showed increased expression of the PI3K catalytic subunit p110δ, which was also observed in lymphoblastoid cells from other autistic siblings but not unaffected members in his multiplex family. The p110δ-selective inhibitor IC87114 reduced elevated S6 phosphorylation and protein synthesis in this cell line. Our results suggest that functional analysis of PI3K/mTOR signaling is a biomarker tool to identify disease-associated molecular defects that could serve as therapeutic
Radiation Effects and Hardening Techniques for Spacecraft Microelectronics
Gambles, J. W.; Maki, G. K.
2002-01-01
The natural radiation from the Van Allen belts, solar flares, and cosmic rays found outside of the protection of the earth's atmosphere can produce deleterious effects on microelectronics used in space systems. Historically civil space agencies and the commercial satellite industry have been able to utilize components produced in special radiation hardened fabrication process foundries that were developed during the 1970s and 1980s under sponsorship of the Departments of Defense (DoD) and Energy (DoE). In the post--cold war world the DoD and DoE push to advance the rad--hard processes has waned. Today the available rad--hard components lag two-plus technology node generations behind state- of-the-art commercial technologies. As a result space craft designers face a large performance gap when trying to utilize available rad--hard components. Compounding the performance gap problems, rad--hard components are becoming increasingly harder to get. Faced with the economic pitfalls associated with low demand versus the ever increasing investment required for integrated circuit manufacturing equipment most sources of rad--hard parts have simply exited this market in recent years, leaving only two domestic US suppliers of digital rad--hard components. This paper summarizes the radiation induced mechanisms that can cause digital microelectronics to fail in space, techniques that can be applied to mitigate these failure mechanisms, and ground based testing used to validate radiation hardness/tolerance. The radiation hardening techniques can be broken down into two classes, Hardness By Process (HBP) and Hardness By Design (HBD). Fortunately many HBD techniques can be applied to commercial fabrication processes providing space craft designer with radiation tolerant Application Specific Integrated Circuits (ASICs) that can bridge the performance gap between the special HBP foundries and the commercial state-of-the-art performance.
Long-term effects of ionizing radiation
International Nuclear Information System (INIS)
Kaul, Alexander; Burkart, Werner; Grosche, Bernd; Jung, Thomas; Martignoni, Klaus; Stephan, Guenther
1997-01-01
This paper approaches the long-term effects of ionizing radiation considering the common thought that killing of cells is the basis for deterministic effects and that the subtle changes in genetic information are important in the development of radiation-induced cancer, or genetic effects if these changes are induced in germ cells
The effects of radiation on man
International Nuclear Information System (INIS)
Saunders, P.
1981-01-01
Available evidence on the effects of high levels of radiation on man and the predictions which have been made on possible low level effects, by extrapolation of the high level data, are summarised. The factors which influence the biological effects of radiation are examined and acute, delayed, somatic and hereditary effects as reported in the literature, are discussed. (U.K.)
Urothelial cancers following radiation therapy for cervical cancer
International Nuclear Information System (INIS)
Nakata, Seiji; Hasumi, Masaru; Sato, Jin; Mayuzumi, Takuji; Kumasaka, Fuminari; Shimizu, Toshihiro.
1996-01-01
Some reports have indicated that bladder cancer is induced by radiation therapy for cervical cancer. We encountered 6 cases of urothelial cancer (5 cases of bladder cancer and 1 case of ureter cancer) following radiation therapy for cervical cancer. Age at the time of diagnosis of cervical cancer ranged from 38 to 66 years, and the average was 51.2±11.0 (S.D.) years old. Age at the time of diagnosis of urothelial cancer ranged from 53 to 83 years, and the average was 67.5±10.3 years old. The interval between the diagnosis of cervical cancer and urothelial cancer ranged from 3 to 25 years, averaging 16.3 years. It is impossible to evaluate the risk of development of urothelial cancer after radiation therapy based on our data. However, it is important to make an effort to diagnose urothelial cancer at an early stage by educating patients (e.g., advising regular urine tests) after the follow-up period to cervical cancer. (author)
Radiation effect on rocket engine performance
Chiu, Huei-Huang; Kross, K. W.; Krebsbach, A. N.
1990-01-01
Critical problem areas involving the effect of radiation on the combustion of bipropellants are addressed by formulating a universal scaling law in combination with a radiation-enhanced vaporization combustion model. Numerical algorithms are developed and data pertaining to the Variable Thrust Engine (VTE) and the Space Shuttle Main Engine (SSME) are used to conduct parametric sensitivity studies to predict the principal intercoupling effects of radiation. The analysis reveals that low-enthalpy engines, such as the VTE, are vulnerable to a substantial performance setback due to radiative loss, whereas the performance of high-enthalpy engines such as the SSME are hardly affected over a broad range of engine operation. Combustion enhancement by radiative heating of the propellant has a significant impact on propellants with high absorptivity.
2016-09-08
of electromagnetic 85 pulse effects on cables and electrical devices4 and as a self - powered detector for in-core neutron flux measurement in nuclear...AFCEC-CX-TY-TP-2016-0003 A SELF - POWERED THIN-FILM RADIATION DETECTOR USING INTRINSIC HIGH-ENERGY CURRENT (HEC) (AUTHOR’S FINAL VERSION...14 -- 5 Oct 15 A self - powered thin-film radiation detector using intrinsic high-energy current (HEC) (Author’s Final Version) FA8051-15-P-0010
Biological effects and hazards of radiation exposure
International Nuclear Information System (INIS)
Boas, J.F.; Solomon, S.B.
1990-01-01
Radiation induced carcinogenesis and mutagenesis form the main risk to health from exposure to low levels of radiation. This risk effects can be at least qualitatively understood by considering the effects of radiation on cell DNA. Whilst exposure to high levels of radiation results in a number of identifiable effects, exposure to low levels of radiation may result in effects which only manifest themselves after many years. Risk estimates for low levels of radiation have been derived on the basis of a number of assumptions. In the case of uranium mine workers a major hazard arises from the inhalation of radon daughters. Whilst the correlation between radon daughter exposure and lung cancer incidence is well established, the numerical value of the risk factor is the subject of controversy. ICRP 50 gives a value of 10 cases per 10 6 person-years at risk per WLM (range 5-15 x 10 -6 PYR -1 WLM -1 ). The effect of smoking on lung cancer incidence rates amongst miners is also controversial. Nevertheless, smoking by miners should be discouraged
Overview of radiation effects research in photonics
Webb, Robert C.; Cohn, Lewis M.; Taylor, Edward W.; Greenwell, Roger A.
1995-05-01
A brief overview of ongoing radiation effects research in photonics is presented focusing on integrated optic and acousto-optic components. A short summary of radiation-induced effects in electro-optic modulators, detector arrays, and other photonic technologies is presented along with extensive references. The coordinated radiation effects studies among researchers within the Tri-Service Organizations and international experimental teams are beginning to demonstrate consistent measurements of radiation-induced effects in photonic components and confirming earlier reported data. This paper will present an overview of these coordinated investigations and focus on key research being conducted with the AFMC Phillips Laboratory, Naval Research Laboratory, Defence Nuclear Agency, NATO Nuclear Effects Task Group, and the Tri-Service Photonics Coordinating Committee.
Computer modelling of radiation-induced bystander effect
International Nuclear Information System (INIS)
Khvostunov, Igor K.; Nikjoo, Hooshang
2002-01-01
Radiation-induced genomic instability and bystander effects are now well established consequences of exposure of living cells to ionising radiation. It has been observed that cells not directly hit by radiation tracks may still exhibit radiation effects. We present a quantitative modelling of the radiation-induced bystander effect based on a diffusion model of spreading the bystander signal. The model assumes the bystander factor to be a protein of low molecular weight, given out by the hit cell, diffusing in the medium and reacting with non-hit cells. The model calculations successfully predict the results of cell survival in an irradiated conditioned medium. The model predicts the shape of dose-effect relationship for cell survival and oncogenic transformation induced by broad-beam and micro-beam irradiation by alpha-particles. (author)
Irradiation of: MOS field effect structures effect of the radiation dose
International Nuclear Information System (INIS)
Leray, J.L.
1989-01-01
The radiation effects on the structure and the operation of a metal-oxide semiconductor (MOS) are studied. The phenomenology of the radiation damage is analyzed as a function of the accumulated radiation dose and the time. The chronology of the phenomena which takes place in the oxide and the radiation transient phases in MOS structures are discussed. The equivalence of different radiations on SiO2 and other semiconductors is analyzed. The models applied to the study of the radiation permanent effects are reviewed [fr
Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J H; Okkenhaug, Klaus; Vanhaesebroeck, Bart
2008-06-17
The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110alpha, p110beta, and p110delta) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110alpha and p110delta to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110gamma class IB PI3K lack SH2 domains and instead couple p110gamma to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110beta and cells derived from a p110beta-deficient mouse line, that p110beta is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110beta and p110gamma contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110beta but not p110gamma, p110beta mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110gamma in these cells reduced the contribution of p110beta to GPCR signaling. Taken together, these data show that p110beta and p110gamma can couple redundantly to the same GPCR agonists. p110beta, which shows a much broader tissue distribution than the leukocyte-restricted p110gamma, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110gamma expression is low or absent.
Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J. H.; Okkenhaug, Klaus; Vanhaesebroeck, Bart
2008-01-01
The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110α, p110β, and p110δ) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110α and p110δ to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110γ class IB PI3K lack SH2 domains and instead couple p110γ to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110β and cells derived from a p110β-deficient mouse line, that p110β is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110β and p110γ contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110β but not p110γ, p110β mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110γ in these cells reduced the contribution of p110β to GPCR signaling. Taken together, these data show that p110β and p110γ can couple redundantly to the same GPCR agonists. p110β, which shows a much broader tissue distribution than the leukocyte-restricted p110γ, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110γ expression is low or absent. PMID:18544649
Medical response to effects of ionising radiation
International Nuclear Information System (INIS)
Crosbie, W.A.; Gittus, J.H.
1989-01-01
The proceedings of a conference on 'Medical Response to Effects of Ionising Radiation' in 1989 in the form of nineteen papers published as a book. Topics discussed include radiation accidents at nuclear facilities, the medical management of radiation casualties, the responsibilities, plans and resources for coping with a nuclear accident and finally the long term effects of radiation, including leukaemia epidemiology studies. All papers were selected and indexed separately. (UK)
Modulation of modeled microgravity on radiation-induced bystander effects in Arabidopsis thaliana
Energy Technology Data Exchange (ETDEWEB)
Wang, Ting [Key Laboratory of Ion Beam Bio-engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences and Anhui Province, Hefei, Anhui 230031 (China); Sun, Qiao [Space Molecular Biological Lab, China Academy of Space Technology, Beijing 100086 (China); Xu, Wei; Li, Fanghua [Key Laboratory of Ion Beam Bio-engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences and Anhui Province, Hefei, Anhui 230031 (China); Li, Huasheng; Lu, Jinying [Space Molecular Biological Lab, China Academy of Space Technology, Beijing 100086 (China); Wu, Lijun; Wu, Yuejin [Key Laboratory of Ion Beam Bio-engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences and Anhui Province, Hefei, Anhui 230031 (China); Liu, Min [Space Molecular Biological Lab, China Academy of Space Technology, Beijing 100086 (China); Bian, Po [Key Laboratory of Ion Beam Bio-engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences and Anhui Province, Hefei, Anhui 230031 (China)
2015-03-15
Highlights: • The effects of microgravity on the radiation-induced bystander effects (RIBE) were definitely demonstrated. • The effects of microgravity on RIBE might be divergent for different biological events. • The microgravity mainly modified the generation or transport of bystander signals at early stage. - Abstract: Both space radiation and microgravity have been demonstrated to have inevitable impact on living organisms during space flights and should be considered as important factors for estimating the potential health risk for astronauts. Therefore, the question whether radiation effects could be modulated by microgravity is an important aspect in such risk evaluation. Space particles at low dose and fluence rate, directly affect only a fraction of cells in the whole organism, which implement radiation-induced bystander effects (RIBE) in cellular response to space radiation exposure. The fact that all of the RIBE experiments are carried out in a normal gravity condition bring forward the need for evidence regarding the effect of microgravity on RIBE. In the present study, a two-dimensional rotation clinostat was adopted to demonstrate RIBE in microgravity conditions, in which the RIBE was assayed using an experimental system of root-localized irradiation of Arabidopsis thaliana (A. thaliana) plants. The results showed that the modeled microgravity inhibited significantly the RIBE-mediated up-regulation of expression of the AtRAD54 and AtRAD51 genes, generation of reactive oxygen species (ROS) and transcriptional activation of multicopy P35S:GUS, but made no difference to the induction of homologous recombination by RIBE, showing divergent responses of RIBE to the microgravity conditions. The time course of interaction between the modeled microgravity and RIBE was further investigated, and the results showed that the microgravity mainly modulated the processes of the generation or translocation of the bystander signal(s) in roots.
Measuring space radiation shielding effectiveness
Directory of Open Access Journals (Sweden)
Bahadori Amir
2017-01-01
Full Text Available Passive radiation shielding is one strategy to mitigate the problem of space radiation exposure. While space vehicles are constructed largely of aluminum, polyethylene has been demonstrated to have superior shielding characteristics for both galactic cosmic rays and solar particle events due to the high hydrogen content. A method to calculate the shielding effectiveness of a material relative to reference material from Bragg peak measurements performed using energetic heavy charged particles is described. Using accelerated alpha particles at the National Aeronautics and Space Administration Space Radiation Laboratory at Brookhaven National Laboratory, the method is applied to sample tiles from the Heat Melt Compactor, which were created by melting material from a simulated astronaut waste stream, consisting of materials such as trash and unconsumed food. The shielding effectiveness calculated from measurements of the Heat Melt Compactor sample tiles is about 10% less than the shielding effectiveness of polyethylene. Shielding material produced from the astronaut waste stream in the form of Heat Melt Compactor tiles is therefore found to be an attractive solution for protection against space radiation.
Measuring space radiation shielding effectiveness
Bahadori, Amir; Semones, Edward; Ewert, Michael; Broyan, James; Walker, Steven
2017-09-01
Passive radiation shielding is one strategy to mitigate the problem of space radiation exposure. While space vehicles are constructed largely of aluminum, polyethylene has been demonstrated to have superior shielding characteristics for both galactic cosmic rays and solar particle events due to the high hydrogen content. A method to calculate the shielding effectiveness of a material relative to reference material from Bragg peak measurements performed using energetic heavy charged particles is described. Using accelerated alpha particles at the National Aeronautics and Space Administration Space Radiation Laboratory at Brookhaven National Laboratory, the method is applied to sample tiles from the Heat Melt Compactor, which were created by melting material from a simulated astronaut waste stream, consisting of materials such as trash and unconsumed food. The shielding effectiveness calculated from measurements of the Heat Melt Compactor sample tiles is about 10% less than the shielding effectiveness of polyethylene. Shielding material produced from the astronaut waste stream in the form of Heat Melt Compactor tiles is therefore found to be an attractive solution for protection against space radiation.
[Effects of radiation exposure on human body].
Kamiya, Kenji; Sasatani, Megumi
2012-03-01
There are two types of radiation health effect; acute disorder and late on-set disorder. Acute disorder is a deterministic effect that the symptoms appear by exposure above a threshold. Tissues and cells that compose the human body have different radiation sensitivity respectively, and the symptoms appear in order, from highly radiosensitive tissues. The clinical symptoms of acute disorder begin with a decrease in lymphocytes, and then the symptoms appear such as alopecia, skin erythema, hematopoietic damage, gastrointestinal damage, central nervous system damage with increasing radiation dose. Regarding the late on-set disorder, a predominant health effect is the cancer among the symptoms of such as cancer, non-cancer disease and genetic effect. Cancer and genetic effect are recognized as stochastic effects without the threshold. When radiation dose is equal to or more than 100 mSv, it is observed that the cancer risk by radiation exposure increases linearly with an increase in dose. On the other hand, the risk of developing cancer through low-dose radiation exposure, less 100 mSv, has not yet been clarified scientifically. Although uncertainty still remains regarding low level risk estimation, ICRP propound LNT model and conduct radiation protection in accordance with LNT model in the low-dose and low-dose rate radiation from a position of radiation protection. Meanwhile, the mechanism of radiation damage has been gradually clarified. The initial event of radiation-induced diseases is thought to be the damage to genome such as radiation-induced DNA double-strand breaks. Recently, it is clarified that our cells could recognize genome damage and induce the diverse cell response to maintain genome integrity. This phenomenon is called DNA damage response which induces the cell cycle arrest, DNA repair, apoptosis, cell senescence and so on. These responses act in the direction to maintain genome integrity against genome damage, however, the death of large number of
Long-term effects of radiation
International Nuclear Information System (INIS)
Smith, J.; Smith, T.
1981-01-01
It is pointed out that sources of long-term damage from radiation are two-fold. People who have been exposed to doses of radiation from initial early fallout but have recovered from the acute effects may still suffer long-term damage from their exposure. Those who have not been exposed to early fallout may be exposed to delayed fallout, the hazards from which are almost exclusively from ingesting strontium, caesium and carbon isotopes present in food; the damage caused is relatively unimportant compared with that caused by the brief doses from initial radiation and early fallout. A brief discussion is presented of the distribution of delayed long-lived isotope fallout, and an outline is sketched of late biological effects, such as malignant disease, cataracts, retarded development, infertility and genetic effects. (U.K.)
International Nuclear Information System (INIS)
Okamoto, Manabu; Ozeki, Satoru; Higuchi, Yoshinori; Tashiro, Hideo
1988-01-01
The effect of concurrent combined treatment with 22.5 Gy of radiation and 110 mg of bleomycin or 55 mg of peplomycin on oral carcinoma involving the mandible was examined histologically. In 14 of 18 patients who had mandibles resected after this combined treatment, bone invasion by carcinoma was observed histologically. According to Shimosato's classification of histological effects, 3 belonged to Grade III/IV, 4 to IIb, 3 to IIa and 4 to I. The formation of new bone that was considered to be reparable was observed in the marked effective patients. In 4 patients the Grade IIb, residual surviving cancer cells were observed in the mandible. Accordingly, excision was needed in the area of radiologic features of mandibular infiltration. But it is considered that although the excision scope for the patient who has received the preoperative treatment is the same as that for the patient who has not, it is advantageous for the former patient that a wider safety region is obtained. (author)
The health effects of low-dose ionizing radiation
International Nuclear Information System (INIS)
Dixit, A.N.; Dixit, Nishant
2012-01-01
It has been established by various researches, that high doses of ionizing radiation are harmful to health. There is substantial controversy regarding the effects of low doses of ionizing radiation despite the large amount of work carried out (both laboratory and epidemiological). Exposure to high levels of radiation can cause radiation injury, and these injuries can be relatively severe with sufficiently high radiation doses. Prolonged exposure to low levels of radiation may lead to cancer, although the nature of our response to very low radiation levels is not well known at this time. Many of our radiation safety regulations and procedures are designed to protect the health of those exposed to radiation occupationally or as members of the public. According to the linear no-threshold (LNT) hypothesis, any amount, however small, of radiation is potentially harmful, even down to zero levels. The threshold hypothesis, on the other hand, emphasizes that below a certain threshold level of radiation exposure, any deleterious effects are absent. At the same time, there are strong arguments, both experimental and epidemiological, which support the radiation hormesis (beneficial effects of low-level ionizing radiation). These effects cannot be anticipated by extrapolating from harmful effects noted at high doses. Evidence indicates an inverse relationship between chronic low-dose radiation levels and cancer incidence and/or mortality rates. Examples are drawn from: 1) state surveys for more than 200 million people in the United States; 2) state cancer hospitals for 200 million people in India; 3) 10,000 residents of Taipei who lived in cobalt-60 contaminated homes; 4) high-radiation areas of Ramsar, Iran; 5) 12 million person-years of exposed and carefully selected control nuclear workers; 6) almost 300,000 radon measurements of homes in the United States; and 7) non-smokers in high-radon areas of early Saxony, Germany. This evidence conforms to the hypothesis that
Calfee, R.D.; Little, E.E.; Pearl, C.A.; Hoffman, R.L.
2010-01-01
Solar ultraviolet radiation (UV) has received much attention as a factor that could play a role in amphibian population declines. UV can be hazardous to some amphibians, but the resultant effects depend on a variety of environmental and behavioral factors. In this study, the potential effects of UV on the Northwestern Salamander, Ambystoma gracile, from three lakes were assessed in the laboratory using a solar simulator. We measured the survival of embryos and the survival and growth of larvae exposed to four UV treatments in controlled laboratory studies, the UV absorbance of egg jelly, oviposition depths in the lakes, and UV absorbance in water samples from the three lakes. Hatching success of embryos decreased in the higher UV treatments as compared to the control treatments, and growth of surviving larvae was significantly reduced in the higher UVB irradiance treatments. The egg jelly exhibited a small peak of absorbance within the UVB range (290-320 nm). The magnitude of UV absorbance differed among egg jellies from the three lakes. Oviposition depths at the three sites averaged 1.10 m below the water surface. Approximately 66 of surface UVB radiation was attenuated at 10-cm depth in all three lakes. Results of this study indicate that larvae may be sensitive to UVB exposure under laboratory conditions; however, in field conditions the depths of egg deposition in the lakes, absorbance of UV radiation by the water column, and the potential for behavioral adjustments may mitigate severe effects of UV radiation. Copyright 2010 Society for the Study of Amphibians and Reptiles.
International Nuclear Information System (INIS)
Belyakov, O.V.; Folkard, M.; Prise, K.M.; Michael, B.D.; Mothersill, C.
2002-01-01
According to the target theory of radiation induced effects (Lea, 1946), which forms a central core of radiation biology, DNA damage occurs during or very shortly after irradiation of the nuclei in targeted cells and the potential for biological consequences can be expressed within one or two cell generations. A range of evidence has now emerged that challenges the classical effects resulting from targeted damage to DNA. These effects have also been termed non-(DNA)-targeted (Ward, 1999) and include radiation-induced bystander effects (Iyer and Lehnert, 2000a), genomic instability (Wright, 2000), adaptive response (Wolff, 1998), low dose hyper-radiosensitivity (HRS) (Joiner, et al., 2001), delayed reproductive death (Seymour, et al., 1986) and induction of genes by radiation (Hickman, et al., 1994). An essential feature of non-targeted effects is that they do not require a direct nuclear exposure by irradiation to be expressed and they are particularly significant at low doses. This new evidence suggests a new paradigm for radiation biology that challenges the universality of target theory. In this paper we will concentrate on the radiation-induced bystander effects because of its particular importance for radiation protection
International Nuclear Information System (INIS)
Groetz, K.A.; Brahm, R.; Al-Nawas, B.; Wagner, W.; Riesenbeck, D.; Willich, N.; Seegenschmiedt, M.H.
2001-01-01
Objectives: Since the first description of rapid destruction of dental hard tissues following head and neck radiotherapy 80 years ago, 'radiation caries' is an established clinical finding. The internationally accepted clinical evaluation score RTOG/EORTC however is lacking a classification of this frequent radiogenic alteration. Material and Methods: Medical records, data and images of radiation effects on the teeth of more than 1,500 patients, who underwent periradiotherapeutic care, were analyzed. Macroscopic alterations regarding the grade of late lesions of tooth crowns were used for a classification into 4 grades according to the RTOG/EORTC guidelines. Results: No early radiation effects were found by macroscopic inspection. In the first 90 days following radiotherapy 1/3 of the patients complained of reversible hypersensitivity, which may be related to a temporary hyperemia of the pulp. It was possible to classify radiation caries as a late radiation effect on a graded scale as known from RTOG/EORTC for other organ systems. This is a prerequisite for the integration of radiation caries into the international nomenclature of the RTOG/EORTC classification. Conclusions: The documentation of early radiation effects on dental hard tissues seems to be neglectable. On the other hand the documentation of late radiation effects has a high clinical impact. The identification of an initial lesion at the high-risk areas of the neck and incisal part of the tooth can lead to a successful therapy as a major prerequisite for orofacial rehabilitation. An internationally standardized documentation is a basis for the evaluation of the side effects of radiooncotic therapy as well as the effectiveness of protective and supportive procedures. (orig.) [de
Biologic effects and health hazards of microwave radiation
Energy Technology Data Exchange (ETDEWEB)
Czerski, P; Ostrowski, K; Shore, M L; Silverman, C., Suess, M.J.; Waldeskog, B
1974-01-01
Proceedings of an international symposium held in Warsaw, 15--18 Oct. 1973, sponsored by the World Health Organization, the U.S. Department of Health, Education and Welfare, and the Polish Scientific Council to the Minister of Health and Social Welfare are presented. It covered numerous aspects of exposure to microwave radiation. The papers more specifically relating to occupational exposure to microwaves deal with: measurement of microwave radiations, clinical manifestations, neurological findings, health status of microwave workers, blood protein disorders, effects of electromagnetic fields in densely populated areas, microwave cataract and concomitant pathology, retinal changes, assessment of lens translucency in microwave workers. A list of participants at the symposium and an author and subject index are appended.
Spontaneous and radiation induced cell death in HeLa S3 human carcinoma
International Nuclear Information System (INIS)
Zaric, B.; Milosavljevic, B.; Radojcic, M.
2001-01-01
Radiation biologists have classified radiation-induced cell death based on cell proliferative capacity to either mitotic or interphase death. Cytologists have revealed two morphologically and biochemically diverse forms of cell death, apoptosis and necrosis. While the knowledge of the former is already well exploited by radiologists, cell susceptibility to apoptosis and necrosis is still under investigation. We studied characteristics of spontaneous cell death, and dose dependence and time course of radiation-induced cell death of human uterine cervix epitheloid carcinoma HeLaS 3 in culture. Cells were irradiated with 2-40 Gy of γ-rays. The effect on growth, viability, morphology and genomic DNA structure were followed 24-72 h after irradiation. Cell viability was evaluated by trypan-blue exclusion assay and cell morphology by in situ DNA staining with propidium iodide. Cell genomic DNA fragmentation pattern was determined by electrophoresis on 2% agarose gels. At all cell densities 25-35% cells were PI positive and their DNA was fragmented to a high molecular size (≥20 kbp), but the internucleosomal ladder was not observed. A significant decrease in viability to 33% was observed 72 h post 40 Gy irradiation. It corresponded to 55% of PI positive cells. A smear of smaller DNA fragments (0.1-1 kbp), 24 h after 10-20 Gy irradiation was considered as proof that the dominant form of radiation-induced cell death was necrosis. It was concluded that the dominant form of radiation-induced cell death in HeLaS 3 population was necrosis and the radiation dose which caused 50% of cell death after 72 h (termed ND 50 ) was between 30-40 Gy. (author)
International Nuclear Information System (INIS)
Chi, Se-Hwan
2015-01-01
Changes in flexural strength and Weibull modulus due to specimen size were investigated for three nuclear graphite grades, IG-110, NBG-18, and PCEA, using four-point-1/3 point (4-1/3) loading with specimens of three different sizes: 3.18 (Thickness) × 6.35 (Width) × 50.8 (Length), 6.50 (T) × 12.0 (W) × 52.0 (L), 18.0 (T) × 16.0 (W) × 64 (L) (mm) (total: 210 specimens). Results showed some specimen size effects were grade dependent: While NBG-18 (a) showed rather significant specimen size effects (37% difference between the 3 T and 18 T), the differences in IG-110 and PCEA were 7.6–15%. The maximum differences in flexural strength due to specimen size were larger in the PCEA and NBG-18 having larger sized coke particles (medium grain size: >300 μm) than the IG-110 with super fine coke particle size (25 μm). The Weibull modulus showed a data population dependency, in that it decreased with increasing numbers of data used for modulus determination. A good correlation between the fracture surface roughness and the flexural strength was confirmed
Monte Carlo simulations for the space radiation superconducting shield project (SR2S).
Vuolo, M; Giraudo, M; Musenich, R; Calvelli, V; Ambroglini, F; Burger, W J; Battiston, R
2016-02-01
Astronauts on deep-space long-duration missions will be exposed for long time to galactic cosmic rays (GCR) and Solar Particle Events (SPE). The exposure to space radiation could lead to both acute and late effects in the crew members and well defined countermeasures do not exist nowadays. The simplest solution given by optimized passive shielding is not able to reduce the dose deposited by GCRs below the actual dose limits, therefore other solutions, such as active shielding employing superconducting magnetic fields, are under study. In the framework of the EU FP7 SR2S Project - Space Radiation Superconducting Shield--a toroidal magnetic system based on MgB2 superconductors has been analyzed through detailed Monte Carlo simulations using Geant4 interface GRAS. Spacecraft and magnets were modeled together with a simplified mechanical structure supporting the coils. Radiation transport through magnetic fields and materials was simulated for a deep-space mission scenario, considering for the first time the effect of secondary particles produced in the passage of space radiation through the active shielding and spacecraft structures. When modeling the structures supporting the active shielding systems and the habitat, the radiation protection efficiency of the magnetic field is severely decreasing compared to the one reported in previous studies, when only the magnetic field was modeled around the crew. This is due to the large production of secondary radiation taking place in the material surrounding the habitat. Copyright © 2016 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.
Late effects of radiation on immune system; a review
International Nuclear Information System (INIS)
Sado, T.
1979-01-01
Lymphocytes are divided into 2 major classes: T and B lymphocytes (or cells). T cells are responsible for cell-mediated immune response, and B cells for humoral immune response or antibody formation. The possible immunological complications that might develop as the late manifestation of radiation effects include: lymphoid neoplasms, immune complex diseases, auto-aggressive immune reactions, and other degenerative diseases of immunological nature. The development of lymphoid neoplasma following the exposure to radiation was extensively studied with mice. Radiation-induced immunological compications would not contribute significantly to the life-shortening of exposed individuals. The extensive health survey of adult A-bomb survivors revealed little evidence of immunological complications such as rheumatoid arthritis, kidney diseases, paraproteinemia, etc. The young healthy adults who had received thymic irradiation during infancy for the treatment of enlarged thymus manifested higher incidence of illness with abnormal immunological features. Immune complex diseases, particularly the inter-capillary glomerulosclerosis of kidneys, develop as a result of earlier exposure to high dose of radiation. (Yamashita, S.)
International Nuclear Information System (INIS)
Georgieva, R.
2006-01-01
Full text: There are two major arms of radiation science in which Bystander effects (ByEff) could be of practical importance: radiotherapy and risk assessment. Basic biological principles, including dose-response relationships that have become dogma in the context of targeted effects of IR must now be reconsidered. The direct effects of radiation and the bystander components had to be reinvestigated to show the difference between them. It may be necessary to introduce a factor for ByEff's when calculating dose to both normal tissues and tumor. Presumably the relative effects on normal or tumor tissues could be different and that difference may not be always predictable. In relation to radiation protection, the existence of RIByEff's raises important questions for the way radiation dose is measured and modeled. The biological effect of exposure to low-doses radiation is likely to vary between individuals and between organs in one the same individual. Further studies on non-targeted effects should contribute to the establishment of adequate environmental and occupational radiation protection standards. This lecture looks at the history, the current data and controversies that are now beginning to resolve the questions concerning the mechanisms underlying the induction and transmission of ByEff. Especially, effects on radiotherapy and radiation protection are discussed
48 CFR 249.110 - Settlement negotiation memorandum.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...
Ionizing radiation, radiation sources, radiation exposure, radiation effects. Pt. 2
International Nuclear Information System (INIS)
Schultz, E.
1985-01-01
Part 2 deals with radiation exposure due to artificial radiation sources. The article describes X-ray diagnosis complete with an analysis of major methods, nuclear-medical diagnosis, percutaneous radiation therapy, isotope therapy, radiation from industrial generation of nucler energy and other sources of ionizing radiation. In conclusion, the authors attempt to asses total dose, genetically significant dose and various hazards of total radiation exposure by means of a summation of all radiation impacts. (orig./WU) [de
Effects of radiation on aquatic organisms
International Nuclear Information System (INIS)
Kaur, Harbhajan; Lata, Poonam; Sharma, Ankush
2012-01-01
With the onset of nuclear age, nuclear fuel cycle products, nuclear medicine techniques, disposal of radio active wastes on land or in water, fall out of testing nuclear weapons has contributed large amount of radio nuclides to the water bodies. Radio nuclides can imbalance aquatic ecosystem resulting in danger to natural life. The biological effects of radiation on aquatic life are mortality, pathophysiological, reproductive, developmental and genetic changes. A broad review of the results obtained about the aquatic organisms related to different phyla indicates that the lower or less developed or more primitive organisms are more resistant than the higher or more advanced, developed and complex organisms to ionizing radiation. The algae, protozoa are more resistant than the insects, crustaceans, molluscs and fishes. The changes in sensitivity between different stages of development have also been noted. A review of the results of exposing salmonoid gametes, eggs, fingerlings and adults to X-rays supports the concepts that radio sensitivity decreases with age. This paper presents a selective review on effects of radiation and radio nuclides on the aquatic life. It include uses and sources of radiation, effective quantity of radiation, lethal and sub lethal effect, effects on survival, growth, reproduction, behaviour, metabolism, carcinogenicity and mutagenicity. (author)
Low-level radiation effects: a fact book
International Nuclear Information System (INIS)
Brill, A.B.; Adelstein, S.J.; Saenger, E.L.; Webster, E.W.
1982-01-01
Low Level Raidation Effects: A Fact Book, prepared by the Society of Nuclear Medicine Subcommittee on the Risks of Low-Level Ionizing Radiation, attempts to examine the health effects of small doses of radiation. For immediate questions, this work provides a well-organized brief summary of recent radiologic data from refereed scientific literature and from the publications of advisory groups such as the National Council of Radiation Protection and Measurement (NCRP), the International Commission on Radiological Protection (ICRP), the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR), and the National Academy of Sciences (NAS). Since it consists almost entirely of tables and graphs from the above-mentioned sources along with summary paragraphs, the Fact Book is very useful in the preparation of lectures. The book is divided into seven sections. Chapter One, Glossary, Units and Conversion Factors, is useful because nearly all data given in the rest of the book is in conventional units and should be converted to SI units for future technical audiences. Chapter 2, Radiobiology, covers the fundamental principles of the field. Chapter 3, Radiation Doses, can be used to help an audience appreciate the relative magnitudes of radiation exposures they may read about or encounter. Chapter 4, Late Somatic Effects of Low Doses of Ionizing Radiation, gives data concerning cancer induction and embryonic effects, and Chapter 5 provides data on genetic effects Chapter 6, Risks, Statistical Facts and Public Perception can be used to compare the risks of radiation exposure with more commonly encountered risks
Ionizing radiation effect on human reproduction
International Nuclear Information System (INIS)
Jirous, J.
1987-01-01
A review is presented of the existing knowledge on the adverse effects of ionizing radiation on human reproduction. Some interesting findings have been obtained by interapolating the results of studies in mouse embryos to humans, important knowledge has been obtained in studies involving the population of Hiroshima and Nagasaki. The review summarizes the knowledge in the following conclusions: (1) prior to the blastocyst stage, the mammalian embryo is insensitive to teratogenic and growth retarding radiation effects but is highly sensitive to the lethal radiation effect; (2) in the early organogenesis, the embryo is very sensitive to growth retarding, teratogenic and lethal radiation effects. It can, however, partly offset growth retardation in the post-natal period; (3) in the early fetal development stage, the fetus shows reduced sensitivity to teratogenic damage of many organs; sensitivity of the central nervous system and growth retardation remain which can only be compensated post-natally with difficulties; (4) in the late stage of pregnancy the fetus is not significantly deformed as a result of irradiation but permanent cellular depletion can result in various organs and tissues post-natally if radiation doses are high. (L.O.). 22 refs
Effect of lateral radiative losses on radiative shock propagation
Czech Academy of Sciences Publication Activity Database
Busquet, M.; Audit, E.; González, M.; Stehlé, C.; Thais, F.; Acef, O.; Bauduin, D.; Barroso, P.; Rus, Bedřich; Kozlová, Michaela; Polan, Jiří; Mocek, Tomáš
2007-01-01
Roč. 3, - (2007), s. 8-11 ISSN 1574-1818 EU Projects: European Commission(XE) 506350 - LASERLAB-EUROPE Institutional research plan: CEZ:AV0Z10100523 Keywords : radiative shocks * laboratory astrophysics Subject RIV: BH - Optics, Masers, Lasers
D-T radiation effects on TFTR diagnostics
International Nuclear Information System (INIS)
Ramsey, A.T.
1994-10-01
For a 50%-50% deuterium-tritium plasma, the neutron production is 80x higher and the total energy release is 200x higher than the same plasma composed only of deuterium. With this increase in radiation, diagnostics which see only negligible amounts of noise during DD operation may find themselves overwhelmed during DT. The neutrons are not only more numerous, but have 6x as much energy, which causes the calculated 2.4x increase in the gamma flux per neutron near TFTR. We report here the effects of this increased radiation on the TFTR diagnostic set. The most noticeable effects are luminescence and transmission losses in fiber optic signal cables. In addition, a plastic fiber near the torus became unusably opaque after a few DT discharges. Silicon detectors show signs of neutron interactions as well as gamma response, and microchannel electron multipliers show an increased background due to the gamma flux. Bolometers show n and γ heating, and the Thomson scattering intensifier gate spark gap was unreliable until the gas pressure was adjusted. All of these effects were anticipated, and in some cases shielding or compensation techniques were used. Compensation fibers work satisfactorily at these radiation levels, and the rapid fall-off of the radiation as one moves away from the machine makes relocation of fibers and other sensitive components very useful. Conventional shielding designs worked when streaming through signal penetrations was properly dealt with. In coming DT campaigns and the generation of new tokamaks, such problems will be more severe. JET anticipates higher dose levels per shot during DT; TPX has 1000 s pulses and ITER presents a particularly difficult challenge. We shall discuss the implications of our results for diagnostics on these machines
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL
7 CFR 29.110 - Method of sampling.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Method of sampling. 29.110 Section 29.110 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Regulations Inspectors, Samplers, and Weighers § 29.110 Method of sampling. In sampling tobacco...
Angevin, Eric; Isambert, Nicolas; Trillet-Lenoir, Véronique; You, Benoit; Alexandre, Jérôme; Zalcman, Gérard; Vielh, Philippe; Farace, Françoise; Valleix, Fanny; Podoll, Thomas; Kuramochi, Yu; Miyashita, Itaru; Hosono, Osamu; Dang, Nam H; Ohnuma, Kei; Yamada, Taketo; Kaneko, Yutaro; Morimoto, Chikao
2017-04-25
YS110 is a humanised IgG1 monoclonal antibody with high affinity to the CD26 antigen. YS110 demonstrated preclinical anti-tumour effects without significant side effects. This FIH study was designed to determine the maximal tolerated dose (MTD) and recommended phase 2 dose (RP2D) to assess the tolerance, pharmacokinetics (PK) and pharmacodynamics profiles of YS110 and preliminary efficacy. YS110 were initially administered intravenously once every 2 weeks (Q2W) for three doses and then, based on PK data, once every week (Q1W) for five doses in patients with CD26-expressing solid tumours. Thirty-three patients (22 mesothelioma) received a median of 3 (range 1-30) YS110 infusions across six dose levels (0.1-6 mg kg -1 ). MTD was not reached and two dose-limiting toxicities (infusion hypersensitivity reactions) led to the institution of a systemic premedication. Low-grade asthenia (30.3%), hypersensitivity (27.3%), nausea (15.2%), flushing (15.2%), chills (12.1%) and pyrexia (12.1%) were reported as ADRs. Pharmacokinetic parameters (AUC and C max ) increased in proportion with the dose. sCD26/DPPIV assays indicated CD26 modulation. Prolonged stable diseases were observed in 13 out of 26 evaluable patients. YS110 is well tolerated up to 6 mg kg -1 Q1W, which has been defined as the RP2D, with encouraging prolonged disease stabilisations observed in a number of patients with advanced/refractory mesothelioma.
Energy Technology Data Exchange (ETDEWEB)
Asano, M. (Radiation Effects Research Foundation, Hiroshima, Japan); Norman, J.E. Jr.; Kato, H.; Yagawa, K.
1978-01-01
The authors examined 155 autopsy cases of Hashimoto's thyroiditis in the Life Span Study sample including both A-bomb survivors and controls in Hiroshima and Nagasaki (1954 to 1974). Hashimoto's thyroiditis was classified into lymphoid, diffuse and fibrous types and the following results were obtained. No difference existed in the effects of A-bomb radiation in the incidence and ATB. The ratio of males to females did not reveal statistical significance, even though reversed ratio was noted in the high dose group. The variation of thyroid gland weight in T65 dose or by variant showed no significant pattern, even though the smallest average weight was found in the highest radiation exposure group. The complications in the patients with Hashimoto's thyroiditis were noted to have high prevalance of ovarian cancer and low prevalence of stomach cancer and total cancer. Only two patients with Hashimoto's thyroiditis were found to be complicated with thyroid carcinoma. Among collagen diseases, the prevalence of rheumatic fever and rheumatoid arthritis was high as complication. And the prevalence of combined diseases suggested that no late effect of A-bomb radiation existed.
Comparison of the dose-effect relationship for UV radiation and ionizing radiation
International Nuclear Information System (INIS)
Leenhouts, H.P.; Sijsma, M.J.; Chadwick, K.H.
1990-06-01
Ionizing radiation and ultraviolet radiation (UV) are both physical agents with mutagenic and carcinogenic properties. However, there are some basic differences in the fundamental mechanism of their interaction with biological material that may have consequences for risk assessment. In this paper the dose-effect relationships for gamma radiation and UV at cellular level will be used to demonstrate the different radio-biological effectiveness of both agents. The results will be discussed in the framework of a biophysical model, based on the assumption that DNA doublestranded lesions are crucial for the cytotoxic action. After exposure to ionizing radiation, the lesions are fixed immediately following irradiation, but after UV exposure the lethal lesions are recognized only in the next DNA synthesis phase. The combination of this concept with the mechanism of lesion induction and the possibility of repair, leads to different dose and time relationships for the radiation effects of both agents. The possible consequences for risk assessment at low levels will be discussed. (author). 9 refs.; 5 figs
Radiation effects in optoelectronic devices
International Nuclear Information System (INIS)
Barnes, C.E.; Wiczer, J.J.
1984-05-01
Purpose of this report is to provide not only a summary of radiation damage studies at Sandia National Laboratories, but also of those in the literature on the components of optoelectronic systems: light emitting diodes (LEDs), laser diodes, photodetectors, optical fibers, and optical isolators. This review of radiation damage in optoelectronic components is structured according to device type. In each section, a brief discussion of those device properties relevant to radiation effects is given
Radiation effects on cell membranes
International Nuclear Information System (INIS)
Koeteles, G.J.
1982-01-01
Experimental data are presented concerning the effects of relatively low doses of x radiation and low concentration of tritiated water (HTO) on various receptor functions - concanavalin A, cationized ferritin, poliovirus of plasma membranes of animal and human cells which point to early and temporary disturbances of the composite structures and functions of membranes. References are given to the manifold influence of radiation-induced membrane phenomenon on the development and regeneration of radiation injuries. (author)
Cancedda, S; Rohrer Bley, C; Aresu, L; Dacasto, M; Leone, V F; Pizzoni, S; Gracis, M; Marconato, L
2016-12-01
Prognosis for unresectable canine malignant melanoma (MM) is typically poor, and therapeutic approaches remain largely palliative. A bi-institutional trial was conducted to compare efficacy and safety of radiation therapy (RT) and RT with post-radiation temozolomide in dogs with chemotherapy-naïve, measurable MM. RT consisted of 5 × 6 Gy fractions over 2.5 weeks. Dogs whose owners wished to pursue chemotherapy received adjuvant oral temozolomide (60 mg m -2 for 5 days every 28 days). Fifteen dogs were treated with RT only (Group 1) and 12 dogs subsequently received temozolomide (Group 2). Overall response rate was similar between Group 1 (86.7%) and Group 2 (81.1%). Median time to progression (TTP) was significantly longer in Group 2 (205 days) compared to Group 1 (110 days; p = 0.046). Survival time was not significantly different between groups. Both treatments were well tolerated. Post-radiation temozolomide has a good safety profile, and may improve TTP in MM when compared to coarse fractionated RT. © 2014 John Wiley & Sons Ltd.
Adaptive response to ionizing radiation in bone marrow mouse cells (CFU-s) in vivo. Oxygen effect
Energy Technology Data Exchange (ETDEWEB)
Saenko, A.S.; Semina, O.V.; Semenets, T.N.; Smirnova, S.G.; Orlova, N.V. [Russian Academy of Medical Sciences, Kaluga Region (Russian Federation). Medical Radiological Research Centre
1997-03-01
An acute gamma-irradiation of mice in small doses of 0.003-0.05 Gy results in elevated radioresistance of bone marrow CFU-s to challenge dose of 1.5 Gy. Hypoxia during exposure to conditioning dose abolishes or strongly decreases AR in CFU-s of mice marrow. Ascorbic acid and menadione induce cross-adaptation of mouse bone marrow CFU-s to action of gamma-radiation. The increase radioresistance was observed during 4 days after orally administration of vitamins C and K in doses of 1 mg and 0.06 mg/animal, accordingly, AR in Lewis lung carcinoma cells did not be observed in two independent experiments. (authors)
Adaptive response to ionizing radiation in bone marrow mouse cells (CFU-s) in vivo. Oxygen effect
International Nuclear Information System (INIS)
Saenko, A.S.; Semina, O.V.; Semenets, T.N.; Smirnova, S.G.; Orlova, N.V.
1997-01-01
An acute gamma-irradiation of mice in small doses of 0.003-0.05 Gy results in elevated radioresistance of bone marrow CFU-s to challenge dose of 1.5 Gy. Hypoxia during exposure to conditioning dose abolishes or strongly decreases AR in CFU-s of mice marrow. Ascorbic acid and menadione induce cross-adaptation of mouse bone marrow CFU-s to action of gamma-radiation. The increase radioresistance was observed during 4 days after orally administration of vitamins C and K in doses of 1 mg and 0.06 mg/animal, accordingly, AR in Lewis lung carcinoma cells did not be observed in two independent experiments. (authors)
Biotropic Effect of Radiation Conditions on Orbital Cosmic Stations
Tsetlin, Vladimir; Ushakov, Igor; Gurieva, Tamar; Moisa, Svetlana; Zotin, Alexei; Lobanov, Alexei
On the orbit of pilot orbital stations the crews undergo to low doses of chronic irradiation of cosmic radiation. The studying of radiobiological effects in different living systems were carried out in the ship’s side (OC “MIR” and ICS) and model surface experiments (power dose 200 mGy/day, density of neutron flow 30 particles/sm2 sec). It was shown that ionized radiation effects on embryonal development of Japanese quail embryo, inducing morphological disturbances in 12% of embryos. Many years ontogenesis (more 15 years of life in OC “MIR”) of microbial association evoked replacement of dominant types of micromycetes and bacterium and increasing of colony-formed units (CFU) in four orders. In laboratory low doses of γ-radiation induced the increasing of flight strain biomass of Aspergillus niger that corresponds to a radiation hormezis and also the increasing of radio-sensitivity. Moreover, under γ-neutron radiation were marked some deviations in morphology of supporting cell and numerous head falls of Aspergillus niger. The irradiation of Protozoa by low doses led to that spontaneous motion activity of spirostoms (Spirostomum ambiguum Ehbg.) accommodated in water processing by mixed γ-neutron radiation decreased twice that testified the fact that the definite factor of γ-neutron radiation effect is the changing of water medium state. In dry seeds of the highest plants wetting in water of preliminary low doses α-and γ-irradiation cells gradually decreased. In hypomagnetic camera the opposite tendency was observed. It is established the phenomena of stimulating effect of low doses of continuous γ-radiation (source of radiation Co60, period of radiation 10 days, average daily power dose 1,5-2,0 mGy, summary dose 15 mGy) on mezenchim stem cells of mice bone brain - a radiation hormezis which revealed in the intensifying of proliferative activity and increasing of number of colony-formed units-F in bone brain in 1,5-4,5 times. Regenerative capacity of
International Nuclear Information System (INIS)
Itoh, Youko; Kurabe, Teruhisa; Ishiguchi, Tsuneo
2004-01-01
To reduce the side effects of radiotherapy, radioprotective effects of lycopene on villi and crypts in the small intestine of abdominally radiated mice (15 Gy) were examined with administration pre-, continuous and post-radiation. In the lycopene group, the ratio of the villus length to the crypt was significantly increased in comparison with the radiation only group at 2 days after radiation. At 7 days after radiation, the ratio of necrotic cells in crypt/total was significantly decreased and the ratio of necrotic cells in villus/total was significantly increased by lycopene administration, which indicated an acceleration of the recovery from the radiation injury with lycopene. Each lycopene administered group showed a significant radioprotective effect, with the pre-radiation administration inducing a smaller effect than that of continuous and post-radiation administration. Radiation induced apoptosis was also decreased by lycopene administration. It is concluded that pre-, continuous and post-radiation administration of lycopene protects against radiation injury of the small intestine and accelerate the recovery. (author)
33 CFR 110.25 - Salem Sound, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Salem Sound, Mass. 110.25 Section 110.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.25 Salem Sound, Mass. (a) Beverly Harbor, north of Salem...
33 CFR 110.238 - Apra Harbor, Guam.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. 110.238 Section 110.238 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.238 Apra Harbor, Guam. (a) The anchorage grounds (Datum: WGS...
2010-07-01
... DISABILITIES Disability Ratings The Digestive System § 4.110 Ulcers. Experience has shown that the term “peptic ulcer” is not sufficiently specific for rating purposes. Manifest differences in ulcers of the stomach... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Ulcers. 4.110 Section 4...
Effective dose: a radiation protection quantity
Menzel, H G
2012-01-01
Modern radiation protection is based on the principles of justification, limitation, and optimisation. Assessment of radiation risks for individuals or groups of individuals is, however, not a primary objective of radiological protection. The implementation of the principles of limitation and optimisation requires an appropriate quantification of radiation exposure. The International Commission on Radiological Protection (ICRP) has introduced effective dose as the principal radiological protection quantity to be used for setting and controlling dose limits for stochastic effects in the regulatory context, and for the practical implementation of the optimisation principle. Effective dose is the tissue weighted sum of radiation weighted organ and tissue doses of a reference person from exposure to external irradiations and internal emitters. The specific normalised values of tissue weighting factors are defined by ICRP for individual tissues, and used as an approximate age- and sex-averaged representation of th...
Effects of ionizing radiation on life
International Nuclear Information System (INIS)
Rausch, L.
1982-01-01
Radiobiology in the last years was able to find detailed explanations for the effects of ionizing radiation on living organisms. But it is still impossible to make exact statements concerning the damages by radiation. Even now, science has to content itself with probability data. Moreover no typical damages of ionizing radiation can be identified. Therefore, the risks of ionizing radiation can only be determined by comparison with the spontaneous rate of cancerous or genetic defects. The article describes the interaction of high-energy radiation with the molecules of the organism and their consequences for radiation protection. (orig.)
24 CFR 110.15 - Location of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Location of posters. 110.15 Section 110.15 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF... HOUSING POSTER Requirements for Display of Posters § 110.15 Location of posters. All fair housing posters...
12 CFR 411.110 - Certification and disclosure.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification and disclosure. 411.110 Section 411.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.110 Certification and disclosure. (a) Each person shall file a certification, and a disclosure...
7 CFR 3565.110 - Insolvency of lender.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Insolvency of lender. 3565.110 Section 3565.110... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Lender Requirements § 3565.110 Insolvency of lender. The... determination of insolvency by the lender. If the lender fails to transfer a loan when required, the guarantee...
Directory of Open Access Journals (Sweden)
Bing Mao
Full Text Available Enhanced ultraviolet radiation (UV and elevated tropospheric ozone (O3 may individually cause reductions in the growth and productivity of important agricultural crops. However, research regarding their combined effects on important agricultural crops is still scarce, especially on changes in secondary metabolites and endogenous hormones, which are important protective substances and signal components that control plant responses to environment stresses. In this study, using an experimental setup of open top chambers, we monitored the responses of seed yield per plant, leaf secondary metabolites and leaf endogenous hormones under the stress of elevated O3 and enhanced UV radiation individually, as well as their combined stress. The results indicated that elevated O3 (110 ± 10 nmol mol-1 for 8 hours per day and enhanced UV radiation (1.73 kJ h-1 m-2 significantly decreased seed yield per plant. Concentrations of rutin, queretin and total flavonoids were significantly increased under the elevated O3 treatment or the enhanced UV radiation treatment or the combination treatment at flowering and podding stages, and concentrations of rutin, queretin and total flavonoids showed significant correlations with seed yield per plant. Concentrations of ABA and IAA decreased under the three treatments. There was a significant positive correlation between the ABA concentration and seed yield and a negative correlation between the IAA concentration and seed yield. We concluded that the combined stress of elevated O3 and UV radiation significantly decreased seed yield per plant. Yield reduction was associated with changes in the concentrations of flavonoids, ABA and IAA in soybean leaves. The effects of the combined O3 and UV stress were always greater than those of the individual stresses alone.
Combined genetic effects of chemicals and radiation
International Nuclear Information System (INIS)
Kada, T.; Inoue, T.; Yokoiyama, A.; Russell, L.B.
1979-01-01
The interactions of chemicals and radiation are complex, and there may exist other unexpected patterns. The photodynamic induction of mutation by fluorescein dyes, and the radiosensitization with iodine compounds are classified as the interactions of chemicals and radiation outside cells. On the other hand, the antimutagenic effects of cobaltous chloride is concerned with the events taking place in the cells that had already been exposed to mutagenic agents. It is likely that the action of mutagenic agents is not direct, and that cellular functions, such as mutators or repair systems, are involved in the mutagenesis initiated by the agents. Such cellular functions can be affected by a second agent. In sexually reproducing organisms, two agents can also act on separate cells (male and female germ cells) which subsequently fuse. In mice, the experiments combining the radiation applied to one sex with the chemicals given to the other sex are only in early stages. Males were irradiated with X-ray (spermatozoa and spermatids sampled) and females (mature oocytes) were treated with caffeine. When the endpoint was dominant lethal, the level of X-ray effect induced in the male genome was independent of the caffeine treatment of the female. However, when the endpoint was sex-chromosome-loss, and a different strain of female was used, the caffeine potentiation was statistically significant at 5% level. (Yamashita, S.)
Radiation protection in the age of accountability - measuring our effectiveness
International Nuclear Information System (INIS)
Hutchinson, D.E.
1993-01-01
Effectiveness and accountability were catch-words of the 1980s for public and private enterprises. This mood has persisted into the current decade and radiation protection authorities have not escaped the organisational microscope. But whereas simple models and measures of effectiveness can be applied to most private companies and government agencies, organisations in the regulatory and preventative health areas cannot be assessed by the same criteria. These organisations are fundamentally different because their primary objective is one of minimisation. This paper looks at options for measuring and reporting the effectiveness of radiation protection organisations. Some performance indicators are proposed and evaluated. The intention is not, however, to present a 'solution' to this apparently vexing problem. Indeed, the answer may be that there is none. 11 refs., 4 figs
Ferreira-Junior, J B; Vieira, C A; Soares, S R S; Guedes, R; Rocha Junior, V A; Simoes, H G; Brown, L E; Bottaro, M
2014-12-01
It has been demonstrated that body cooling may decrease neuromuscular performance. However, the effect of a single session of whole body cryotherapy (-110°C) on neuromuscular performance has not been well documented. Thus, the aim of this study was to evaluate the effects of a single exposure of WBC on elbow flexor neuromuscular performance. Thirteen physically active, healthy young men (age=27.9±4.2 years, mass=79.4±9.7 kg, height=176.7±5.2 cm) were randomly exposed to 2 different experimental conditions separated by a minimum of 72 h: 1) whole body cryotherapy- 3 min at -110°C; 2) control- 3 min at 21°C. All subjects were tested for maximal isokinetic elbow flexion at 60°.s(-1) 30 min before and 10 min after each condition. There were no significant differences in peak torque, average power, total work or muscle activity between conditions. Peak torque was lower at post-test compared to pre-test in both conditions (F=6.58, p=0.025). However, there were no differences between pre-test and post-test for any other variables. These results indicate that strength specialists, athletic trainers and physical therapists might utilize whole body cryotherapy before training or rehabilitation without compromising neuromuscular performance of the elbow flexors. © Georg Thieme Verlag KG Stuttgart · New York.
Radiation effects of high and low doses
International Nuclear Information System (INIS)
El-Naggar, A.M.
1998-01-01
The extensive proliferation of the uses and applications of atomic and nuclear energy resulted in possible repercussions on human health. The prominent features of the health hazards that may be incurred after exposure to high and low radiation doses are discussed. The physical and biological factors involved in the sequential development of radiation health effects and the different cellular responses to radiation injury are considered. The main criteria and features of radiation effects of high and low doses are comprehensively outlined
Fine features of parametric X-ray radiation by relativistic electrons and ions
Directory of Open Access Journals (Sweden)
K.B. Korotchenko
2017-11-01
Full Text Available In present work within the frame of dynamic theory for parametric X-ray radiation in two-beam approximation we have presented detailed studies on parametric radiation emitted by relativistic both electrons and ions at channeling in crystals that is highly requested at planned experiments. The analysis done has shown that the intensity of radiation at relativistic electron channeling in Si (110 with respect to the conventional parametric radiation intensity has up to 5% uncertainty, while the error of approximate formulas for calculating parametric X-ray radiation maxima does not exceed 1.2%. We have demonstrated that simple expressions for the Fourier components of Si crystal susceptibility χ0 and χgσ could be reduced, as well as the temperature dependence for radiation maxima in Si crystal (diffraction plane (110 within Debye model. Moreover, for any types of channeled ions it is shown that the parametric X-ray radiation intensity is proportional to z2−b(Z,z/z with the function b(Z,z depending on the screening parameter and the ion charge number z=Z−Ze.
Electrical properties of NiAs-type MnTe films with preferred crystallographic plane of (110)
Energy Technology Data Exchange (ETDEWEB)
Yang, L.; Wang, Z. H., E-mail: zhwang@imr.ac.cn; Zhang, Z. D. [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China)
2016-01-28
NiAs-type manganese telluride (MnTe) films with preferred crystallographic plane of (110) were prepared on Si/SiO{sub 2} substrates by pulsed laser deposition. X-ray diffraction (XRD) of the films was studied at different temperatures. The XRD peak of MnTe (110) films shifts to higher angle with decreasing temperature, showing the decrease of the lattice parameter. Resistivity of the films was studied in the temperature range of 2–350 K. The bump between 150 and 250 K was observed in the films, which may be related to the special s-d and p-d overlaps induced by the compressed lattice. The magnon drag effect near its Néel temperature T{sub N} and enlarged magnetic-elastic coupling below 100 K were observed and analyzed in details.
Non-targeted bystander effects induced by ionizing radiation
International Nuclear Information System (INIS)
Morgan, William F.; Sowa, Marianne B.
2007-01-01
Radiation-induced bystander effects refer to those responses occurring in cells that were not subject to energy deposition events following ionizing radiation. These bystander cells may have been neighbors of irradiated cells, or physically separated but subject to soluble secreted signals from irradiated cells. Bystander effects have been observed in vitro and in vivo and for various radiation qualities. In tribute to an old friend and colleague, Anthony V. Carrano, who would have said 'well what are the critical questions that should be addressed, and so what?', we review the evidence for non-targeted radiation-induced bystander effects with emphasis on prevailing questions in this rapidly developing research field, and the potential significance of bystander effects in evaluating the detrimental health effects of radiation exposure
The shape memory alloy actuator controlled by the Sun’s radiation
Riad, Amine; Alhamany, Abdelilah; Benzohra, Mouna
2017-07-01
Shape memory alloys (SMAs) have many thermo-mechanical characteristics which can return to their original value once exposed to a specific temperature. These materials are able to change their mechanical features such as shape, displacement or frequency in response to stress or heating; this may be useful for actuators in many fields such as aircraft, robotics and microsystems. In order to know the effect of the Sun’s radiation on SMAs we have conducted a numerical study that simulates a SMA actuator.
Radiation effects in silicate glasses
International Nuclear Information System (INIS)
Bibler, N.E.; Howitt, D.G.
1988-01-01
The study of radiation effects in complex silicate glasses has received renewed attention because of their use in special applications such as high level nuclear waste immobilization and fiber optics. Radiation changes the properties of these glasses by altering their electronic and atomic configurations. These alterations or defects may cause dilatations or microscopic phase changes along with absorption centers that limit the optical application of the glasses. Atomic displacements induced in the already disordered structure of the glasses may affect their use where heavy irradiating particles such as alpha particles, alpha recoils, fission fragments, or accelerated ions are present. Large changes (up to 1%) in density may result. In some cases the radiation damage may be severe enough to affect the durability of the glass in aqueous solutions. In the paper, the authors review the literature concerning radiation effects on density, durability, stored energy, microstructure and optical properties of silicate glasses. Both simple glasses and complex glasses used for immobilization of nuclear waste are considered
46 CFR 7.110 - Mamala Bay, HI.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Mamala Bay, HI. 7.110 Section 7.110 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Hawaii § 7.110 Mamala Bay, HI. A line drawn from Barbers Point Light to Diamond Head Light. Pacific Coast ...
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Use of TIAs. 603.110 Section 603.110 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS General § 603.110 Use of TIAs. The ultimate goal for using a TIA is to broaden the technology base available to meet DOE mission...
Radiation loading effect proportional chamber on the performances
International Nuclear Information System (INIS)
Alekseev, T.D.; Kalinina, N.A.; Karpukhin, V.V.; Kruglov, V.V.; Khazins, D.M.
1980-01-01
The effect of a space charge which appears under the effect of radiation loading on counting characteristics of a proportional chamber, is experimentally investigated. Calculations are made which take into account the effect of a space charge of positive ions formed in the chamber. The investigations have been carried out on the test board which consists of a one-coordinate proportional chamber, a telescope of two scintillation counters and a collimated 90 Sr β-source. The proportional chamber has the 160x160 mm dimensions. The signal wires with the 50 μm diameter are located with the step of s=10 mm. High-voltage planes are coiled with a wire with the 100 μm diameter and a 2 mm step. The distance between high-voltage planes are 18 mm. The chamber is blown through with a gaseous mixture, its composition is 57% Ar+38% CH 4 +5% (OCH 3 ) 2 CH 2 . When carrying out measurements in wide ranges, the density of radiation loading and the amplifier threshold are changed. The experimental results show a considerable effect of radiation loading and the value of amplifier threshold on the value of a counting characteristic. This should be taken into account when estimating the performance of a proportional chamber according to board testing using radioactive sources, as conditions for investigations are usually different from those of a physical experiment on an accelerator
International Nuclear Information System (INIS)
Kardinal, I.
1998-01-01
The complementary techniques of HR-XPS and HREELS have been applied to two distinct problems. The first studies adsorption and dissociation of C 2 N 2 on Ni (110) at room temperature (RT) and at 90 K and its co-adsorption with CO. At RT C 2 N 2 dissociates and forms a c(2x2)-CN structure. The resulting CN is found to be bound in the grooves of the (110) surface yielding the lowest C-N vibrational energy yet observed. C 2 N 2 was found to dissociate even at 90 K however the resulting CN overlayer after warming to RT showed remarkable differences to that of the RT adsorption. As well as the in-groove species a number of adsorption sites on the ridges with a bond order higher have been identified. Preadsorbed CO is completely driven of the Ni (110) surface by co-adsorption of CN at RT. HREELS indicates that first CO is desorbed from the on-top-sites and then from the bridge-sites of the (110)-ridges involving a considerable increase of the HREELS cross section for the CO on the bridge-sites. Also the signal intensity of the coadsorbed CN is suppressed by the CO present on the surface. The second study investigated the adsorption of bithiophene (BiT) on clean Ni (110) and the S-modified c(2x2)-S-Ni (110) and p(4x1)-S-Ni (110). The latter provided a strongly structured substrate which forced the assembly of the adsorbed BiT-molecules. The high degree of order of this adsorbate/substrate system was obvious in both the HR-XPS results and the BREELS results with strong azimuthal anisotropy. This system was used to asses the ability to use the HREELS impact selection rules to determine molecular orientation of a reasonably complex adsorbate overlayer. (author)
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.110 Section 28... Manufacturing Bonded Warehouse Losses § 28.110 Losses. Where there has been a loss of distilled spirits while in... of subpart O of this part, with respect to losses of spirits after withdrawal without payment of tax...
International Nuclear Information System (INIS)
Myasnik, M.N.; Morozov, I.I.; Petin, V.G.
1980-01-01
The dependence of the photoreactivation effect in E coli Bsub(s-1) cells on LET and energy of sparsely ionizing radiation was studied. The photoreactivation was shown to be absent after densely ionizing radiation (α-particles of 239 Pu; fast neutron Esub(n) = 0.85 MeV) and after sparsely ionizing radiation with energies below 200 keV. In those cases where photoreactivation took place, the photoreactivable sector was found to increase with the voltage of the radiation. (author)
Radiation-hard ASICS for sLHC optical data transmission
International Nuclear Information System (INIS)
Gan, K.K.
2009-01-01
High-speed data transmission in a high radiation environment poses an immense challenge in the detector design. We investigate the feasibility of using optical links for the silicon trackers of the ATLAS experiment for the planned upgrade of the LHC. The planned upgrade with ten times higher collision rate will produce a similar increase in the radiation. One possibility for the optical transmission is to use VCSEL arrays operating at 850 nm to transmit optical signals while using PIN arrays to convert the optical signals into electrical signals. We have designed a prototype chip containing building blocks for future SLHC optical links using a 130 nm CMOS 8RF process. The chip contains four main blocks; a VCSEL driver optimized for operation at 640 Mb/s, a VCSEL driver optimized for 3.2 Gb/s, a PIN receiver with a clock/data recovery circuit for operation at 40, 160, and 320 Mb/s, and two clock multipliers designed to operate at 640 Mb/s. The clock multiplier is designed to produce the high speed clock to serialize the data for transmission. All circuitry was designed following test results and guidelines from CERN on radiation tolerant design for the process. We have irradiated the chips with 24 GeV protons at CERN. For the VDC, the duty cycle of the output signal and the current consumption of the LVDS receiver remained constant during the irradiation. However, we observed significant decreases in the current consumption of the VCSEL driver circuit and the output drive current. This indicated that the think oxide layout used in the VCSEL driver portion of the chip might not be as radiation-hard and the circuit had been redesigned to minimize this sensitivity. For the PIN receiver, we found that the radiation produced no significant degradation, including the single event upset rate. The upset rate decreased with larger PIN current and was higher for a chip coupled to a PIN diode as expected. For the clock multipliers, we observed that the clocks of some chips
2010-10-01
....C. 450m-1] does the term contract include compacts, funding agreements, and construction project... the term contract include compacts, funding agreements, and construction project agreements entered into under Title V? Yes, for the purposes of section 110 of the Act [25 U.S.C. 450m-1] the term...
Graphene Field Effect Transistor for Radiation Detection
Li, Mary J. (Inventor); Chen, Zhihong (Inventor)
2016-01-01
The present invention relates to a graphene field effect transistor-based radiation sensor for use in a variety of radiation detection applications, including manned spaceflight missions. The sensing mechanism of the radiation sensor is based on the high sensitivity of graphene in the local change of electric field that can result from the interaction of ionizing radiation with a gated undoped silicon absorber serving as the supporting substrate in the graphene field effect transistor. The radiation sensor has low power and high sensitivity, a flexible structure, and a wide temperature range, and can be used in a variety of applications, particularly in space missions for human exploration.
International Nuclear Information System (INIS)
Tawfik, Z.S.; Abushady, M.R.
1992-01-01
The radioprotective effect of garlic on four bacterial strains with different degrees of radiation sensitivities was investigated. The presence of garlic led to an increase in d-10 value of Ps. Aeruginosa, S. aureus and S. typhimurium by 160%, 50%, and 30% respectively. The protective efficiency of garlic against radiation was noticed to be proportional to its concentration in a given inoculum size. Garlic extract up to 180 micro liter per 10 8 inoculum size of B. cereus showed no protective effect. This fact was attributed to the existence of sulphur compounds in the given strain. Higher garlic concentrations appeared to affect the cloning efficiency of a given strain. 4fig., 2tab
Calfee, Robin D.; Little, Edward E.; Pearl, Christopher A.; Hoffman, Robert L.
2010-01-01
Solar ultraviolet radiation (UV) has received much attention as a factor that could play a role in amphibian population declines. UV can be hazardous to some amphibians, but the resultant effects depend on a variety of environmental and behavioral factors. In this study, the potential effects of UV on the Northwestern Salamander, Ambystoma gracile, from three lakes were assessed in the laboratory using a solar simulator. We measured the survival of embryos and the survival and growth of larvae exposed to four UV treatments in controlled laboratory studies, the UV absorbance of egg jelly, oviposition depths in the lakes, and UV absorbance in water samples from the three lakes. Hatching success of embryos decreased in the higher UV treatments as compared to the control treatments, and growth of surviving larvae was significantly reduced in the higher UVB irradiance treatments. The egg jelly exhibited a small peak of absorbance within the UVB range (290–320 nm). The magnitude of UV absorbance differed among egg jellies from the three lakes. Oviposition depths at the three sites averaged 1.10 m below the water surface. Approximately 66% of surface UVB radiation was attenuated at 10-cm depth in all three lakes. Results of this study indicate that larvae may be sensitive to UVB exposure under laboratory conditions; however, in field conditions the depths of egg deposition in the lakes, absorbance of UV radiation by the water column, and the potential for behavioral adjustments may mitigate severe effects of UV radiation.
International Nuclear Information System (INIS)
Collings, E.W.
1986-01-01
An important cause of deterioration in superconducting magnets intended for high-energy physics and fusion-reactor applications is radiation damage. The present chapter deals chiefly with the effects of electron, proton, gamma and neutron irradiation on the properties of stabilized Ti-Nb-base composite superconductors. The authors examine the particle-accelerator environment, electron irradiation of Ti-Nb superconductor, proton irradiation of Ti-Nb superconductor and its stabilizer, and deuteron irradiation of Ti-Nb superconductor. A section discussing the fusion reactor environment in general is presented, and the two principal classes of fusion reactor based on the magnetic-confinement concept, namely the tokamak and the mirrormachine are examined. Also discussed is neutron irradiation of Cu/TiNb composite superconductors and critical current density of neutronirradiated Ti-Nb. Finally, radiation damage to stabilizer and insulating materials is described
Characterization of Rh films on Ta(110)
International Nuclear Information System (INIS)
Jiang, L.Q.; Ruckman, M.W.; Strongin, M.
1989-01-01
The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low energy electron diffraction and low energy ion scattering. From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh/Ta(110) appears to grow in the Stranski-Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at 1.2 and 2. 5 eV binding energy during the initial phase of thin film growth (0 3.7 ML). Photoemission data for CO covered surfaces show that CO dissociates on the Rh/Ta(110) surface for Rh coverages less than 2.5 ML and also show that the Rh clusters develop at least one site capable of molecular CO adsorption above 0.3 ML Rh coverage. 38 refs., 5 figs
Annual report of Radiation Effects Research Foundation, April 1, 1988 - March 31, 1989
International Nuclear Information System (INIS)
1990-01-01
This annual report summarizes the research activities of the Radiation Effects Research Foundation in the fiscal year 1988. Outcome of the work is presented, covering the two major workshops for 'immunology' and for 'radiation-induced carcinogenesis' which were held in Hiroshima on November 28-29, 1988, and on March 16-18, 1989, respectively. Study meeting of 'medical radiation research program' and Japan-the U.S. joint meeting of 'DS 86' are reported, as well as the other scientific lectures and campus study seminars. Included are research abstracts published by the Research Foundation staff. The bibliography of papers, published in scientific journals and presented in scientific meetings, is provided. Appendices give the details of the aforementioned workshops, the continuing research issues, and the personnel list of the Radiation Effects Research Foundation. (N.K.)
Awosan, K J; Ibrahim, Mto; Saidu, S A; Ma'aji, S M; Danfulani, M; Yunusa, E U; Ikhuenbor, D B; Ige, T A
2016-08-01
Use of ionizing radiation in medical imaging for diagnostic and interventional purposes has risen dramatically in recent years with a concomitant increase in exposure of patients and health workers to radiation hazards. To assess the knowledge of radiation hazards, radiation protection practices and clinical profile of health workers in UDUTH, Sokoto, Nigeria. A cross-sectional study was conducted among 110 Radiology, Radiotherapy and Dentistry staff selected by universal sampling technique. The study comprised of administration of standardized semi-structured pre-tested questionnaire (to obtain information on socio-demographic characteristics, knowledge of radiation hazards, and radiation protection practices of participants), clinical assessment (comprising of chest X-ray, abdominal ultrasound and laboratory investigation on hematological parameters), and evaluation of radiation exposure of participants (extracted from existing hospital records on their radiation exposure status). The participants were aged 20 to 65 years (mean = 34.04 ± 8.83), most of them were males (67.3%) and married (65.7%). Sixty five (59.1%) had good knowledge of radiation hazards, 58 (52.7%) had good knowledge of Personal Protective Devices (PPDs), less than a third, 30 (27.3%) consistently wore dosimeter, and very few (10.9% and below) consistently wore the various PPDs at work. The average annual radiation exposure over a 4 year period ranged from 0.0475mSv to 1.8725mSv. Only 1 (1.2%) of 86 participants had abnormal chest X-ray findings, 8 (9.4%) of 85 participants had abnormal abdominal ultrasound findings; while 17 (15.5%) and 11 (10.0%) of 110 participants had anemia and leucopenia respectively. This study demonstrated poor radiation protection practices despite good knowledge of radiation hazards among the participants, but radiation exposure and prevalence of abnormal clinical conditions were found to be low. Periodic in-service training and monitoring on radiation safety was
Effect of HALS on radiation discoloration of PE
International Nuclear Information System (INIS)
Wang Huiliang; Wang Chun; Chen Wenxiu
2001-01-01
The effects of hindered amine light stabilizers (HALS) on the radiation-induced discoloration of polyethylene (PE) are studied by measuring the yellowness index (YI) of PE. It is found that all the HALS used are effective in preventing PE from radiation-induced discoloration. The YI of PE added pentamethyl HALS (PMPM, PPMPM) is a little higher than that of PE added corresponding tetramethyl HALS (TMPM, PTMPM) when radiation dose is low than 100 kGy, but when the radiation dose is higher than 100 kGy, the YI of PE added pentamethyl HALS is lower. Pentamethyl HALS is more effective in preventing PE from radiation-induced discoloration when radiation dose is higher. It is also found that polymeric HALS is more effective in preventing PE from radiation-induced discoloration than corresponding monomeric HALS when radiation dose is higher than 200 kGy. The formation of alkyl free radical, carbonyl after irradiation is measured. It is found that the relative concentration of free radical formed in PE added TMPM is higher than that of PE added PMPM when radiation dose is relatively high. The carbonyl index of PE containing pentamethyl HALS is less than that of PE containing tetramethyl HALS when radiation is relatively low, but the results is contrary when radiation dose is relatively high. It is believed that HALS prevents PE from radiation-induced discoloration by scavenging free radicals formed in irradiated PE
Dutta, R; Kashyap, V K
2001-04-01
Genetic variation at four minisatellite loci D1S7, D4S139, D5S110 and D17S79 in three predominant population groups of eastern India, namely Brahmin, Kayastha and Garo, are reported in this study. The Brahmin and Kayastha are of Indo-Caucasoid origin while the Garo community represents the Indo-Mongoloid ethnic group. The methodology employed comprised generation of HaeIII-restricted fragments of isolated DNA, Southern blotting, and hybridization using chemiluminescent probes MS1, pH30, LH1 and V1 for the four loci. All four loci were highly polymorphic in the population groups. Heterozygosity values for the four loci ranged between 0.68 and 0.95. Neither departure from Hardy Weinberg expectations nor evidence of any association across alleles among the selected loci was observed. The gene differentiation value among the loci is moderate (GST = 0.027). A neighbour-joining tree constructed on the basis of the generated data shows very low genetic distance between the Brahmin and Kayastha communities in relation to the Garo. Our results based on genetic distance analysis are consistent with results of earlier studies based on serological markers and linguistic as well as morphological affiliations of these populations and their Indo-Caucasoid and Indo-Mongoloid origin. The minisatellite loci studied here were found to be not only useful in showing significant genetic variation between the populations but also to be suitable for human identity testing among eastern Indian populations.
Effects of UV radiation on phytoplankton
Smith, Raymond C.; Cullen, John J.
1995-07-01
et al., 1986; Worrest, 1986; NOAA, 1987; Smith, 1989; Smith and Baker, 1989; Voytek, 1990; Häder, 1993; Acevedo and Nolan, 1993; Holm-Hansen et al., 1993; Vincent and Roy, 1993; Biggs and Joyner, 1994; Williamson and Zagarese, 1994; Karentz, 1994; Cullen and Neale, 1993; Cullen and Neale, 1994]. As Hader et al. have summarized [UNEP, 1989; UNEP, 1991], "UV-B radiation in aquatic systems: 1) affects adaptive strategies (e.g., motility, orientation); 2) impairs important physiological functions (e.g., photosynthesis and enzymatic reactions); and 3) threatens marine organisms during their developmental stages (e.g., the young of finfish, shrimp larvae, crab larvae)". Possible consequences to aquatic systems include: reduced biomass production; changes in species composition and biodiversity; and alterations of aquatic ecosystems and biogeochemical cycles associated with the above changes. Within the past four years, our knowledge with respect to the environmental effects of ozone-related increased levels of UV-B has increased significantly, and numerous efforts have been directed toward process-oriented studies of UV responses in plants and animals. Consensus is building toward the view that current levels of UV play a major role as an ecological determinant, influencing both survival and distribution, and are thus deserving of increased study independent of ozone-related UV-B increases. This review outlines U.S. research subsequent to 1991 and emphasizes studies concerned with phytoplankton.
Radiation effects on relativistic electrons in strong external fields
International Nuclear Information System (INIS)
Iqbal, Khalid
2013-01-01
The effects of radiation of high energy electron beams are a major issue in almost all types of charged particle accelerators. The objective of this thesis is both the analytical and numerical study of radiation effects. Due to its many applications the study of the self force has become a very active and productive field of research. The main part of this thesis is devoted to the study of radiation effects in laser-based plasma accelerators. Analytical models predict the existence of radiation effects. The investigation of radiation reaction show that in laser-based plasma accelerators, the self force effects lower the energy gain and emittance for moderate energies electron beams and increase the relative energy spread. However, for relatively high energy electron beams, the self radiation and retardation (radiation effects of one electron on the other electron of the system) effects increase the transverse emittance of the beam. The energy gain decreases to even lower value and relative energy spread increases to even higher value due to high radiation losses. The second part of this thesis investigates with radiation reaction in focused laser beams. Radiation effects are very weak even for high energy electrons. The radiation-free acceleration and the simple practical setup make direct acceleration in a focused laser beam very attractive. The results presented in this thesis can be helpful for the optimization of future electron acceleration experiments, in particular in the case of laser-plasma accelerators.
Basic radiation effects in nuclear power electronics technology
International Nuclear Information System (INIS)
Gover, J.E.; Srour, J.R.
1985-05-01
An overview is presented of the effects of radiation in microelectronics technology. The approach taken throughout these notes is to review microscopic phenomena associated with radiation effects and to show how these lead to macroscopic effects in semiconductor devices and integrated circuits. Bipolar integrated circuits technology is reviewed in Appendix A. Appendix B gives present and future applications of radiation-tolerant microelectronics in nuclear power applications as well as the radiation tolerance requirements of these applications
Occupational Exposure to Diagnostic Radiology in Workers without Training in Radiation Safety
International Nuclear Information System (INIS)
Gaona, Enrique; Enriquez, Jesus G. Franco
2004-01-01
The physicians, technicians, nurses, and others involved in radiation areas constitute the largest group of workers occupationally exposed to man-made sources of radiation. Personnel radiation exposure must be monitored for safety and regulatory considerations, this assessment may need to be made over a period of one month or several months. The purpose of this study was to carry out an exploratory survey of occupational exposures associated with diagnostic radiology. The personnel dosimeters used in this study were thermoluminescent dosimeters (TLDs). The reported number of monitored workers was 110 of different departments of radiology of the Mexican Republic without education in radiation safety, included general fluoscopic/radiographic imaging, computed tomography and mammography procedures. Physicians and X-ray technologist in diagnostic radiology receive an average annual effective dose of 2.9 mSv with range from 0.18 to 5.64 mSv. The average level of occupational exposures is generally similar to the global average level of natural radiation exposure. The annual global per capita effective dose due to natural radiation sources is 2.4 mSv (UNSCEAR 2000 Report). There is not significant difference between average occupational exposures and natural radiation exposure for p < 0.05
Effects of gamma radiation on the OM431 human ocular melanoma cell line
International Nuclear Information System (INIS)
Logani, S.; Cho, A.S.; Su, L.D.; Withers, H.R.; McBride, W.H.; Hall, M.O.; Lee, D.A.; Milani, J.K.; Straatsma, B.R.
1995-01-01
In order to determine the dose responsiveness to radiation of ocular melanoma, we conducted an in vitro dose-response study on a monolayer cell culture using a clonogenic assay. The effects on cell survival were determined relative to unirradiated controls. A human epithelioid ocular melanoma cell line, OM431, was maintained in tissue culture and serial dilutions of viable cells were plated in flasks, allowed to settle and attach for 48 h, and subsequently irradiated with 1-10 Gy in single fractions. After 2 weeks, the number of reproducing clones (forming colonies with greater than 32 cells or five generations) were counted. The surviving fractions of cells were plotted on a cell survival curve using the linear quadratic model. The survival curve showed a large initial shoulder followed by an exponential decline in growth. Our data suggest that the OM431 ocular melanoma cell line responds to irradiation in a manner similar to other melanoma cell lines and is relatively radioresistent especially at lower doses. (author)
Gu, B.; Yang, P.; Kuo, C. P.; Mlawer, E. J.
2017-12-01
Evaluation of RRTMG and Fu-Liou RTM Performance against LBLRTM-DISORT Simulations and CERES Data in terms of Ice Clouds Radiative Effects Boyan Gu1, Ping Yang1, Chia-Pang Kuo1, Eli J. Mlawer2 Department of Atmospheric Sciences, Texas A&M University, College Station, TX 77843, USA Atmospheric and Environmental Research (AER), Lexington, MA 02421, USA Ice clouds play an important role in climate system, especially in the Earth's radiation balance and hydrological cycle. However, the representation of ice cloud radiative effects (CRE) remains significant uncertainty, because scattering properties of ice clouds are not well considered in general circulation models (GCM). We analyze the strengths and weakness of the Rapid Radiative Transfer Model for GCM Applications (RRTMG) and Fu-Liou Radiative Transfer Model (RTM) against rigorous LBLRTM-DISORT (a combination of Line-By-Line Radiative Transfer Model and Discrete Ordinate Radiative Transfer Model) calculations and CERES (Clouds and the Earth's Radiant Energy System) flux observations. In total, 6 US standard atmospheric profiles and 42 atmospheric profiles from Atmospheric and Environmental Research (AER) Company are used to evaluate the RRTMG and Fu-Liou RTM by LBLRTM-DISORT calculations from 0 to 3250 cm-1. Ice cloud radiative effect simulations with RRTMG and Fu-Liou RTM are initialized using the ice cloud properties from MODIS collection-6 products. Simulations of single layer ice cloud CRE by RRTMG and LBLRTM-DISORT show that RRTMG, neglecting scattering, overestimates the TOA flux by about 0-15 W/m2 depending on the cloud particle size and optical depth, and the most significant overestimation occurs when the particle effective radius is small (around 10 μm) and the cloud optical depth is intermediate (about 1-10). The overestimation reduces significantly when the similarity rule is applied to RRTMG. We combine ice cloud properties from MODIS Collection-6 and atmospheric profiles from the Modern
Rumen bacterial diversity of 80 to 110-day-old goats using 16S rRNA sequencing.
Directory of Open Access Journals (Sweden)
Xufeng Han
Full Text Available The ability of rumen microorganisms to use fibrous plant matter plays an important role in ruminant animals; however, little information about rumen colonization by microbial populations after weaning has been reported. In this study, high-throughput sequencing was used to investigate the establishment of this microbial population in 80 to 110-day-old goats. Illumina sequencing of goat rumen samples yielded 101,356,610 nucleotides that were assembled into 256,868 reads with an average read length of 394 nucleotides. Taxonomic analysis of metagenomic reads indicated that the predominant phyla were distinct at different growth stages. The phyla Firmicutes and Synergistetes were predominant in samples taken from 80 to 100-day-old goats, but Bacteroidetes and Firmicutes became the most abundant phyla in samples from 110-day-old animals. There was a remarkable variation in the microbial populations with age; Firmicutes and Synergistetes decreased after weaning, but Bacteroidetes and Proteobacteria increased from 80 to 110 day of age. These findings suggested that colonization of the rumen by microorganisms is related to their function in the rumen digestive system. These results give a better understanding of the role of rumen microbes and the establishment of the microbial population, which help to maintain the host's health and improve animal performance.
International Nuclear Information System (INIS)
1994-01-01
This leaflet in the NRPB At-a-Glance-Series briefly summarises the biological effects of radiation, harm and sensitivity to radiation, radiation protection principles, acceptability of risk and the control of doses to workers, the public and in medical procedures in the UK. (UK)
Biological effect of non-ionizing radiations on microorganisms
International Nuclear Information System (INIS)
Shimizu, Kikuo; Yamamoto, Takayoshi; Nakaoka, Yasuo
2000-01-01
We studied the effect of extremely low frequency magnetic fields (ELF-MF) of 60-Hz and 500 mT on the growth and the mutation frequency of the budding yeast S.cerevisiae and on the behavior of the ciliate Paramecium multimicronucleatum. The growth rate and mutation frequencies of several strains of S.cerevisiae (wild type and radiation sensitive mutants, rad or rev) were examined but no significant difference was observed. Moreover, the behavior of P.multimicronucleatum under the ELF-MF was examined. When exposed to a vertical field of 0.6 T, the cells accumulated at the upper end of the cuvette. (author)
Biological effect of non-ionizing radiations on microorganisms
Energy Technology Data Exchange (ETDEWEB)
Shimizu, Kikuo; Yamamoto, Takayoshi [Osaka Univ., Radioisotope Research Center, Suita, Osaka (Japan); Nakaoka, Yasuo [Osaka Univ., Graduate School of Engineering Science, Department of Biophysical Engineering, Toyonaka, Osaka (Japan)
2000-05-01
We studied the effect of extremely low frequency magnetic fields (ELF-MF) of 60-Hz and 500 mT on the growth and the mutation frequency of the budding yeast S.cerevisiae and on the behavior of the ciliate Paramecium multimicronucleatum. The growth rate and mutation frequencies of several strains of S.cerevisiae (wild type and radiation sensitive mutants, rad or rev) were examined but no significant difference was observed. Moreover, the behavior of P.multimicronucleatum under the ELF-MF was examined. When exposed to a vertical field of 0.6 T, the cells accumulated at the upper end of the cuvette. (author)
Hawking radiation from AdS black holes
International Nuclear Information System (INIS)
Hubeny, Veronika E; Rangamani, Mukund; Marolf, Donald
2010-01-01
We study Hartle-Hawking-like states of quantum field theories on asymptotically AdS black hole backgrounds, with particular regard to the phase structure of interacting theories. By a suitable analytic continuation we show that the equilibrium dynamics of field theories on large asymptotically AdS black holes can be related to the low-temperature states of the same field theory on the AdS soliton (or pure AdS) background. This allows us to gain insight into Hartle-Hawking-like states on large-radius Schwarzschild- or rotating-AdS black holes. Furthermore, we exploit the AdS/CFT correspondence to explore the physics of strongly coupled large N theories on asymptotically AdS black holes. In particular, we exhibit a plausibly complete set of phases for the M2-brane world-volume superconformal field theory on a BTZ black hole background. Our analysis partially resolves puzzles previously raised in connection with Hawking radiation on large AdS black holes.
Effects of radiation quality, intensity, and duration on photosynthesis and growth
Energy Technology Data Exchange (ETDEWEB)
Bugbee, B. [Utah State Univ., Logan, UT (United States)
1994-12-31
Differences in radiation quality from the six most common electric lamps have little effect on photosynthetic rate. Radiation quality primarily alters growth because of changes in branching or internode elongation, which change radiation absorption. Growth and yield in wheat appear to be insensitive to radiation quality. Growth and yield in soybeans can be slightly increased under high pressure sodium lamps compared to metal halide lamps, in spite of greatly reduced chlorophyll concentrations under HPS lamps. Daily integrated photosynthetic photon flux (mol m{sup -2} d{sup -1}) most directly determines leaf anatomy and growth. Photosynthetic photon flux levels of 800 {mu}mol m{sup -2} s{sup -1} are adequate to simulate field daily-integrated PPF levels for both short and long day plants, but plant canopies can benefit from much higher PPF levels.
Radiation effects in ice: New results
International Nuclear Information System (INIS)
Baragiola, R.A.; Fama, M.; Loeffler, M.J.; Raut, U.; Shi, J.
2008-01-01
Studies of radiation effects in ice are motivated by intrinsic interest and by applications in astronomy. Here we report on new and recent results on radiation effects induced by energetic ions in ice: amorphization of crystalline ice, compaction of microporous amorphous ice, electrostatic charging and dielectric breakdown and correlated structural/chemical changes in the irradiation of water-ammonia ices
International Nuclear Information System (INIS)
Kirk, J.; Cain, O.; Gray, W.M.
1977-01-01
Cumulative Radiation Effect (CRE) represents a scale of accumulative sub-tolerance radiation damage, with a unique value of the CRE describing a specific level of radiation effect. Computer calculations have been used to simplify the evaluation of problems associated with the applications of the CRE-system in radiotherapy. In a general appraisal of the applications of computers to the CRE-system, the various problems encountered in clinical radiotherapy have been categorised into those involving the evaluation of a CRE at a point in tissue and those involving the calculation of CRE distributions. As a general guide, the computer techniques adopted at the Glasgow Institute of Radiotherapeutics for the solution of CRE problems are presented, and consist basically of a package of three interactive programs for point CRE calculations and a Fortran program which calculates CRE distributions for iso-effect treatment planning. Many examples are given to demonstrate the applications of these programs, and special emphasis has been laid on the problem of treating a point in tissue with different doses per fraction on alternate treatment days. The wide range of possible clinical applications of the CRE-system has been outlined and described under the categories of routine clinical applications, retrospective and prospective surveys of patient treatment, and experimental and theoretical research. Some of these applications such as the results of surveys and studies of time optimisation of treatment schedules could have far-reaching consequences and lead to significant improvements in treatment and cure rates with the minimum damage to normal tissue. (author)
International Nuclear Information System (INIS)
Rannou, A.; Ameon, R.; Boisson, P.; Clairand, I.; Couasnon, O.; Franck, D.; Scanff, P.; Rehel, J.L.; Thevenet, M.
2005-01-01
This report presents the main work carried out by the Institute of radiation protection and nuclear safety (I.R.S.N.) in the year 2005 for the management of occupational radiological protection. it draws up an assessment for this same year of the occupational external exposures to ionizing radiation in France on the basis of passive dosimetry data transmitted to the I.R.S.N. by the approved dosimetry laboratories. (authors)
Energy Technology Data Exchange (ETDEWEB)
Wright, E.G. (Molecular and Cellular Pathology Laboratories, Division of Pathology and Neuroscience, Ninewells Hospital and Medical School, Dundee, Scotland (United Kingdom))
2008-12-15
The dogma that genetic alterations are restricted to directly irradiated cells has been challenged by observations in which effects of ionizing radiation, characteristically associated with the consequences of energy deposition in the cell nucleus, arise in non-irradiated cells. These, so called, untargeted effects are demonstrated in cells that are the descendants of irradiated cells (radiation-induced genomic instability) or in cells that have communicated with neighbouring irradiated cells (radiation-induced bystander effects). There are also reports of long-range signals in vivo, known as clastogenic factors, with the capacity to induce damage in unirradiated cells. Clastogenic factors may be related to the inflammatory responses that have been implicated in some of the pathological consequences of radiation exposures. The phenotypic expression of untargeted effects reflects a balance between the type of signals produced and the responses of cell populations to such signals, both of which may be significantly influenced by cell type and genotype. There is accumulating evidence that untargeted effects in vitro involve inter-cellular signalling, production of cytokines and free radical generation. These are also features of inflammatory responses in vivo that are known to have the potential for both bystander-mediated and persisting damage as well as for conferring a predisposition to malignancy. At present it is far from clear how untargeted effects contribute to overall cellular radiation responses and in vivo consequences but it is possible that the various untargeted effects may reflect inter-related aspects of a non-specific inflammatory-type response to radiation-induced stress and injury and be involved in a variety of the pathological consequences of radiation exposures. (orig.)
International Nuclear Information System (INIS)
Wright, E.G.
2008-01-01
The dogma that genetic alterations are restricted to directly irradiated cells has been challenged by observations in which effects of ionizing radiation, characteristically associated with the consequences of energy deposition in the cell nucleus, arise in non-irradiated cells. These, so called, untargeted effects are demonstrated in cells that are the descendants of irradiated cells (radiation-induced genomic instability) or in cells that have communicated with neighbouring irradiated cells (radiation-induced bystander effects). There are also reports of long-range signals in vivo, known as clastogenic factors, with the capacity to induce damage in unirradiated cells. Clastogenic factors may be related to the inflammatory responses that have been implicated in some of the pathological consequences of radiation exposures. The phenotypic expression of untargeted effects reflects a balance between the type of signals produced and the responses of cell populations to such signals, both of which may be significantly influenced by cell type and genotype. There is accumulating evidence that untargeted effects in vitro involve inter-cellular signalling, production of cytokines and free radical generation. These are also features of inflammatory responses in vivo that are known to have the potential for both bystander-mediated and persisting damage as well as for conferring a predisposition to malignancy. At present it is far from clear how untargeted effects contribute to overall cellular radiation responses and in vivo consequences but it is possible that the various untargeted effects may reflect inter-related aspects of a non-specific inflammatory-type response to radiation-induced stress and injury and be involved in a variety of the pathological consequences of radiation exposures. (orig.)
Radiation effects on custom MOS devices
International Nuclear Information System (INIS)
Harris, R.
1999-05-01
This Thesis consists of four chapters: The first is primarily for background information on the effects of radiation on MOS devices and the theory of wafer bonding; the second gives a full discussion of all practical work carried out for manufacture of Field Effect test Capacitors, the third discusses manufacture of vacuum insulator Field Effect Transistors (FET's) and the fourth discusses the testing of these devices. Using a thermally bonded field effect capacitor structure, a vacuum dielectric was studied for use in high radiation environments with a view to manufacturing a CMOS compatible, micro machined transistor. Results are given in the form of high frequency C-V curves before and after a 120 kGy(Si), 12 MRad(Si), dose from a Co 60 source showing a 1 Volt shift. The work is then extended to the design and manufacture of a micro machined, under-etch technique, Field Effect Transistor for use in high radiation areas. Results are shown for Threshold, Subthreshold and Transfer characteristics before and after irradiation up to a total dose of 100kGy or 10MRad. The conclusion from this work is that it should be possible to commercially manufacture practical vacuum dielectric field effect transistors which are radiation hard to at least 120 kGy(Si). (author)
Radiation Bystander Effects Mechanism
Directory of Open Access Journals (Sweden)
Shokohzaman Soleymanifard
2009-06-01
Full Text Available Introduction: Radiation Induced Bystander Effect (RIBE which cause radiation effects in non-irradiated cells, has challenged the principle according to which radiation traversal through the nucleus of a cell is necessary for producing biological responses. What is the mechanism of this phenomenon? To have a better understanding of this rather ambiguous concept substantial number of original and reviewed article were carefully examined. Results: Irradiated cells release molecules which can propagate in cell environment and/or transmit through gap junction intercellular communication. These molecules can reach to non-irradiated cells and transmit bystander signals. In many investigations, it has been confirmed that these molecules are growth factors, cytokines, nitric oxide and free radicals like reactive oxygen species (ROS. Transmission of by stander signal to neighboring cells persuades them to produce secondary growth factors which in their turn cause further cell injuries. Some investigators suggest, organelles other than nucleus (mitochondria and cell membrane are the origin of these signals. There is another opinion which suggests double strand breaks (DSB are not directly generated in bystander cells, rather they are due to smaller damage like single strand breaks which accumulate and end up to DSB. Although bystander mechanisms have not been exactly known, it can be confirmed that multiple mechanisms and various pathways are responsible for this effect. Cell type, radiation type, experimental conditions and end points identify the dominant mechanism. Conclusion: Molecules and pathways which are responsible for RIBE, also cause systemic responses to other non-irradiation stresses. So RIBE is a kind of systemic stress or innate immune responses, which are performed by cell microenvironment. Irradiated cells and their signals are components of microenvironment for creating bystander effects.
International Nuclear Information System (INIS)
Hhalel, A.M.
1990-01-01
This book intrduces a good knowledge in specifications of ionizing radiation biological effects and the proper protective measures againest harmful effectes. The book is devided in to five main sections, the first one introduces the hostorical bachground of the contributions of a number of scietists in the basic knolwledge of radiation and its biological effects. The second section deals with the physical and chemical principles of radiation the third one talks about radiation detection. While the fourth section talks (via seven chapter) about the effectes of ionizing radiation on living organisms molecules cells, tissues organs systems and the living organism the fifth section talks about the uses of radiation sources, the probability of radiation accidents, protective measures, international recommendations related to doses and safe use of ionizing radiation. (Abed Al-wali Al-ajlouni). 53 refs., 107 figs., 13 tabs
Radiation Effects on Spacecraft Structural Materials
International Nuclear Information System (INIS)
Wang, Jy-An J.; Ellis, Ronald J.; Hunter, Hamilton T.; Singleterry, Robert C. Jr.
2002-01-01
Research is being conducted to develop an integrated technology for the prediction of aging behavior for space structural materials during service. This research will utilize state-of-the-art radiation experimental apparatus and analysis, updated codes and databases, and integrated mechanical and radiation testing techniques to investigate the suitability of numerous current and potential spacecraft structural materials. Also included are the effects on structural materials in surface modules and planetary landing craft, with or without fission power supplies. Spacecraft structural materials would also be in hostile radiation environments on the surface of the moon and planets without appreciable atmospheres and moons around planets with large intense magnetic and radiation fields (such as the Jovian moons). The effects of extreme temperature cycles in such locations compounds the effects of radiation on structural materials. This paper describes the integrated methodology in detail and shows that it will provide a significant technological advance for designing advanced spacecraft. This methodology will also allow for the development of advanced spacecraft materials through the understanding of the underlying mechanisms of material degradation in the space radiation environment. Thus, this technology holds a promise for revolutionary advances in material damage prediction and protection of space structural components as, for example, in the development of guidelines for managing surveillance programs regarding the integrity of spacecraft components, and the safety of the aging spacecraft. (authors)
Protective effects of L-selenomethionine on space radiation induced changes in gene expression.
Stewart, J; Ko, Y-H; Kennedy, A R
2007-06-01
Ionizing radiation can produce adverse biological effects in astronauts during space travel. Of particular concern are the types of radiation from highly energetic, heavy, charged particles known as HZE particles. The aims of our studies are to characterize HZE particle radiation induced biological effects and evaluate the effects of L-selenomethionine (SeM) on these adverse biological effects. In this study, microarray technology was used to measure HZE radiation induced changes in gene expression, as well as to evaluate modulation of these changes by SeM. Human thyroid epithelial cells (HTori-3) were irradiated (1 GeV/n iron ions) in the presence or in the absence of 5 microM SeM. At 6 h post-irradiation, all cells were harvested for RNA isolation. Gene Chip U133Av2 from Affymetrix was used for the analysis of gene expression, and ANOVA and EASE were used for a determination of the genes and biological processes whose differential expression is statistically significant. Results of this microarray study indicate that exposure to small doses of radiation from HZE particles, 10 and 20 cGy from iron ions, induces statistically significant differential expression of 196 and 610 genes, respectively. In the presence of SeM, differential expression of 77 out of 196 genes (exposure to 10 cGy) and 336 out of 610 genes (exposure to 20 cGy) is abolished. In the presence or in the absence of SeM, radiation from HZE particles induces differential expression of genes whose products have roles in the induction of G1/S arrest during the mitotic cell cycle, as well as heat shock proteins. Some of the genes, whose expressions were affected by radiation from HZE particles and were unchanged in irradiated cells treated with SeM, have been shown to have altered expression levels in cancer cells. The conclusions of this report are that radiation from HZE particles can induce differential expression of many genes, some of which are known to play roles in the same processes that have
Effects of radiation; Effets des radiations
Energy Technology Data Exchange (ETDEWEB)
Masse, R [Office de Protection contre les Rayonnements Ionisants, 78 - le Vesinet (France)
2006-07-01
The medical consequences of a whole-body irradiation come from the destruction of cells and inflammatory reactions it provokes. The most sensitive organs are the tissues that actively split. The embryo is particularly sensitive, from 200 mSv for the effects on the brain development. The reproduction functions are reached for man from 2000 mSv, the ovary sensitivity is less, the oocytes do not split after the fetus life. For adult the bone marrow outrage leads to the disappearing of blood cells (4000 mSv). The doses from 6000 to 10000 mSv lead the failure of the digestive system and lung. for the upper doses every tissue is reached, particularly by the effects on cells of blood vessels. Important brain dysfunctions appear beyond 10000 mSv. As regards the delayed effects of overexposures the epidemiology brings to light sanitary consequences of the exposure of the population to the ionizing radiations and requires that all the possible factors associated for that purpose are considered. About hereditary effects, it appears that moderate acute radiation exposures of even a relatively large human population must have little impact, in spite of the rate of spontaneous congenital deformations is of the order of 6 %. For the induction of cancers, it is not observed excess for doses lower than 200 mSv for adults and 100 mSv for children (the populations studied are survival people of hiroshima and Nagasaki, patients treated by irradiation, uranium miners, children exposed to radioactive iodine after Chernobylsk accident). To simplify an expression of the risk has been fixed to 5% of induced cancer by Sv for population and 4% by Sv for workers, the different being explained by the demography and the sensitivity of the youngest age groups. As regards the low doses of radiations, a bundle of convergent epidemiological observations notices the absence of effects of the low doses rates. Biological mechanisms, notably of repair are approached, then certain accidents (Goiania
Effects of radiation; Effets des radiations
Energy Technology Data Exchange (ETDEWEB)
Masse, R. [Office de Protection contre les Rayonnements Ionisants, 78 - le Vesinet (France)
2006-07-01
The medical consequences of a whole-body irradiation come from the destruction of cells and inflammatory reactions it provokes. The most sensitive organs are the tissues that actively split. The embryo is particularly sensitive, from 200 mSv for the effects on the brain development. The reproduction functions are reached for man from 2000 mSv, the ovary sensitivity is less, the oocytes do not split after the fetus life. For adult the bone marrow outrage leads to the disappearing of blood cells (4000 mSv). The doses from 6000 to 10000 mSv lead the failure of the digestive system and lung. for the upper doses every tissue is reached, particularly by the effects on cells of blood vessels. Important brain dysfunctions appear beyond 10000 mSv. As regards the delayed effects of overexposures the epidemiology brings to light sanitary consequences of the exposure of the population to the ionizing radiations and requires that all the possible factors associated for that purpose are considered. About hereditary effects, it appears that moderate acute radiation exposures of even a relatively large human population must have little impact, in spite of the rate of spontaneous congenital deformations is of the order of 6 %. For the induction of cancers, it is not observed excess for doses lower than 200 mSv for adults and 100 mSv for children (the populations studied are survival people of hiroshima and Nagasaki, patients treated by irradiation, uranium miners, children exposed to radioactive iodine after Chernobylsk accident). To simplify an expression of the risk has been fixed to 5% of induced cancer by Sv for population and 4% by Sv for workers, the different being explained by the demography and the sensitivity of the youngest age groups. As regards the low doses of radiations, a bundle of convergent epidemiological observations notices the absence of effects of the low doses rates. Biological mechanisms, notably of repair are approached, then certain accidents (Goiania
Radiation effects in wild terrestrial vertebrates - the EPIC collection.
Sazykina, Tatiana; Kryshev, Ivan I
2006-01-01
The paper presents data on radiation effects in populations of wild vertebrate animals inhabiting contaminated terrestrial ecosystems. The data were extracted from the database "Radiation effects on biota", compiled within the framework of the EC Project EPIC (2000-2003). The data collection, based on publications in Russian, demonstrates radiation effects in the areas characterized with high levels of radionuclides (Kyshtym radioactive trace; "spots" of enhanced natural radioactivity in the Komi region of Russia; territories contaminated from the Chernobyl fallout). The data covers a wide range of exposures from acute accidental irradiation to lifetime exposures at relatively low dose rates. Radiation effects include mortality, changes in reproduction, decrease of health, ecological effects, cytogenetic effects, adaptation to radiation, and others. Peculiarities of radiation effects caused by different radionuclides are described, also the severity of effects as they appear in different organisms (e.g. mice, frogs, birds, etc.).
Radiation effects in wild terrestrial vertebrates - the EPIC collection
International Nuclear Information System (INIS)
Sazykina, Tatiana; Kryshev, Ivan I.
2006-01-01
The paper presents data on radiation effects in populations of wild vertebrate animals inhabiting contaminated terrestrial ecosystems. The data were extracted from the database 'Radiation effects on biota', compiled within the framework of the EC Project EPIC (2000-2003). The data collection, based on publications in Russian, demonstrates radiation effects in the areas characterized with high levels of radionuclides (Kyshtym radioactive trace; 'spots' of enhanced natural radioactivity in the Komi region of Russia; territories contaminated from the Chernobyl fallout). The data covers a wide range of exposures from acute accidental irradiation to lifetime exposures at relatively low dose rates. Radiation effects include mortality, changes in reproduction, decrease of health, ecological effects, cytogenetic effects, adaptation to radiation, and others. Peculiarities of radiation effects caused by different radionuclides are described, also the severity of effects as they appear in different organisms (e.g. mice, frogs, birds, etc.)
Radiative decays of the Upsilon(1S) meson
International Nuclear Information System (INIS)
Besson, D.Z.
1986-01-01
Using the CLEO detector at the Cornell Electron Storage Ring, the author is able to measure the QCD scaling parameter Λ/sub MS/ as well as the strong coupling constant α/sub s/ through a measurement of the direct photon energy spectrum resulting from decays of the Upsilon(1S) meson. The author finds fair agreement with previous work. In addition, the author sets limits on exclusive two-body radiative decays of the Upsilon(1S) meson and see no evidence for the type of such two-body decays which are observed in psi decays
Effects of tobacco-smoke on radiation-induced pneumonitis in rats
International Nuclear Information System (INIS)
Nilsson, K.; Henriksson, R.; Cai, Y.-Q.; Hellstroem, S.; Bjermer, L.; Hoernqvist Bylunds, S.
1992-01-01
To investigate the effect of exposure to tobacco smoke (TS) on the development of irradiation-induced pneumonitis in rats, five groups of animals were investigated including controls (C), tobacco smoke exposed (S), irradiated (RNS) and irradiated and tobacco smoke exposed (RS). An additional group (RS/NS) was exposed to tobacco before irradiation but not afterwards. Results indicate that smoking suppresses the radiation-induced inflammation but to a lesser degree affects the radiation-induced increase in membrane permeability as reflected by increased protein levels in BAL. Moreover, the marked effects on the numbers of mast cells and neutrophils in the RS group may indicate that these cells play an important role in the mechanism by which tobacco smoke modulates the effects of irradiation. When exposure to tobacco smoke was terminated immediately after irradiation (RS/NS), the inflammatory response was unaffected. (author)
Photoelectron spectrometry of manganese vapor between 12 and 110 eV
International Nuclear Information System (INIS)
Krause, M.O.; Carlson, T.A.; Fahlman, A.
1984-01-01
The important dynamic parameters, partial photoionization cross section sigma and angular distribution parameter β, have been determined for atomic Mn between 12 and 110 eV by electron spectroscopy with synchrotron radiation (ESSR). The single-electron photolines from the 3d and 4s subshells and the associated two-electron satellite lines were measured, and the resonance region of 3p→3d excitation around 50 eV was studied in detail. Absolute partial cross sections were derived. For the 3d-subshell properties, we find good agreement with the many-body perturbation-theory calculation (MBPT) by Garvin et al. over the entire energy range and with the random-phase-approximation results by Amusia et al. over the 3p resonance region. Available calculation (MBPT) underestimates the enhancement of sigma(4s) through the 3p resonance. Where overlap exists, the experimental data by Bruhn et al. and by Kobrin et al. agree well with our results. The work on Mn, taken in toto, provides a good overall understanding of the photoionization dynamics of the 3d transition series element Mn, which has a half-filled subshell, although a number of problems, e.g., two- and three-electron transitions and the low-energy region, remain to be further studied. A need for an accurate determination (5--10%) of the total photoabsorption cross section is indicated
Energy Technology Data Exchange (ETDEWEB)
Jung, J.S. [LG Electronics Corporation (Korea); Kauh, S.K. [Seoul National University, Seoul (Korea); Yoo, H.S. [Soongsil University, Seoul (Korea)
1998-11-01
Camouflage measures in military purpose utilizes the apparent temperature difference between the target and background, so it is essential to develop thermal analysis program for apparent temperature predictions and to apply some camouflage measures to real military targets for camouflage purpose. In this study, a thermal analysis program including conduction, convection and radiation is developed and the validity of radiation heat transfer terms is examined. The results show that longwave radiation along with solar radiation should be included in order to predict apparent temperature as well as physical temperature exactly. Longwave emissivity variation as an effective camouflage measures is applied to a real M2 tank. From the simulation results, it is found that an effective surface treatment, such as painting of a less emissive material or camouflage, clothing, may provide a temperature similarity or a spatial similarity, resulting in an effective camouflage. (author). 12 refs., 6 figs., 1 tab.
Laser radiation effect on radiation-induced defects in heavy ion tracks in dielectrics
International Nuclear Information System (INIS)
Egorov, A.N.; Zhiryakov, B.M.; Kushin, V.V.; Lyapidevskij, V.K.; Khokhlov, N.B.
1988-01-01
Possibility of laser radiation resonance effect on radiation-induced defects in heavy ion tracks in dielectric materials is investigated. Absorption spectra in infrared, visible and ultraviolet ranges for cellulose nitrate samples irradiated by 6 MeV/nucleon 58 Ni ions and reactor gamma radiation are measured. Absorption spectra for irradiated and reference samples are presented. Two absorption bands λ 1 =0.33 μm (E 1 =3.9 eV) and λ 2 =0.72 μm (E 2 =1.7 eV) are detected. Etching rate decrease in a track under laser radiation effect is noticed. 3 refs.; 1 fig
Ionizing radiations: effects and sources
International Nuclear Information System (INIS)
Vignes, S.; Nenot, J.C.
1978-01-01
Having first mentioned the effects of ionizing radiations in cancerogenisis, pre-natal, and genetic fields, the authors present the different sources of radiations and estimate their respective contributions to the total irradiation dose. Their paper makes reference to the main elements of a report issued by the United Nations Scientific Committee in 1977 [fr
Lethal and mutagenic effects of radiation and alkylating agents on two strains of mouse L5178Y cells
International Nuclear Information System (INIS)
Evans, H.H.; Horng, M.; Beer, J.Z.
1986-01-01
The two closely related strains of L5178Y (LY) mouse lymphoma cells, LY-R and LY-S, have been shown to differ in their sensitivity to UV and ionizing radiation. In the present work, the lethal and mutagenic effects of ethyl methanesulfonate (EMS), methyl nitrosourea (MNU) and UV radiation (254 nm) were compared in the two strains. Mutability at the Na + /K + -ATPase locus as well as the HGPRT locus was determined. The authors found strain LY-S to be more resistant than strain LY-R to the lethal effects of UV radiation. In contrast, strain LY-S was more sensitive to the cytotoxic effects of the two alkylating agents. In spite of these differences in sensitivity, the authors found strain LY-S to be less mutable than strain LY-R by all 3 agents at the HGPRT locus. At the Na + /K + -ATPase locus, strain LY-S was also less mutable than strain LY-R by equal concentrations of EMS and UV radiation and by equitoxic concentrations of MNU. However, the difference between the strains was much more pronounced at the HGPRT locus than at the Na + /K + -ATPase locus. The authors have suggested that the interaction of unrepaired lesions in strain LY-S tends to cause an excess of deletions and multilocus effects, which in turn result in a locus-dependent decrease in the recovery of viable LY-S mutant cells. (Auth.)
Study of biological effect of radiation
International Nuclear Information System (INIS)
Li Guisheng
1992-01-01
The some progress on the study of biological effect for protract exposure to low dose rate radiation is reported, and it is indicated that the potential risk of this exposure for the human health and the importance of the routine monitoring of radiation dose for various nuclear installations. The potential exposure to the low dose rate radiation would attract people's extra attention
Molecular and cellular effects of radiations
International Nuclear Information System (INIS)
Peak, M.J.; Peak, J.G.; Ito, A.; Roth, R.M.
1985-01-01
This program is concerned with the basic nature of the biological effects of mutagenic and carcinogenic environmental radiations, including those solar ultraviolet and visible radiations responsible for the most common form of human cancer: cancer of the skin. Concentrating on the damages to DNA caused by these radiations, the program attempts to delineate the basic mechanisms whereby such damage may occur. 14 refs
Thermal effects in radiation processing
International Nuclear Information System (INIS)
Zagorski, Z.P.
1985-01-01
The balance of ionizing radiation energy incident on an object being processed is discussed in terms of energy losses, influencing the amount really absorbed. To obtain the amount of heat produced, the absorbed energy is corrected for the change in internal energy of the system and for the heat effect of secondary reactions developing after the initiation. The temperature of a processed object results from the heat evolved and from the specific heat of the material comprising the object. The csub(p) of most materials is usually much lower than that of aqueous systems and therefore temperatures after irradiation are higher. The role of low specific heat in radiation processing at cryogenic conditions is stressed. Adiabatic conditions of accelerator irradiation are contrasted with the steady state thermal conditions prevailing in large gamma sources. Among specific questions discussed in the last part of the paper are: intermediate and final temperature of composite materials, measurement of real thermal effects in situ, neutralization of undesired warming experienced during radiation processing, processing at temperatures other than ambient and administration of very high doses of radiation. (author)
Thermal effects in radiation processing
International Nuclear Information System (INIS)
Zagorski, Z.P.
1984-01-01
The balance of ionizing radiation energy incident on an object being processed is discussed in terms of energy losses, influencing the amount really absorbed. To obtain the amount of heat produced, the absorbed energy is corrected for the change in internal energy of the system and for the heat effect of secondary reactions developing after the initiation. The temperature of a processed object results from the heat evolved and from the specific heat of the material comprising the object. The specific heat of most materials is usually much lower than that of aqueous systems and therefore temperatures after irradiation are higher. The role of low specific heat in radiation processing at cryogenic conditions is stressed. Adiabatic conditions of accelerator irradiation are contrasted with the steady state thermal conditions prevailing in large gamma sources. Among specific questions discussed in the last part of the paper are: intermediate and final temperature of composite materials, measurement of real thermal effects in situ, neutralization of undesired warming experienced during radiation processing, processing at temperatures other than ambient and administration of very high doses of radiation
Reconfigurable Patch Antenna Radiations Using Plasma Faraday Shield Effect
Barro , Oumar Alassane; Himdi , Mohamed; Lafond , Olivier
2016-01-01
International audience; This letter presents a new reconfigurable antenna associated with a plasma Faraday shield effect. The Faraday shield effect is realized by using a fluorescent lamp. A patch antenna operating at 2.45 GHz is placed inside the lamp. The performance of the reconfigurable system is observed in terms of S11, gain and radiation patterns by simulation and measurement. It is shown that by switching ON the fluorescent lamp, the gain of the antenna decreases and the antenna syste...
Health Effects of Non-Ionizing Radiation on Human
International Nuclear Information System (INIS)
Zubaidah-Alatas; Yanti Lusiyanti
2001-01-01
Increases of development and use of equipment that procedures non-ionizing radiant energy such as laser, radar, microwave ovens, power lines and hand phones, bring about public concern about the possible health effects owing to the non-ionizing radiation exposure. Non ionizing electromagnetic radiation compared to ionizing radiation, has longer wavelength, lower frequency, and lower photon energy in its interaction with body tissues. The term on non-ionizing radiation refers to the groups of electromagnetic radiations with energies less than about 10 eV corresponding to wavelengths in the ultraviolet, visible, infra red microwave and radiofrequency spectral regions. This paper describes the current state of knowledge about types of non-ionizing radiation and the health effects at molecular and cellular levels as well as its effects on human health. (author)
Grant, Eric J; Cologne, John B; Sharp, Gerald B; Eguchi, Hidetaka; Stevens, Richard G; Izumi, Shizue; Kim, Young-Min; Berrington de González, Amy; Ohishi, Waka; Nakachi, Kei
2018-02-01
Ionizing radiation and high levels of circulating estradiol are known breast cancer carcinogens. We investigated the risk of first primary postmenopausal breast cancer in relation to the combined effects of whole-body ionizing radiation exposure and prediagnostic levels of postmenopausal sex hormones, particularly bioavailable estradiol (bE 2 ). A nested case-control study of 57 incident breast cancer cases matched with 110 controls among atomic bomb survivors. Joint effects of breast radiation dose and circulating levels of sex hormones were assessed using binary regression and path analysis. Radiation exposure, higher levels of bE 2 , testosterone and progesterone, and established reproductive risk factors were positively associated with postmenopausal breast cancer risk. A test for mediation of the effect of radiation via bE 2 level suggested a small (14%) but significant mediation (p = 0.004). The estimated interaction between radiation and bE 2 was large but not significant (interaction = 3.86; p = 0.32). There is accumulating evidence that ionizing radiation not only damages DNA but also alters other organ systems. While caution is needed, some portion of the radiation risk of postmenopausal breast cancer appeared to be mediated through bE 2 levels, which may be evidence for cancer risks due to both direct and indirect effects of radiation.
DEFF Research Database (Denmark)
Pang, Xiaodan; Caballero Jambrina, Antonio; Dogadaev, Anton Konstantinovich
2012-01-01
In this paper, we demonstrate a photonic up-converted 25 Gbit/s fiber-wireless quadrature phase shift-keying (QPSK) data transmission link at the W-band (75–110 GHz). By launching two free-running lasers spaced at 87.5 GHz into a standard single-mode fiber (SSMF) at the central office, a W...
Effect of respiratory motion on internal radiation dosimetry
Energy Technology Data Exchange (ETDEWEB)
Xie, Tianwu [Division of Nuclear Medicine and Molecular Imaging, Geneva University Hospital, Geneva 4 CH-1211 (Switzerland); Zaidi, Habib, E-mail: habib.zaidi@hcuge.ch [Division of Nuclear Medicine and Molecular Imaging, Geneva University Hospital, Geneva 4 CH-1211 (Switzerland); Geneva Neuroscience Center, Geneva University, Geneva CH-1205 (Switzerland); Department of Nuclear Medicine and Molecular Imaging, University of Groningen, University Medical Center Groningen, Groningen 9700 RB (Netherlands)
2014-11-01
Purpose: Estimation of the radiation dose to internal organs is essential for the assessment of radiation risks and benefits to patients undergoing diagnostic and therapeutic nuclear medicine procedures including PET. Respiratory motion induces notable internal organ displacement, which influences the absorbed dose for external exposure to radiation. However, to their knowledge, the effect of respiratory motion on internal radiation dosimetry has never been reported before. Methods: Thirteen computational models representing the adult male at different respiratory phases corresponding to the normal respiratory cycle were generated from the 4D dynamic XCAT phantom. Monte Carlo calculations were performed using the MCNP transport code to estimate the specific absorbed fractions (SAFs) of monoenergetic photons/electrons, the S-values of common positron-emitting radionuclides (C-11, N-13, O-15, F-18, Cu-64, Ga-68, Rb-82, Y-86, and I-124), and the absorbed dose of {sup 18}F-fluorodeoxyglucose ({sup 18}F-FDG) in 28 target regions for both the static (average of dynamic frames) and dynamic phantoms. Results: The self-absorbed dose for most organs/tissues is only slightly influenced by respiratory motion. However, for the lung, the self-absorbed SAF is about 11.5% higher at the peak exhale phase than the peak inhale phase for photon energies above 50 keV. The cross-absorbed dose is obviously affected by respiratory motion for many combinations of source-target pairs. The cross-absorbed S-values for the heart contents irradiating the lung are about 7.5% higher in the peak exhale phase than the peak inhale phase for different positron-emitting radionuclides. For {sup 18}F-FDG, organ absorbed doses are less influenced by respiratory motion. Conclusions: Respiration-induced volume variations of the lungs and the repositioning of internal organs affect the self-absorbed dose of the lungs and cross-absorbed dose between organs in internal radiation dosimetry. The dynamic
Radiation Effects in M and NEMS
2016-03-31
electrical basis of operation of M&NEM structures? In particular, cumulative damage by non - ionizing energy loss can, in principle, alter the... Radiation Effects in M&NEMS Michael Alles, Kirill Bolotin, Alex Zettl, Brian Homeijer, Jim Davidson, Ronald Schrimpf, Robert Reed, Dan Fleetwood...understanding radiation effects on the relevant properties of the constituent materials and structures, particularly advanced 2D materials, and the
Effects of radiation on scintillating fiber performance
International Nuclear Information System (INIS)
Bauer, M.L.; Cohn, H.; Efremenko, Yu.; Gordeev, A.; Kamyshkov, Yu.; Onopienko, D.; Savin, S.; Shmakov, K.; Tarkovsky, E.; Young, K.G.; Carey, R.; Rothman, M.; Sulak, L.; Worstell, W.; Parr, H.
1992-01-01
Continued rapid improvements in formulations for scintillating fibers require the ability to parameterize and predict effects of radiation on detector performance. Experimental techniques necessary to obtain needed information and calculational procedures used in performing predications for hadron scintillating fiber calorimetry in the Superconducting Supercollider environment are described. The experimental techniques involve control of the testing environment, consideration of dose rate effects, and other factors. These calculations involve the behavior of particle showers in the detector, expected levels of radiation, and parameterization of the radiation effects. A summary of significant work is also presented
Effects of radiation on scintillating fiber performance
International Nuclear Information System (INIS)
Young, K.G.; Bauer, M.L.; Cohn, H.; Efremenko, Yu.; Gordeev, A.; Kamyshkov, Yu.; Onopienko, D.; Savin, S.; Shmakov, K.; Tarkovsky, E.; Carey, R.; Rothman, M.; Sulak, L.; Worstell, W.; Paar, H.
1993-01-01
Continued rapid improvements in formulations for scintillating fibers require the ability to parameterize and predict effects of radiation on detector performance. Experimental techniques necessary to obtain desired information and calculational procedures used in performing predictions for hadron scintillating fiber calorimetry in the Superconducting Supercollider environment are described. The experimental techniques involve control of the testing environment, consideration of dose rate effects, and other factors. The calculations involve the behavior of particle showers in the detector, expected levels of radiation, and parameterization of the radiation effects. A summary of significant work is also presented
Azevedo, Elaine Cristina; Orivaldo Chierice, Gilberto; Claro Neto, Salvador; Scheidegger Soboll, Daniel; Mauro Nascimento, Eduardo; Lepienski, Carlos Mauricio
2011-03-01
In this study, an adhesive of a polyurethane derivate from castor oil was irradiated with gamma radiation from a 60Co source, at doses from 0.2 to 25 kGy. This adhesive polyurethane is considered for use in hospital furniture because it does not liberate dangerous solvents. Hardness and elastic modulus were measured by instrumented indentation with a pyramidal Berkovich indenter, using loads from 0.08-40 mN with a nanoindenter XP. The instrumented indentation hardness was 110 MPa for an untreated sample, increasing to 124 MPa after irradiation with 25 kGy, at penetration depths of about 5 μm. The increases in elastic modulus induced by radiation were less pronounced. This polyurethane is naturally cross-linked and the relative modifications in the hardness are attributed to an additional cross-linking process induced by radiation. X-ray diffraction indicates a slight increase in crystallinity. The roughness measured by atomic force microscopy increases after gamma irradiation.
Effects of whole-body cryotherapy (-110 °C) on proprioception and indices of muscle damage.
Costello, J T; Algar, L A; Donnelly, A E
2012-04-01
The purpose of this study was to investigate the effects of whole-body cryotherapy (WBC) on proprioceptive function, muscle force recovery following eccentric muscle contractions and tympanic temperature (T(TY) ). Thirty-six subjects were randomly assigned to a group receiving two 3-min treatments of -110 ± 3 °C or 15 ± 3 °C. Knee joint position sense (JPS), maximal voluntary isometric contraction (MVIC) of the knee extensors, force proprioception and T(TY) were recorded before, immediately after the exposure and again 15 min later. A convenience sample of 18 subjects also underwent an eccentric exercise protocol on their contralateral left leg 24 h before exposure. MVIC (left knee), peak power output (PPO) during a repeated sprint on a cycle ergometer and muscles soreness were measured pre-, 24, 48 and 72h post-treatment. WBC reduced T(TY) , by 0.3 °C, when compared with the control group (P<0.001). However, JPS, MVIC or force proprioception was not affected. Similarly, WBC did not effect MVIC, PPO or muscle soreness following eccentric exercise. WBC, administered 24 h after eccentric exercise, is ineffective in alleviating muscle soreness or enhancing muscle force recovery. The results of this study also indicate no increased risk of proprioceptive-related injury following WBC. © 2011 John Wiley & Sons A/S.
Targeted and non-targeted effects of ionizing radiation
Directory of Open Access Journals (Sweden)
Omar Desouky
2015-04-01
Full Text Available For a long time it was generally accepted that effects of ionizing radiation such as cell death, chromosomal aberrations, DNA damage, mutagenesis, and carcinogenesis result from direct ionization of cell structures, particularly DNA, or from indirect damage through reactive oxygen species produced by radiolysis of water, and these biological effects were attributed to irreparable or misrepaired DNA damage in cells directly hit by radiation. Using linear non-threshold model (LNT, possible risks from exposure to low dose ionizing radiation (below 100 mSv are estimated by extrapolating from data obtained after exposure to higher doses of radiation. This model has been challenged by numerous observations, in which cells that were not directly traversed by the ionizing radiation exhibited responses similar to those of the directly irradiated cells. Therefore, it is nowadays accepted that the detrimental effects of ionizing radiation are not restricted only in the irradiated cells, but also to non-irradiated bystander or even distant cells manifesting various biological effects.
Radiation effects of ion beams on polymers
International Nuclear Information System (INIS)
Tagawa, Seiichi
1993-01-01
Recent progress in the radiation effects of ion beams on polymers are reviewed briefly. Our recent work on the radiation effects of ion beams on polystyrene thin films on silicon wafers and time resolved emission studies on polymers are described. (orig.)
The late biological effects of ionizing radiation
Energy Technology Data Exchange (ETDEWEB)
NONE
1978-06-15
Full text: The principal objective of the symposium was to review the current status of understanding of the late biological effects of ionizing radiation from external and internal sources. A second objective was to critically evaluate information obtained from epidemiological studies of human population groups as well as from animal experimentation in order to provide a solid scientific basis upon which problems of current concern, such as radiation protection standards and risk-benefit analysis, could be deliberated. Eighty-one papers were presented in 10 sessions which covered epidemiological studies of late effects in human populations exposed to internal and/or external ionizing radiation; quantitative and qualitative data from animal experimentation of late effects; methodological problems and modern approaches; factors influencing susceptibility or expression of late radiation injury; comparative evaluation of late effects induced by radiation and other environmental pollutants, and problems of risk assessment. In addition, there were two evening sessions for free discussion of problems of interpreting animal data, and of the epidemiological studies of occupationally exposed populations. Reports on atomic bomb survivors showed that these epidemiological studies are providing dependable data, such as dose-related excess infant mortality. The reports also revealed the need for consensus in the method employed in the interpretation of data. That was also the case with studies on occupationally exposed populations at Hanford plant, where disparate results were presented on radiation-induced neoplasia among radiation workers. These data are, however, considered not so significant in relative terms when compared to risks involved in other industries. It was recommended that national registry systems for the dosimetry and medical records of radiation workers be established and co-ordinated internationally in order to facilitate reliable epidemiological
Radiation hormesis and its potential to manage radiation injuries
International Nuclear Information System (INIS)
Bala, Madhu; Mathew, Lazar
2000-01-01
The term radiation hormesis explains stimulatory or beneficial effects of low dose radiation exposure, which cannot be predicted by extrapolation of detrimental or lethal effects of high dose radiation exposure. Although beneficial effects of low doses of radiation were observed soon after discovery of x-rays and radioactivity, studies remained inconclusive until recently, due to (i) inadequate statistical planning of experiments conducted in early part of the 20th century; and (ii) poor dose monitoring. Recently (1980s onwards), large scale, systematic epidemiological and experimental studies with a number of diverse systems have demonstrated existence of radiation hormesis beyond doubt. It is pointed out that the hormetic effects of radiation have not been successfully exploited so far for human benefits, primarily because underlying molecular mechanisms are poorly understood. It is argued that with more and more studies, it is becoming evident that radiation hormesis is not merely physiological adaptation, but a genetically regulated phenomenon and involves de novo synthesis of proteins. Role of these proteins in induction of radiation hormesis is the current area of research in a number of world-renowned laboratories. The first part of this review elucidates the shifts in paradigms on radiation effects in the 20th century and the later portion presents a brief on underlying molecular mechanisms of radiation hormesis and their implications towards management of radiation injuries. (author)
International Nuclear Information System (INIS)
Santos, Gustavo H.F.; Silva, Hianna A.M.F.; Melo, Mychely S.; Silva, Edvane B.
2013-01-01
Spondias luta L. (Anacardiaceae), popularly known as cajazeira, is a plant widespread in several regions of Brazil, famous for containing phenolic compounds, which are responsible for your characteristic astringent. Ionizing radiations have the ability to cross the material, ionizing atoms and molecules, causing changes in atoms and molecules important. It is known ionizing radiation promotes quantitative and qualitative changes in plant materials, increasing, decreasing or inactivating secondary substances. The objective of this work was to evaluate the effect of gamma radiation as a modifier of the activity of the phenolic compounds of the bark extract of S. luta L. Methods: For the dosage of phenol extracts (control, irradiated with 5 kGy, 10 kGy, 15 kGy and 20 kGy) were diluted in methanol to a final concentration of 200 mg / L. In test tubes were added 50 μL of extract plus 1 ml of distilled water and 500 μl of Folin (diluted 1:10). After 10 minutes in a dark chamber was added 2.5 ml of calcium carbonate to 20% and the content of the tube was homogenized. After 20 minutes was performed with a spectrophotometer at 735 nm. The assay was performed in triplicate and calculated from a standard curve solution of gallic acid and expressed in μEAG (GAE/mg extract). Results: The control extracts, irradiated to 5 kGy, 10 kGy, 15 kGy and 20 kGy, had, respectively, 6.25, 6.70, 6.25, 6.85, 6.45 μEAG/mg of extract. Conclusion: The results showed no significant change in the amount of phenolic compounds, showing that these compounds are radioresistant extract these doses. (author)
Radiation effects in the environment
Energy Technology Data Exchange (ETDEWEB)
Begay, F.; Rosen, L.; Petersen, D.F.; Mason, C.; Travis, B. [Los Alamos National Lab., NM (United States); Yazzie, A. [Navajo Nation, Window Rock, AZ (United States). Dept. of History; Isaac, M.C.P.; Seaborg, G.T. [Lawrence Berkeley National Lab., CA (United States); Leavitt, C.P. [Univ. of New Mexico, Albuquerque, NM (United States). Dept. of Physics and Astronomy
1999-04-01
Although the Navajo possess substantial resource wealth-coal, gas, uranium, water-this potential wealth has been translated into limited permanent economic or political power. In fact, wealth or potential for wealth has often made the Navajo the victims of more powerful interests greedy for the assets under limited Navajo control. The primary focus for this education workshop on the radiation effects in the environment is to provide a forum where scientists from the nuclear science and technology community can share their knowledge toward the advancement and diffusion of nuclear science and technology issues for the Navajo public. The scientists will make an attempt to consider the following basic questions; what is science; what is mathematics; what is nuclear radiation? Seven papers are included in this report: Navajo view of radiation; Nuclear energy, national security and international stability; ABC`s of nuclear science; Nuclear medicine: 100 years in the making; Radon in the environment; Bicarbonate leaching of uranium; and Computational methods for subsurface flow and transport. The proceedings of this workshop will be used as a valuable reference materials in future workshops and K-14 classrooms in Navajo communities that need to improve basic understanding of nuclear science and technology issues. Results of the Begay-Stevens research has revealed the existence of strange and mysterious concepts in the Navajo Language of nature. With these research results Begay and Stevens prepared a lecture entitled The Physics of Laser Fusion in the Navajo language. This lecture has been delivered in numerous Navajo schools, and in universities and colleges in the US, Canada, and Alaska.
Modelling of the indirect radiation effect due to background aerosols in Austria
International Nuclear Information System (INIS)
Neubauer, D.
2009-01-01
Aerosols and greenhouse gases are the two most important contributors to the anthropogenic climate change. The indirect aerosol effect is simulated in this study. The effects of black carbon are investigated. Usually, models use measured aerosol data as input, and their predictions are compared to cloud parameters measured independently from the aerosol measurements. The model developed in this study uses simultaneously measured values for the aerosol and the subsequent cloud. This way, more realistic predictions for the indirect aerosol effect can be expected. The model uses data from an earlier intensive measurement campaign at an Austrian background site. The aerosol and cloud data are taken from the FWF project P 131 43 - CHE and had been collected in 2000 at a measurement site on a mountain in the proximity of Vienna (Rax, 1680 m a.s.l.). The simulation model consists of two parts, a cloud droplet growth model and a radiative model. The growth model for cloud droplets computes the cloud droplet distribution originating from a measured aerosol distribution. The calculated cloud droplet size distributions that are used for further calculations are selected according to the measured liquid water content of the real-world cloud. The radiative model then computes the radiative forcing using the calculated cloud droplet size distribution. The cloud model is a cloud parcel model which describes an ascending air parcel containing the droplets. Turbulent diffusion (important for stratiform clouds) is realized through a simple approach. The model includes nucleation, condensation, coagulation and radiative effects. Because of radiative heating/cooling of the cloud droplets the temperature and the critical super-saturation of the droplets can change. For radiative transfer calculations, the radiative transfer code of the public domain program 'Streamer' was adapted for this study. 'Streamer' accounts for scattering and absorption of radiation in the whole spectral region
Radiation effect of polyether-urethane under action of different ionizing radiation
International Nuclear Information System (INIS)
Huang Wei; Chen Xiaojun; Gao Xiaoling; Xu Yunshu; Fu Yibei
2006-01-01
The research concerns in the radiation effect of γ-ray and electron beam on polyether-urethane. The thermal property and radical intensity were determined by differential thermal gravimetric analysis and electron spin resonance. The composition and content of gas products from samples irradiated by different ionizing radiation were analyzed by gas chromatography. The action mechanism of these two radiation resources of γ-ray and electron beam are same, but the means of energy deposit is different. It results in the differences of radical intensity and the thermal property of polyether-urethane as well as its gas products from the radiation decomposition. (authors)
View of environmental radiation effects from the study of radiation biology in C. elegans
International Nuclear Information System (INIS)
Sakashita, Tetsuya
2011-01-01
Caenorhabditis (C.) elegans is a non-parasitic soil nematode and is well-known as a unique model organism, because of its complete cell-lineage, nervous network and genome sequences. Also, C. elegans can be easily manipulated in the laboratory. These advantages make C. elegans as a good in vivo model system in the field of radiation biology. Radiation effects in C. elegans have been studied for three decades. Here, I briefly review the current knowledge of the biological effects of ionizing irradiation in C. elegans with a scope of environmental radiation effects. Firstly, basic information of C. elegans as a model organism is described. Secondly, historical view is reported on the study of radiation biology in C. elegans. Thirdly, our research on learning behavior is presented. Finally, an opinion of the use of C. elegans for environmental radiation protection is referred. I believe that C. elegans may be a good promising in vivo model system in the field of environmental radiation biology. (author)
International Nuclear Information System (INIS)
El-Nagger, A.M.; Ibrahim, M.S.; Said, H.M.; Zahran, A.H.
2002-01-01
The compatibility of polypropylene (P P)/polystyrene (P S) polymer blends modified through gamma radiation or accelerated electrons has been investigated. Two methods were suggested; either by exposing pp component or by exposing the melt extruded mixed polymers to both type of radiation. The modified blends were characterized by measuring the colour interceptions and observing the structure morphology by scanning electron microscope (SEM). A method was proposed depending on the measurement of the transparency (L * ) of the films of pure polymers and their blend before and after they had been modified by high-energy radiation. The transparency values were used to calculate quantitatively the percentage compatibility of pp/ps blends. The results showed that irradiation process through the two methods used in this work improved the compatibility of P P/P S blends. However, modification through exposing the mixed polymers is more effective than exposing pp component prior to melt extrusion mixing. The modification through irradiating mixed blends gamma radiation tends to yield improved modification than with E B radiation. On the other hand, the fracture surfaces of the blends examined by SEM gives further supports to the results of transparency measurements
Wideł, Maria; Przybyszewski, Waldemar; Rzeszowska-Wolny, Joanna
2009-08-18
It has long been a central radiobiological dogma that the damaging effects of ionizing radiation, such as cell death, cytogenetic changes, apoptosis, mutagenesis, and carcinogenesis, are the results of the direct ionization of cell structures, particularly DNA, or indirect damage via water radiolysis products. However, several years ago attention turned to a third mechanism of radiation, termed the "bystander effect" or "radiation-induced bystander effect" (RIBE). This is induced by agents and signals emitted by directly irradiated cells and manifests as a lowering of survival, cytogenetic damage, apoptosis enhancement, and biochemical changes in neighboring non-irradiated cells. The bystander effect is mainly observed in in vitro experiments using very low doses of alpha particles (range; mGy, cGy), but also after conventional irradiation (X-rays, gamma rays) at low as well as conventional doses. The mechanisms responsible for the bystander effect are complex and still poorly understood. It is believed that molecular signals released from irradiated cells induce different signaling ways in non-irradiated neighboring cells, leading to the observed events. The molecular signals may be transmitted through gap junction intercellular communication and through a medium transfer mechanism. The nature of these transmitted factors are diverse, and still not definitely established. It seems that RIBE may have important clinical implications for health risk associated with radiation exposure. Potentially, this effect may have important implications in the creation of whole-body or localized side effects in tissues beyond the irradiation field and also in low-dose radiological and radioisotope diagnostics. Factors emitted by irradiated cells may result in the risk of genetic instability, mutations, and second primary cancer induction. They might also have their own part in inducing and extending post-radiation side effects in normal tissue. The bystander effect may be a
Characterization of Rh films on Ta(110)
International Nuclear Information System (INIS)
Jiang, L.Q.; Ruckman, M.W.; Strongin, M.
1990-01-01
The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low-energy electron diffraction (LEED) and low-energy ion scattering (LEIS). From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh appears to grow in the Stranski--Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at -1.5 and -2.5 eV binding energy during the initial phase of thin-film growth (0 3.7 ML). CO dissociates on the Rh/Ta(110) surface for Rh coverages<2.5 ML and the surface develops a site capable of molecular CO adsorption above 0.3-ML Rh coverage
STS-110 Crew Interview: Jerry Ross
2002-01-01
STS-110 Mission Specialist Jerry Ross is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Ross outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Ross discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.
STS-110 Crew Interview: Stephen Frick
2002-01-01
STS-110 Pilot Stephen Frick is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Frick outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Frick discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.
Atomic and electronic structure of V-Rh(110) near-surface alloy
Czech Academy of Sciences Publication Activity Database
Píš, I.; Stetsovych, V.; Mysliveček, J.; Kettner, M.; Vondráček, Martin; Dvořák, F.; Mazur, D.; Matolín, V.; Nehasil, V.
2013-01-01
Roč. 117, č. 24 (2013), s. 12679-12688 ISSN 1932-7447 Institutional support: RVO:68378271 Keywords : V−Rh(110) near-surface alloy * STM * XPS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.835, year: 2013
Hawking radiation and quantum anomaly in AdS2/CFT1 correspondence
International Nuclear Information System (INIS)
Morita, Takeshi
2009-01-01
In order to understand a boundary description of Hawking radiation in the AdS/CFT correspondence, we investigate the trace anomaly method in AdS 2 space. In this method, Hawking radiation is derived from the trace anomaly of the energy-momentum tensor in the bulk. We find a correspondence between the energy-momentum tensor and a composite operator in CFT 1 and understand the anomalous properties of the energy-momentum tensor in terms of this composite operator. By using this correspondence, we reproduce Hawking radiation from the boundary description. In addition, we find a correspondence between higher-spin currents in the bulk and composite operators in the boundary.
Shashidhar, Ravindranath; Dhokane, Varsha S; Hajare, Sachin N; Sharma, Arun; Bandekar, Jayant R
2007-04-01
The microbiological quality of market samples of minimally processed (MP) pineapple was examined. The effectiveness of radiation treatment in eliminating Salmonella Typhimurium from laboratory inoculated ready-to-eat pineapple slices was also studied. Microbiological quality of minimally processed pineapple samples from Mumbai market was poor; 8.8% of the samples were positive for Salmonella. D(10) (the radiation dose required to reduce bacterial population by 90%) value for S. Typhimurium inoculated in pineapple was 0.242 kGy. Inoculated pack studies in minimally processed pineapple showed that the treatment with a 2-kGy dose of gamma radiation could eliminate 5 log CFU/g of S. Typhimurium. The pathogen was not detected from radiation-processed samples up to 12 d during storage at 4 and 10 degrees C. The processing of market samples with 1 and 2 kGy was effective in improving the microbiological quality of these products.